catalog/INDEX010064400000000000003000000026060732753274200131360ustar00rootsys00000000000000distribution layout_version 1.0 data_model_revision 2.40 uuid 3ebfa83e-80f5-11d5-b804-080009ef6421 mod_time 996062688 create_time 996062688 path_max 255 name_max 100 media sequence_number 1 product tag binutils data_model_revision 2.40 instance_id 1 control_directory binutils revision 2.11.2 title "binutils" description "GNU binary utilities. This package contains various utilities for creation and manipulation of object files, libraries, executables and core files and includes the GNU assembler required by gcc." mod_time 996062688 create_time 996062688 architecture HP-UX_B.11.00_700/800 machine_type 9000/[678]?? os_name HP-UX os_release ?.11.?? os_version * directory /opt/binutils all_filesets binutils-MAN binutils-RUN binutils-SHLIBS is_locatable false subproduct tag Manuals contents binutils-MAN subproduct tag MinimumRuntime contents binutils-SHLIBS subproduct tag Runtime contents binutils-RUN fileset tag binutils-MAN data_model_revision 2.40 instance_id 1 control_directory binutils-MAN size 284726 mod_time 996062688 create_time 996062688 state available fileset tag binutils-RUN data_model_revision 2.40 instance_id 1 control_directory binutils-RUN size 2780524 mod_time 996062689 create_time 996062689 state available fileset tag binutils-SHLIBS data_model_revision 2.40 instance_id 1 control_directory binutils-SHLIBS size 381884 mod_time 996062689 create_time 996062689 state available catalog/dfiles/INDEX010064400000000000003000000002770732753274000144040ustar00rootsys00000000000000distribution layout_version 1.0 data_model_revision 2.40 uuid 3ebfa83e-80f5-11d5-b804-080009ef6421 mod_time 996062688 create_time 996062688 path_max 255 name_max 100 media sequence_number 1 catalog/dfiles/INFO010064400000000000003000000002100732753274000142530ustar00rootsys00000000000000control_file path INDEX size 191 mode 0444 mtime 996062688 tag INDEX control_file path INFO size 197 mode 0444 mtime 996062688 tag INFO catalog/binutils/pfiles/INDEX010044400000000000003000000013240732753274000162410ustar00rootsys00000000000000product tag binutils data_model_revision 2.40 instance_id 1 control_directory binutils revision 2.11.2 title "binutils" description "GNU binary utilities. This package contains various utilities for creation and manipulation of object files, libraries, executables and core files and includes the GNU assembler required by gcc." mod_time 996062688 create_time 996062688 architecture HP-UX_B.11.00_700/800 machine_type 9000/[678]?? os_name HP-UX os_release ?.11.?? os_version * directory /opt/binutils all_filesets binutils-MAN binutils-RUN binutils-SHLIBS is_locatable false subproduct tag Manuals contents binutils-MAN subproduct tag MinimumRuntime contents binutils-SHLIBS subproduct tag Runtime contents binutils-RUN catalog/binutils/pfiles/INFO010044400000000000003000000002100732753274000161160ustar00rootsys00000000000000control_file path INDEX size 724 mode 0444 mtime 996062688 tag INDEX control_file path INFO size 197 mode 0444 mtime 996062688 tag INFO catalog/binutils/binutils-MAN/INDEX010044400000000000003000000002440732753274100172220ustar00rootsys00000000000000fileset tag binutils-MAN data_model_revision 2.40 instance_id 1 control_directory binutils-MAN size 284726 mod_time 996062688 create_time 996062688 state available catalog/binutils/binutils-MAN/INFO010044400000000000003000000034430732753274100171120ustar00rootsys00000000000000control_file path INDEX size 164 mode 0444 mtime 996062689 tag INDEX control_file path INFO size 1887 mode 0444 mtime 996062689 tag INFO file path /opt/binutils/man/man1/addr2line.1 type f size 22845 cksum 3895630952 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062225 file path /opt/binutils/man/man1/ar.1 type f size 30586 cksum 1073133829 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062223 file path /opt/binutils/man/man1/as.1 type f size 26568 cksum 2604452199 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062228 file path /opt/binutils/man/man1/c++filt.1 type f size 3151 cksum 924041188 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062226 file path /opt/binutils/man/man1/gprof.1 type f size 7585 cksum 3674192002 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062237 file path /opt/binutils/man/man1/nlmconv.1 type f size 22381 cksum 3355790120 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062225 file path /opt/binutils/man/man1/nm.1 type f size 24598 cksum 2751215540 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062223 file path /opt/binutils/man/man1/objcopy.1 type f size 25713 cksum 556565735 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062225 file path /opt/binutils/man/man1/objdump.1 type f size 28925 cksum 4203949897 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062224 file path /opt/binutils/man/man1/ranlib.1 type f size 21224 cksum 3436897922 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062224 file path /opt/binutils/man/man1/size.1 type f size 22553 cksum 3458400194 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062224 file path /opt/binutils/man/man1/strings.1 type f size 22538 cksum 3285902679 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062224 file path /opt/binutils/man/man1/strip.1 type f size 24008 cksum 441003430 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062225 catalog/binutils/binutils-RUN/INDEX010044400000000000003000000002450732753274100172540ustar00rootsys00000000000000fileset tag binutils-RUN data_model_revision 2.40 instance_id 1 control_directory binutils-RUN size 2780524 mod_time 996062689 create_time 996062689 state available catalog/binutils/binutils-RUN/INFO010044400000000000003000000072460732753274100171500ustar00rootsys00000000000000control_file path INDEX size 165 mode 0444 mtime 996062689 tag INDEX control_file path INFO size 3810 mode 0444 mtime 996062689 tag INFO file path /opt/binutils/bin/addr2line type f size 94208 cksum 4204602243 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062216 file path /opt/binutils/bin/ar type f size 61440 cksum 2972089787 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062210 file path /opt/binutils/bin/as type f size 335872 cksum 1762316375 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062232 file path /opt/binutils/bin/c++filt type f size 73728 cksum 419884549 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062222 file path /opt/binutils/bin/gasp type f size 81920 cksum 4179313277 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062233 file path /opt/binutils/bin/gprof type f size 163840 cksum 899461474 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062237 file path /opt/binutils/bin/nm type f size 110592 cksum 416492432 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062219 file path /opt/binutils/bin/objcopy type f size 262144 cksum 2663962051 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062215 file path /opt/binutils/bin/objdump type f size 262144 cksum 1205659132 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062208 file path /opt/binutils/bin/ranlib type f size 61440 cksum 357847898 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062212 file path /opt/binutils/bin/readelf type f size 200704 cksum 2586263535 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062217 file path /opt/binutils/bin/size type f size 40960 cksum 4040140868 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062206 file path /opt/binutils/bin/strings type f size 40960 cksum 357087339 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062211 file path /opt/binutils/bin/strip type f size 262144 cksum 1312713222 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062221 file path /opt/binutils/doc/COPYING type f size 18007 cksum 3009663581 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062193 file path /opt/binutils/doc/HPUX.Install type f size 3921 cksum 3498562004 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062193 file path /opt/binutils/doc/README type f size 1719 cksum 2664092825 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062193 file path /opt/binutils/include/ansidecl.h type f size 7204 cksum 383206300 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062198 file path /opt/binutils/include/bfd.h type f size 122198 cksum 2799629895 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062198 file path /opt/binutils/include/bfdlink.h type f size 22588 cksum 2045848419 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062199 file path /opt/binutils/lib/libbfd.a type f size 316480 cksum 791936046 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062198 file path /opt/binutils/lib/libbfd.la type f size 696 cksum 1307394543 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062197 file path /opt/binutils/lib/libiberty.a type f size 173340 cksum 2722579596 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062240 file path /opt/binutils/lib/libopcodes.a type f size 57580 cksum 1289928071 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062202 file path /opt/binutils/lib/libopcodes.la type f size 720 cksum 4226407637 mode 0644 uid 0 gid 3 owner 0 group 3 mtime 996062202 file path /opt/binutils/hppa2.0n-hp-hpux11.00/bin/ar type h link_source /opt/binutils/bin/ar file path /opt/binutils/hppa2.0n-hp-hpux11.00/bin/as type h link_source /opt/binutils/bin/as file path /opt/binutils/hppa2.0n-hp-hpux11.00/bin/nm type h link_source /opt/binutils/bin/nm file path /opt/binutils/hppa2.0n-hp-hpux11.00/bin/ranlib type h link_source /opt/binutils/bin/ranlib file path /opt/binutils/hppa2.0n-hp-hpux11.00/bin/strip type h link_source /opt/binutils/bin/strip catalog/binutils/binutils-SHLIBS/INDEX010044400000000000003000000002520732753274100175720ustar00rootsys00000000000000fileset tag binutils-SHLIBS data_model_revision 2.40 instance_id 1 control_directory binutils-SHLIBS size 381884 mod_time 996062689 create_time 996062689 state available catalog/binutils/binutils-SHLIBS/INFO010044400000000000003000000012610732753274200174600ustar00rootsys00000000000000control_file path INDEX size 170 mode 0444 mtime 996062689 tag INDEX control_file path INFO size 750 mode 0444 mtime 996062690 tag INFO file path /opt/binutils/lib/libbfd-2.11.2.sl type f size 303104 cksum 2806738702 mode 0555 uid 0 gid 3 owner 0 group 3 mtime 996062197 file path /opt/binutils/lib/libbfd.sl type s size 16 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062245 link_source libbfd-2.11.2.sl file path /opt/binutils/lib/libopcodes-2.11.2.sl type f size 77824 cksum 2434426464 mode 0555 uid 0 gid 3 owner 0 group 3 mtime 996062201 file path /opt/binutils/lib/libopcodes.sl type s size 20 mode 0755 uid 0 gid 3 owner 0 group 3 mtime 996062245 link_source libopcodes-2.11.2.sl binutils/binutils-MAN/opt/binutils/man/man1/addr2line.1010064400000000000003000000544750732753202100215160ustar000300000000000000.\" Copyright (c) 1997, 2000 Free Software Foundation .\" See COPYING for conditions for redistribution .TH addr2line 1 "27 March 1997" "Free Software Foundation" "GNU Development Tools" .de BP .sp .ti \-.2i \(** .. .SH NAME addr2line \- convert addresses into file names and line numbers .SH SYNOPSIS .hy 0 .na .TP .B addr2line .RB "[\|" "\-b\ "\c .I bfdname\c .RB " | " "\-\-target="\c .I bfdname\c \&\|] .RB "[\|" \-C | \-\-demangle "\|]" .RB "[\|" "\-e\ "\c .I filename\c .RB " | " "\-\-exe="\c .I filename\c \&\|] .RB "[\|" \-f | \-\-functions "\|]" .RB "[\|" \-s | \-\-basenames "\|]" .RB "[\|" \-H | \-\-help "\|]" .RB "[\|" \-V | \-\-version "\|]" .RB "[\|" addr addr ... "\|]" .ad b .hy 1 .SH DESCRIPTION \c .B addr2line translates program addresses into file names and line numbers. Given an address and an executable, it uses the debugging information in the executable to figure out which file name and line number are associated with a given address. The executable to use is specified with the .B \-e option. The default is .B a.out\c \&. .B addr2line has two modes of operation. In the first, hexadecimal addresses are specified on the command line, and .B addr2line displays the file name and line number for each address. In the second, .B addr2line reads hexadecimal addresses from standard input, and prints the file name and line number for each address on standard output. In this mode, .B addr2line may be used in a pipe to convert dynamically chosen addresses. The format of the output is FILENAME:LINENO. The file name and line number for each address is printed on a separate line. If the .B \-f option is used, then each FILENAME:LINENO line is preceded by a FUNCTIONNAME line which is the name of the function containing the address. If the file name or function name can not be determined, .B addr2line will print two question marks in their place. If the line number can not be determined, .B addr2line will print 0. .SH OPTIONS .TP .BI "\-b " "bfdname"\c .TP .BI "\-\-target=" "bfdname" Specify the object-code format for the object files to be \c .I bfdname\c \&. .TP .B \-C .TP .B \-\-demangle Decode (\fIdemangle\fP) low-level symbol names into user-level names. Besides removing any initial underscore prepended by the system, this makes C++ function names readable. .TP .BI "\-e " "filename"\c .TP .BI "\-\-exe=" "filename" Specify the name of the executable for which addresses should be translated. The default file is .B a.out\c \&. .TP .B \-f .TP .B \-\-functions Display function names as well as file and line number information. .TP .B \-s .TP .B \-\-basenames Display only the base of each file name. .SH "SEE ALSO" .RB "`\|" binutils "\|'" entry in .B info\c \&; .I The GNU Binary Utilities\c \&, Roland H. Pesch (October 1991). .SH COPYING Copyright (c) 1993, 94, 95, 96, 97, 98, 1999, 2000 Free Software Foundation, Inc. .PP This document is distributed under the terms of the GNU Free Documentation License, version 1.1. That license is described in the sources for this manual page, but it is not displayed here in order to make this manual more consise. Copies of this license can also be obtained from: http://www.gnu.org/copyleft/. \" .SH GNU Free Documentation License \" Version 1.1, March 2000 \" Copyright (C) 2000 Free Software Foundation, Inc. \" 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA \" Everyone is permitted to copy and distribute verbatim \" copies of this license document, but changing it is \" not allowed. \" .PP \" 0. PREAMBLE \" .PP \" The purpose of this License is to make a manual, textbook, or other \" written document "free" in the sense of freedom: to assure everyone \" the effective freedom to copy and redistribute it, with or without \" modifying it, either commercially or noncommercially. Secondarily, \" this License preserves for the author and publisher a way to get \" credit for their work, while not being considered responsible for \" modifications made by others. \" .PP \" This License is a kind of "copyleft", which means that derivative \" works of the document must themselves be free in the same sense. It \" complements the GNU General Public License, which is a copyleft \" license designed for free software. \" .PP \" We have designed this License in order to use it for manuals for free \" software, because free software needs free documentation: a free \" program should come with manuals providing the same freedoms that the \" software does. But this License is not limited to software manuals; \" it can be used for any textual work, regardless of subject matter or \" whether it is published as a printed book. We recommend this License \" principally for works whose purpose is instruction or reference. \" .PP \" 1. APPLICABILITY AND DEFINITIONS \" .PP \" This License applies to any manual or other work that contains a \" notice placed by the copyright holder saying it can be distributed \" under the terms of this License. The "Document", below, refers to any \" such manual or work. Any member of the public is a licensee, and is \" addressed as "you". \" .PP \" A "Modified Version" of the Document means any work containing the \" Document or a portion of it, either copied verbatim, or with \" modifications and/or translated into another language. \" .PP \" A "Secondary Section" is a named appendix or a front-matter section of \" the Document that deals exclusively with the relationship of the \" publishers or authors of the Document to the Document's overall subject \" (or to related matters) and contains nothing that could fall directly \" within that overall subject. (For example, if the Document is in part a \" textbook of mathematics, a Secondary Section may not explain any \" mathematics.) The relationship could be a matter of historical \" connection with the subject or with related matters, or of legal, \" commercial, philosophical, ethical or political position regarding \" them. \" .PP \" The "Invariant Sections" are certain Secondary Sections whose titles \" are designated, as being those of Invariant Sections, in the notice \" that says that the Document is released under this License. \" .PP \" The "Cover Texts" are certain short passages of text that are listed, \" as Front-Cover Texts or Back-Cover Texts, in the notice that says that \" the Document is released under this License. \" .PP \" A "Transparent" copy of the Document means a machine-readable copy, \" represented in a format whose specification is available to the \" general public, whose contents can be viewed and edited directly and \" straightforwardly with generic text editors or (for images composed of \" pixels) generic paint programs or (for drawings) some widely available \" drawing editor, and that is suitable for input to text formatters or \" for automatic translation to a variety of formats suitable for input \" to text formatters. A copy made in an otherwise Transparent file \" format whose markup has been designed to thwart or discourage \" subsequent modification by readers is not Transparent. A copy that is \" not "Transparent" is called "Opaque". \" .PP \" Examples of suitable formats for Transparent copies include plain \" ASCII without markup, Texinfo input format, LaTeX input format, SGML \" or XML using a publicly available DTD, and standard-conforming simple \" HTML designed for human modification. Opaque formats include \" PostScript, PDF, proprietary formats that can be read and edited only \" by proprietary word processors, SGML or XML for which the DTD and/or \" processing tools are not generally available, and the \" machine-generated HTML produced by some word processors for output \" purposes only. \" .PP \" The "Title Page" means, for a printed book, the title page itself, \" plus such following pages as are needed to hold, legibly, the material \" this License requires to appear in the title page. For works in \" formats which do not have any title page as such, "Title Page" means \" the text near the most prominent appearance of the work's title, \" preceding the beginning of the body of the text. \" .PP \" 2. VERBATIM COPYING \" .PP \" You may copy and distribute the Document in any medium, either \" commercially or noncommercially, provided that this License, the \" copyright notices, and the license notice saying this License applies \" to the Document are reproduced in all copies, and that you add no other \" conditions whatsoever to those of this License. You may not use \" technical measures to obstruct or control the reading or further \" copying of the copies you make or distribute. However, you may accept \" compensation in exchange for copies. If you distribute a large enough \" number of copies you must also follow the conditions in section 3. \" .PP \" You may also lend copies, under the same conditions stated above, and \" you may publicly display copies. \" .PP \" 3. COPYING IN QUANTITY \" .PP \" If you publish printed copies of the Document numbering more than 100, \" and the Document's license notice requires Cover Texts, you must enclose \" the copies in covers that carry, clearly and legibly, all these Cover \" Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on \" the back cover. Both covers must also clearly and legibly identify \" you as the publisher of these copies. The front cover must present \" the full title with all words of the title equally prominent and \" visible. You may add other material on the covers in addition. \" Copying with changes limited to the covers, as long as they preserve \" the title of the Document and satisfy these conditions, can be treated \" as verbatim copying in other respects. \" .PP \" If the required texts for either cover are too voluminous to fit \" legibly, you should put the first ones listed (as many as fit \" reasonably) on the actual cover, and continue the rest onto adjacent \" pages. \" .PP \" If you publish or distribute Opaque copies of the Document numbering \" more than 100, you must either include a machine-readable Transparent \" copy along with each Opaque copy, or state in or with each Opaque copy \" a publicly-accessible computer-network location containing a complete \" Transparent copy of the Document, free of added material, which the \" general network-using public has access to download anonymously at no \" charge using public-standard network protocols. If you use the latter \" option, you must take reasonably prudent steps, when you begin \" distribution of Opaque copies in quantity, to ensure that this \" Transparent copy will remain thus accessible at the stated location \" until at least one year after the last time you distribute an Opaque \" copy (directly or through your agents or retailers) of that edition to \" the public. \" .PP \" It is requested, but not required, that you contact the authors of the \" Document well before redistributing any large number of copies, to give \" them a chance to provide you with an updated version of the Document. \" .PP \" 4. MODIFICATIONS \" .PP \" You may copy and distribute a Modified Version of the Document under \" the conditions of sections 2 and 3 above, provided that you release \" the Modified Version under precisely this License, with the Modified \" Version filling the role of the Document, thus licensing distribution \" and modification of the Modified Version to whoever possesses a copy \" of it. In addition, you must do these things in the Modified Version: \" .PP \" A. Use in the Title Page (and on the covers, if any) a title distinct \" from that of the Document, and from those of previous versions \" (which should, if there were any, be listed in the History section \" of the Document). You may use the same title as a previous version \" if the original publisher of that version gives permission. \" .PP \" B. List on the Title Page, as authors, one or more persons or entities \" responsible for authorship of the modifications in the Modified \" Version, together with at least five of the principal authors of the \" Document (all of its principal authors, if it has less than five). \" .PP \" C. State on the Title page the name of the publisher of the \" Modified Version, as the publisher. \" .PP \" D. Preserve all the copyright notices of the Document. \" .PP \" E. Add an appropriate copyright notice for your modifications \" adjacent to the other copyright notices. \" .PP \" F. Include, immediately after the copyright notices, a license notice \" giving the public permission to use the Modified Version under the \" terms of this License, in the form shown in the Addendum below. \" Preserve in that license notice the full lists of Invariant Sections \" and required Cover Texts given in the Document's license notice. \" .PP \" H. Include an unaltered copy of this License. \" .PP \" I. Preserve the section entitled "History", and its title, and add to \" it an item stating at least the title, year, new authors, and \" publisher of the Modified Version as given on the Title Page. If \" there is no section entitled "History" in the Document, create one \" stating the title, year, authors, and publisher of the Document as \" given on its Title Page, then add an item describing the Modified \" Version as stated in the previous sentence. \" .PP \" J. Preserve the network location, if any, given in the Document for \" public access to a Transparent copy of the Document, and likewise \" the network locations given in the Document for previous versions \" it was based on. These may be placed in the "History" section. \" You may omit a network location for a work that was published at \" least four years before the Document itself, or if the original \" publisher of the version it refers to gives permission. \" .PP \" K. In any section entitled "Acknowledgements" or "Dedications", \" preserve the section's title, and preserve in the section all the \" substance and tone of each of the contributor acknowledgements \" and/or dedications given therein. \" .PP \" L. Preserve all the Invariant Sections of the Document, \" unaltered in their text and in their titles. Section numbers \" or the equivalent are not considered part of the section titles. \" .PP \" M. Delete any section entitled "Endorsements". Such a section \" may not be included in the Modified Version. \" .PP \" N. Do not retitle any existing section as "Endorsements" \" or to conflict in title with any Invariant Section. \" .PP \" If the Modified Version includes new front-matter sections or \" appendices that qualify as Secondary Sections and contain no material \" copied from the Document, you may at your option designate some or all \" of these sections as invariant. To do this, add their titles to the \" list of Invariant Sections in the Modified Version's license notice. \" These titles must be distinct from any other section titles. \" .PP \" You may add a section entitled "Endorsements", provided it contains \" nothing but endorsements of your Modified Version by various \" parties--for example, statements of peer review or that the text has \" been approved by an organization as the authoritative definition of a \" standard. \" .PP \" You may add a passage of up to five words as a Front-Cover Text, and a \" passage of up to 25 words as a Back-Cover Text, to the end of the list \" of Cover Texts in the Modified Version. Only one passage of \" Front-Cover Text and one of Back-Cover Text may be added by (or \" through arrangements made by) any one entity. If the Document already \" includes a cover text for the same cover, previously added by you or \" by arrangement made by the same entity you are acting on behalf of, \" you may not add another; but you may replace the old one, on explicit \" permission from the previous publisher that added the old one. \" .PP \" The author(s) and publisher(s) of the Document do not by this License \" give permission to use their names for publicity for or to assert or \" imply endorsement of any Modified Version. \" .PP \" 5. COMBINING DOCUMENTS \" .PP \" You may combine the Document with other documents released under this \" License, under the terms defined in section 4 above for modified \" versions, provided that you include in the combination all of the \" Invariant Sections of all of the original documents, unmodified, and \" list them all as Invariant Sections of your combined work in its \" license notice. \" .PP \" The combined work need only contain one copy of this License, and \" multiple identical Invariant Sections may be replaced with a single \" copy. If there are multiple Invariant Sections with the same name but \" different contents, make the title of each such section unique by \" adding at the end of it, in parentheses, the name of the original \" author or publisher of that section if known, or else a unique number. \" Make the same adjustment to the section titles in the list of \" Invariant Sections in the license notice of the combined work. \" .PP \" In the combination, you must combine any sections entitled "History" \" in the various original documents, forming one section entitled \" "History"; likewise combine any sections entitled "Acknowledgements", \" and any sections entitled "Dedications". You must delete all sections \" entitled "Endorsements." \" .PP \" 6. COLLECTIONS OF DOCUMENTS \" .PP \" You may make a collection consisting of the Document and other documents \" released under this License, and replace the individual copies of this \" License in the various documents with a single copy that is included in \" the collection, provided that you follow the rules of this License for \" verbatim copying of each of the documents in all other respects. \" .PP \" You may extract a single document from such a collection, and distribute \" it individually under this License, provided you insert a copy of this \" License into the extracted document, and follow this License in all \" other respects regarding verbatim copying of that document. \" .PP \" 7. AGGREGATION WITH INDEPENDENT WORKS \" .PP \" A compilation of the Document or its derivatives with other separate \" and independent documents or works, in or on a volume of a storage or \" distribution medium, does not as a whole count as a Modified Version \" of the Document, provided no compilation copyright is claimed for the \" compilation. Such a compilation is called an "aggregate", and this \" License does not apply to the other self-contained works thus compiled \" with the Document, on account of their being thus compiled, if they \" are not themselves derivative works of the Document. \" .PP \" If the Cover Text requirement of section 3 is applicable to these \" copies of the Document, then if the Document is less than one quarter \" of the entire aggregate, the Document's Cover Texts may be placed on \" covers that surround only the Document within the aggregate. \" Otherwise they must appear on covers around the whole aggregate. \" .PP \" 8. TRANSLATION \" .PP \" Translation is considered a kind of modification, so you may \" distribute translations of the Document under the terms of section 4. \" Replacing Invariant Sections with translations requires special \" permission from their copyright holders, but you may include \" translations of some or all Invariant Sections in addition to the \" original versions of these Invariant Sections. You may include a \" translation of this License provided that you also include the \" original English version of this License. In case of a disagreement \" between the translation and the original English version of this \" License, the original English version will prevail. \" .PP \" 9. TERMINATION \" .PP \" You may not copy, modify, sublicense, or distribute the Document except \" as expressly provided for under this License. Any other attempt to \" copy, modify, sublicense or distribute the Document is void, and will \" automatically terminate your rights under this License. However, \" parties who have received copies, or rights, from you under this \" License will not have their licenses terminated so long as such \" parties remain in full compliance. \" .PP \" 10. FUTURE REVISIONS OF THIS LICENSE \" .PP \" The Free Software Foundation may publish new, revised versions \" of the GNU Free Documentation License from time to time. Such new \" versions will be similar in spirit to the present version, but may \" differ in detail to address new problems or concerns. See \" http://www.gnu.org/copyleft/. \" .PP \" Each version of the License is given a distinguishing version number. \" If the Document specifies that a particular numbered version of this \" License "or any later version" applies to it, you have the option of \" following the terms and conditions either of that specified version or \" of any later version that has been published (not as a draft) by the \" Free Software Foundation. If the Document does not specify a version \" number of this License, you may choose any version ever published (not \" as a draft) by the Free Software Foundation. \" .PP \" ADDENDUM: How to use this License for your documents \" .PP \" To use this License in a document you have written, include a copy of \" the License in the document and put the following copyright and \" license notices just after the title page: \" .PP \" Copyright (c) YEAR YOUR NAME. \" Permission is granted to copy, distribute and/or \" modify this document under the terms of the GNU \" Free Documentation License, Version 1.1 or any later \" version published by the Free Software Foundation; \" with the Invariant Sections being LIST THEIR TITLES, \" with the Front-Cover Texts being LIST, and with the \" Back-Cover Texts being LIST. A copy of the license \" is included in the section entitled "GNU Free \" Documentation License". \" .PP \" If you have no Invariant Sections, write "with no Invariant Sections" \" instead of saying which ones are invariant. If you have no \" Front-Cover Texts, write "no Front-Cover Texts" instead of \" "Front-Cover Texts being LIST"; likewise for Back-Cover Texts. \" .PP \" If your document contains nontrivial examples of program code, we \" recommend releasing these examples in parallel under your choice of \" free software license, such as the GNU General Public License, \" to permit their use in free software. binutils/binutils-MAN/opt/binutils/man/man1/ar.1010064400000000000003000000735720732753201700202600ustar000300000000000000.\" Copyright (c) 1991, 1992, 1993, 1995, 1998, 1999, 2000 Free Software Foundation .\" See section COPYING for conditions for redistribution .TH ar 1 "1999" "Free Software Foundation" "GNU Development Tools" .de BP .sp .ti \-.2i \(** .. .SH NAME ar \- create, modify, and extract from archives. .SH SYNOPSIS .hy 0 .na .BR ar " [\|" "-" "\|]"\c .I {dmpqrtx}[abcfilNoPsSuvV] \c [\|\c .I membername\c \&\|] \c [\|\c .I count\c \&\|] \c .I archive\c \& \c .I files\c \&.\|.\|. .ad b .hy 1 .SH DESCRIPTION The GNU \c .B ar\c \& program creates, modifies, and extracts from archives. An \c .I archive\c \& is a single file holding a collection of other files in a structure that makes it possible to retrieve the original individual files (called \c .I members\c \& of the archive). The original files' contents, mode (permissions), timestamp, owner, and group are preserved in the archive, and may be reconstituted on extraction. GNU \c .B ar\c \& can maintain archives whose members have names of any length; however, depending on how \c .B ar\c \& is configured on your system, a limit on member-name length may be imposed (for compatibility with archive formats maintained with other tools). If it exists, the limit is often 15 characters (typical of formats related to a.out) or 16 characters (typical of formats related to coff). \c .B ar\c \& is considered a binary utility because archives of this sort are most often used as \c .I libraries\c \& holding commonly needed subroutines. \c .B ar\c \& will create an index to the symbols defined in relocatable object modules in the archive when you specify the modifier `\|\c .B s\c \|'. Once created, this index is updated in the archive whenever \c .B ar\c \& makes a change to its contents (save for the `\|\c .B q\c \|' update operation). An archive with such an index speeds up linking to the library, and allows routines in the library to call each other without regard to their placement in the archive. You may use `\|\c .B nm \-s\c \|' or `\|\c .B nm \-\-print\-armap\c \|' to list this index table. If an archive lacks the table, another form of \c .B ar\c \& called \c .B ranlib\c \& can be used to add just the table. \c .B ar\c \& insists on at least two arguments to execute: one keyletter specifying the \c .I operation\c \& (optionally accompanied by other keyletters specifying \c .I modifiers\c \&), and the archive name to act on. Most operations can also accept further \c .I files\c \& arguments, specifying particular files to operate on. .SH OPTIONS GNU \c .B ar\c \& allows you to mix the operation code \c .I p\c \& and modifier flags \c .I mod\c \& in any order, within the first command-line argument. If you wish, you may begin the first command-line argument with a dash. The \c .I p\c \& keyletter specifies what operation to execute; it may be any of the following, but you must specify only one of them: .TP .B d \c .I Delete\c \& modules from the archive. Specify the names of modules to be deleted as \c .I files\c \&; the archive is untouched if you specify no files to delete. If you specify the `\|\c .B v\c \|' modifier, \c .B ar\c \& will list each module as it is deleted. .TP .B m Use this operation to \c .I move\c \& members in an archive. The ordering of members in an archive can make a difference in how programs are linked using the library, if a symbol is defined in more than one member. If no modifiers are used with \c .B m\c \&, any members you name in the \c .I files\c \& arguments are moved to the \c .I end\c \& of the archive; you can use the `\|\c .B a\c \|', `\|\c .B b\c \|', or `\|\c .B i\c \|' modifiers to move them to a specified place instead. .TP .B p \c .I Print\c \& the specified members of the archive, to the standard output file. If the `\|\c .B v\c \|' modifier is specified, show the member name before copying its contents to standard output. If you specify no \c .I files\c \&, all the files in the archive are printed. .TP .B q \c .I Quick append\c \&; add \c .I files\c \& to the end of \c .I archive\c \&, without checking for replacement. The modifiers `\|\c .B a\c \|', `\|\c .B b\c \|', and `\|\c .B i\c \|' do \c .I not\c \& affect this operation; new members are always placed at the end of the archive. The modifier `\|\c .B v\c \|' makes \c .B ar\c \& list each file as it is appended. Since the point of this operation is speed, the archive's symbol table index is not updated, even if it already existed; you can use `\|\c .B ar s\c \|' or \c .B ranlib\c \& explicitly to update the symbol table index. However, too many different systems assume quick append rebuilds the index, so GNU .B ar implements `\|\c .B q\c \|' as a synonym for `\|\c .B r\c \|'. .TP .B r Insert \c .I files\c \& into \c .I archive\c \& (with \c .I replacement\c \&). This operation differs from `\|\c .B q\c \|' in that any previously existing members are deleted if their names match those being added. If one of the files named in \c .I files\c \& doesn't exist, \c .B ar\c \& displays an error message, and leaves undisturbed any existing members of the archive matching that name. By default, new members are added at the end of the file; but you may use one of the modifiers `\|\c .B a\c \|', `\|\c .B b\c \|', or `\|\c .B i\c \|' to request placement relative to some existing member. The modifier `\|\c .B v\c \|' used with this operation elicits a line of output for each file inserted, along with one of the letters `\|\c .B a\c \|' or `\|\c .B r\c \|' to indicate whether the file was appended (no old member deleted) or replaced. .TP .B t Display a \c .I table\c \& listing the contents of \c .I archive\c \&, or those of the files listed in \c .I files\c \& that are present in the archive. Normally only the member name is shown; if you also want to see the modes (permissions), timestamp, owner, group, and size, you can request that by also specifying the `\|\c .B v\c \|' modifier. If you do not specify any \c .I files\c \&, all files in the archive are listed. If there is more than one file with the same name (say, `\|\c .B fie\c \|') in an archive (say `\|\c .B b.a\c \|'), `\|\c .B ar t b.a fie\c \|' will list only the first instance; to see them all, you must ask for a complete listing\(em\&in our example, `\|\c .B ar t b.a\c \|'. .TP .B x \c .I Extract\c \& members (named \c .I files\c \&) from the archive. You can use the `\|\c .B v\c \|' modifier with this operation, to request that \c .B ar\c \& list each name as it extracts it. If you do not specify any \c .I files\c \&, all files in the archive are extracted. .PP A number of modifiers (\c .I mod\c \&) may immediately follow the \c .I p\c \& keyletter, to specify variations on an operation's behavior: .TP .B a Add new files \c .I after\c \& an existing member of the archive. If you use the modifier \c .B a\c \&, the name of an existing archive member must be present as the \c .I membername\c \& argument, before the \c .I archive\c \& specification. .TP .B b Add new files \c .I before\c \& an existing member of the archive. If you use the modifier \c .B b\c \&, the name of an existing archive member must be present as the \c .I membername\c \& argument, before the \c .I archive\c \& specification. (same as `\|\c .B i\c \|'). .TP .B c \c .I Create\c \& the archive. The specified \c .I archive\c \& is always created if it didn't exist, when you request an update. But a warning is issued unless you specify in advance that you expect to create it, by using this modifier. .TP .B f Truncate names in the archive. .B ar will normally permit file names of any length. This will cause it to create archives which are not compatible with the native .B ar program on some systems. If this is a concern, the .B f modifier may be used to truncate file names when putting them in the archive. .TP .B i Insert new files \c .I before\c \& an existing member of the archive. If you use the modifier \c .B i\c \&, the name of an existing archive member must be present as the \c .I membername\c \& argument, before the \c .I archive\c \& specification. (same as `\|\c .B b\c \|'). .TP .B l This modifier is accepted but not used. .TP .B N Uses the .I count parameter. This is used if there are multiple entries in the archive with the same name. Extract or delete instance .I count of the given name from the archive. .TP .B o Preserve the \c .I original\c \& dates of members when extracting them. If you do not specify this modifier, files extracted from the archive will be stamped with the time of extraction. .TP .B P Use the full path name when matching names in the archive. .B ar can not create an archive with a full path name (such archives are not POSIX complaint), but other archive creators can. This option will cause .B ar to match file names using a complete path name, which can be convenient when extracting a single file from an archive created by another tool. .TP .B s Write an object-file index into the archive, or update an existing one, even if no other change is made to the archive. You may use this modifier flag either with any operation, or alone. Running `\|\c .B ar s\c \|' on an archive is equivalent to running `\|\c .B ranlib\c \|' on it. .TP .B S Do not generate an archive symbol table. This can speed up building a large library in several steps. The resulting archive can not be used with the linker. In order to build a symbol table, you must omit the `\|\c .B S\c \|' modifier on the last execution of `\|\c .B ar\c \|', or you must run `\|\c .B ranlib\c \|' on the archive. .TP .B u Normally, \c .B ar r\c \&.\|.\|. inserts all files listed into the archive. If you would like to insert \c .I only\c \& those of the files you list that are newer than existing members of the same names, use this modifier. The `\|\c .B u\c \|' modifier is allowed only for the operation `\|\c .B r\c \|' (replace). In particular, the combination `\|\c .B qu\c \|' is not allowed, since checking the timestamps would lose any speed advantage from the operation `\|\c .B q\c \|'. .TP .B v This modifier requests the \c .I verbose\c \& version of an operation. Many operations display additional information, such as filenames processed, when the modifier `\|\c .B v\c \|' is appended. .TP .B V This modifier shows the version number of .BR ar . .PP .SH "SEE ALSO" .RB "`\|" binutils "\|'" entry in .B info\c \&; .I The GNU Binary Utilities\c , Roland H. Pesch (October 1991). .BR nm ( 1 )\c \&, .BR ranlib ( 1 )\c \&. .SH COPYING Copyright (c) 1991, 1992, 1993, 1995, 1998, 1999, 2000 Free Software Foundation, Inc. .PP This document is distributed under the terms of the GNU Free Documentation License, version 1.1. That license is described in the sources for this manual page, but it is not displayed here in order to make this manual more consise. Copies of this license can also be obtained from: http://www.gnu.org/copyleft/. \" .SH GNU Free Documentation License \" Version 1.1, March 2000 \" Copyright (C) 2000 Free Software Foundation, Inc. \" 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA \" Everyone is permitted to copy and distribute verbatim \" copies of this license document, but changing it is \" not allowed. \" .PP \" 0. PREAMBLE \" .PP \" The purpose of this License is to make a manual, textbook, or other \" written document "free" in the sense of freedom: to assure everyone \" the effective freedom to copy and redistribute it, with or without \" modifying it, either commercially or noncommercially. Secondarily, \" this License preserves for the author and publisher a way to get \" credit for their work, while not being considered responsible for \" modifications made by others. \" .PP \" This License is a kind of "copyleft", which means that derivative \" works of the document must themselves be free in the same sense. It \" complements the GNU General Public License, which is a copyleft \" license designed for free software. \" .PP \" We have designed this License in order to use it for manuals for free \" software, because free software needs free documentation: a free \" program should come with manuals providing the same freedoms that the \" software does. But this License is not limited to software manuals; \" it can be used for any textual work, regardless of subject matter or \" whether it is published as a printed book. We recommend this License \" principally for works whose purpose is instruction or reference. \" .PP \" 1. APPLICABILITY AND DEFINITIONS \" .PP \" This License applies to any manual or other work that contains a \" notice placed by the copyright holder saying it can be distributed \" under the terms of this License. The "Document", below, refers to any \" such manual or work. Any member of the public is a licensee, and is \" addressed as "you". \" .PP \" A "Modified Version" of the Document means any work containing the \" Document or a portion of it, either copied verbatim, or with \" modifications and/or translated into another language. \" .PP \" A "Secondary Section" is a named appendix or a front-matter section of \" the Document that deals exclusively with the relationship of the \" publishers or authors of the Document to the Document's overall subject \" (or to related matters) and contains nothing that could fall directly \" within that overall subject. (For example, if the Document is in part a \" textbook of mathematics, a Secondary Section may not explain any \" mathematics.) The relationship could be a matter of historical \" connection with the subject or with related matters, or of legal, \" commercial, philosophical, ethical or political position regarding \" them. \" .PP \" The "Invariant Sections" are certain Secondary Sections whose titles \" are designated, as being those of Invariant Sections, in the notice \" that says that the Document is released under this License. \" .PP \" The "Cover Texts" are certain short passages of text that are listed, \" as Front-Cover Texts or Back-Cover Texts, in the notice that says that \" the Document is released under this License. \" .PP \" A "Transparent" copy of the Document means a machine-readable copy, \" represented in a format whose specification is available to the \" general public, whose contents can be viewed and edited directly and \" straightforwardly with generic text editors or (for images composed of \" pixels) generic paint programs or (for drawings) some widely available \" drawing editor, and that is suitable for input to text formatters or \" for automatic translation to a variety of formats suitable for input \" to text formatters. A copy made in an otherwise Transparent file \" format whose markup has been designed to thwart or discourage \" subsequent modification by readers is not Transparent. A copy that is \" not "Transparent" is called "Opaque". \" .PP \" Examples of suitable formats for Transparent copies include plain \" ASCII without markup, Texinfo input format, LaTeX input format, SGML \" or XML using a publicly available DTD, and standard-conforming simple \" HTML designed for human modification. Opaque formats include \" PostScript, PDF, proprietary formats that can be read and edited only \" by proprietary word processors, SGML or XML for which the DTD and/or \" processing tools are not generally available, and the \" machine-generated HTML produced by some word processors for output \" purposes only. \" .PP \" The "Title Page" means, for a printed book, the title page itself, \" plus such following pages as are needed to hold, legibly, the material \" this License requires to appear in the title page. For works in \" formats which do not have any title page as such, "Title Page" means \" the text near the most prominent appearance of the work's title, \" preceding the beginning of the body of the text. \" .PP \" 2. VERBATIM COPYING \" .PP \" You may copy and distribute the Document in any medium, either \" commercially or noncommercially, provided that this License, the \" copyright notices, and the license notice saying this License applies \" to the Document are reproduced in all copies, and that you add no other \" conditions whatsoever to those of this License. You may not use \" technical measures to obstruct or control the reading or further \" copying of the copies you make or distribute. However, you may accept \" compensation in exchange for copies. If you distribute a large enough \" number of copies you must also follow the conditions in section 3. \" .PP \" You may also lend copies, under the same conditions stated above, and \" you may publicly display copies. \" .PP \" 3. COPYING IN QUANTITY \" .PP \" If you publish printed copies of the Document numbering more than 100, \" and the Document's license notice requires Cover Texts, you must enclose \" the copies in covers that carry, clearly and legibly, all these Cover \" Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on \" the back cover. Both covers must also clearly and legibly identify \" you as the publisher of these copies. The front cover must present \" the full title with all words of the title equally prominent and \" visible. You may add other material on the covers in addition. \" Copying with changes limited to the covers, as long as they preserve \" the title of the Document and satisfy these conditions, can be treated \" as verbatim copying in other respects. \" .PP \" If the required texts for either cover are too voluminous to fit \" legibly, you should put the first ones listed (as many as fit \" reasonably) on the actual cover, and continue the rest onto adjacent \" pages. \" .PP \" If you publish or distribute Opaque copies of the Document numbering \" more than 100, you must either include a machine-readable Transparent \" copy along with each Opaque copy, or state in or with each Opaque copy \" a publicly-accessible computer-network location containing a complete \" Transparent copy of the Document, free of added material, which the \" general network-using public has access to download anonymously at no \" charge using public-standard network protocols. If you use the latter \" option, you must take reasonably prudent steps, when you begin \" distribution of Opaque copies in quantity, to ensure that this \" Transparent copy will remain thus accessible at the stated location \" until at least one year after the last time you distribute an Opaque \" copy (directly or through your agents or retailers) of that edition to \" the public. \" .PP \" It is requested, but not required, that you contact the authors of the \" Document well before redistributing any large number of copies, to give \" them a chance to provide you with an updated version of the Document. \" .PP \" 4. MODIFICATIONS \" .PP \" You may copy and distribute a Modified Version of the Document under \" the conditions of sections 2 and 3 above, provided that you release \" the Modified Version under precisely this License, with the Modified \" Version filling the role of the Document, thus licensing distribution \" and modification of the Modified Version to whoever possesses a copy \" of it. In addition, you must do these things in the Modified Version: \" .PP \" A. Use in the Title Page (and on the covers, if any) a title distinct \" from that of the Document, and from those of previous versions \" (which should, if there were any, be listed in the History section \" of the Document). You may use the same title as a previous version \" if the original publisher of that version gives permission. \" .PP \" B. List on the Title Page, as authors, one or more persons or entities \" responsible for authorship of the modifications in the Modified \" Version, together with at least five of the principal authors of the \" Document (all of its principal authors, if it has less than five). \" .PP \" C. State on the Title page the name of the publisher of the \" Modified Version, as the publisher. \" .PP \" D. Preserve all the copyright notices of the Document. \" .PP \" E. Add an appropriate copyright notice for your modifications \" adjacent to the other copyright notices. \" .PP \" F. Include, immediately after the copyright notices, a license notice \" giving the public permission to use the Modified Version under the \" terms of this License, in the form shown in the Addendum below. \" Preserve in that license notice the full lists of Invariant Sections \" and required Cover Texts given in the Document's license notice. \" .PP \" H. Include an unaltered copy of this License. \" .PP \" I. Preserve the section entitled "History", and its title, and add to \" it an item stating at least the title, year, new authors, and \" publisher of the Modified Version as given on the Title Page. If \" there is no section entitled "History" in the Document, create one \" stating the title, year, authors, and publisher of the Document as \" given on its Title Page, then add an item describing the Modified \" Version as stated in the previous sentence. \" .PP \" J. Preserve the network location, if any, given in the Document for \" public access to a Transparent copy of the Document, and likewise \" the network locations given in the Document for previous versions \" it was based on. These may be placed in the "History" section. \" You may omit a network location for a work that was published at \" least four years before the Document itself, or if the original \" publisher of the version it refers to gives permission. \" .PP \" K. In any section entitled "Acknowledgements" or "Dedications", \" preserve the section's title, and preserve in the section all the \" substance and tone of each of the contributor acknowledgements \" and/or dedications given therein. \" .PP \" L. Preserve all the Invariant Sections of the Document, \" unaltered in their text and in their titles. Section numbers \" or the equivalent are not considered part of the section titles. \" .PP \" M. Delete any section entitled "Endorsements". Such a section \" may not be included in the Modified Version. \" .PP \" N. Do not retitle any existing section as "Endorsements" \" or to conflict in title with any Invariant Section. \" .PP \" If the Modified Version includes new front-matter sections or \" appendices that qualify as Secondary Sections and contain no material \" copied from the Document, you may at your option designate some or all \" of these sections as invariant. To do this, add their titles to the \" list of Invariant Sections in the Modified Version's license notice. \" These titles must be distinct from any other section titles. \" .PP \" You may add a section entitled "Endorsements", provided it contains \" nothing but endorsements of your Modified Version by various \" parties--for example, statements of peer review or that the text has \" been approved by an organization as the authoritative definition of a \" standard. \" .PP \" You may add a passage of up to five words as a Front-Cover Text, and a \" passage of up to 25 words as a Back-Cover Text, to the end of the list \" of Cover Texts in the Modified Version. Only one passage of \" Front-Cover Text and one of Back-Cover Text may be added by (or \" through arrangements made by) any one entity. If the Document already \" includes a cover text for the same cover, previously added by you or \" by arrangement made by the same entity you are acting on behalf of, \" you may not add another; but you may replace the old one, on explicit \" permission from the previous publisher that added the old one. \" .PP \" The author(s) and publisher(s) of the Document do not by this License \" give permission to use their names for publicity for or to assert or \" imply endorsement of any Modified Version. \" .PP \" 5. COMBINING DOCUMENTS \" .PP \" You may combine the Document with other documents released under this \" License, under the terms defined in section 4 above for modified \" versions, provided that you include in the combination all of the \" Invariant Sections of all of the original documents, unmodified, and \" list them all as Invariant Sections of your combined work in its \" license notice. \" .PP \" The combined work need only contain one copy of this License, and \" multiple identical Invariant Sections may be replaced with a single \" copy. If there are multiple Invariant Sections with the same name but \" different contents, make the title of each such section unique by \" adding at the end of it, in parentheses, the name of the original \" author or publisher of that section if known, or else a unique number. \" Make the same adjustment to the section titles in the list of \" Invariant Sections in the license notice of the combined work. \" .PP \" In the combination, you must combine any sections entitled "History" \" in the various original documents, forming one section entitled \" "History"; likewise combine any sections entitled "Acknowledgements", \" and any sections entitled "Dedications". You must delete all sections \" entitled "Endorsements." \" .PP \" 6. COLLECTIONS OF DOCUMENTS \" .PP \" You may make a collection consisting of the Document and other documents \" released under this License, and replace the individual copies of this \" License in the various documents with a single copy that is included in \" the collection, provided that you follow the rules of this License for \" verbatim copying of each of the documents in all other respects. \" .PP \" You may extract a single document from such a collection, and distribute \" it individually under this License, provided you insert a copy of this \" License into the extracted document, and follow this License in all \" other respects regarding verbatim copying of that document. \" .PP \" 7. AGGREGATION WITH INDEPENDENT WORKS \" .PP \" A compilation of the Document or its derivatives with other separate \" and independent documents or works, in or on a volume of a storage or \" distribution medium, does not as a whole count as a Modified Version \" of the Document, provided no compilation copyright is claimed for the \" compilation. Such a compilation is called an "aggregate", and this \" License does not apply to the other self-contained works thus compiled \" with the Document, on account of their being thus compiled, if they \" are not themselves derivative works of the Document. \" .PP \" If the Cover Text requirement of section 3 is applicable to these \" copies of the Document, then if the Document is less than one quarter \" of the entire aggregate, the Document's Cover Texts may be placed on \" covers that surround only the Document within the aggregate. \" Otherwise they must appear on covers around the whole aggregate. \" .PP \" 8. TRANSLATION \" .PP \" Translation is considered a kind of modification, so you may \" distribute translations of the Document under the terms of section 4. \" Replacing Invariant Sections with translations requires special \" permission from their copyright holders, but you may include \" translations of some or all Invariant Sections in addition to the \" original versions of these Invariant Sections. You may include a \" translation of this License provided that you also include the \" original English version of this License. In case of a disagreement \" between the translation and the original English version of this \" License, the original English version will prevail. \" .PP \" 9. TERMINATION \" .PP \" You may not copy, modify, sublicense, or distribute the Document except \" as expressly provided for under this License. Any other attempt to \" copy, modify, sublicense or distribute the Document is void, and will \" automatically terminate your rights under this License. However, \" parties who have received copies, or rights, from you under this \" License will not have their licenses terminated so long as such \" parties remain in full compliance. \" .PP \" 10. FUTURE REVISIONS OF THIS LICENSE \" .PP \" The Free Software Foundation may publish new, revised versions \" of the GNU Free Documentation License from time to time. Such new \" versions will be similar in spirit to the present version, but may \" differ in detail to address new problems or concerns. See \" http://www.gnu.org/copyleft/. \" .PP \" Each version of the License is given a distinguishing version number. \" If the Document specifies that a particular numbered version of this \" License "or any later version" applies to it, you have the option of \" following the terms and conditions either of that specified version or \" of any later version that has been published (not as a draft) by the \" Free Software Foundation. If the Document does not specify a version \" number of this License, you may choose any version ever published (not \" as a draft) by the Free Software Foundation. \" .PP \" ADDENDUM: How to use this License for your documents \" .PP \" To use this License in a document you have written, include a copy of \" the License in the document and put the following copyright and \" license notices just after the title page: \" .PP \" Copyright (c) YEAR YOUR NAME. \" Permission is granted to copy, distribute and/or \" modify this document under the terms of the GNU \" Free Documentation License, Version 1.1 or any later \" version published by the Free Software Foundation; \" with the Invariant Sections being LIST THEIR TITLES, \" with the Front-Cover Texts being LIST, and with the \" Back-Cover Texts being LIST. A copy of the license \" is included in the section entitled "GNU Free \" Documentation License". \" .PP \" If you have no Invariant Sections, write "with no Invariant Sections" \" instead of saying which ones are invariant. If you have no \" Front-Cover Texts, write "no Front-Cover Texts" instead of \" "Front-Cover Texts being LIST"; likewise for Back-Cover Texts. \" .PP \" If your document contains nontrivial examples of program code, we \" recommend releasing these examples in parallel under your choice of \" free software license, such as the GNU General Public License, \" to permit their use in free software. binutils/binutils-MAN/opt/binutils/man/man1/as.1010064400000000000003000000637100732753202400202500ustar000300000000000000.\" Copyright (c) 1991, 1992, 1996, 1997, 1998, 2000 Free Software Foundation .\" See section COPYING for conditions for redistribution .TH as 1 "29 March 1996" "Free Software Foundation" "GNU Development Tools" .SH NAME GNU as \- the portable GNU assembler. .SH SYNOPSIS .na .B as .RB "[\|" \-a "[\|" dhlns "\|]" \c \&[\|\=\c .I file\c \&\|]\|] .RB "[\|" \-D "\|]" .RB "[\|" \-\-defsym\ SYM=VAL "\|]" .RB "[\|" \-f "\|]" .RB "[\|" \-\-gstabs "\|]" .RB "[\|" \-I .I path\c \&\|] .RB "[\|" \-K "\|]" .RB "[\|" \-L "\|]" .RB "[\|" \-M\ |\ \-\-mri "\|]" .RB "[\|" \-o .I objfile\c \&\|] .RB "[\|" \-R "\|]" .RB "[\|" \-\-traditional\-format "\|]" .RB "[\|" \-v "\|]" .RB "[\|" \-w "\|]" .RB "[\|" \-\^\- "\ |\ " \c .I files\c \&\|.\|.\|.\|] .I i960-only options: .br .RB "[\|" \-ACA "\||\|" \-ACA_A "\||\|" \-ACB\c .RB "\||\|" \-ACC "\||\|" \-AKA "\||\|" \-AKB\c .RB "\||\|" \-AKC "\||\|" \-AMC "\|]" .RB "[\|" \-b "\|]" .RB "[\|" \-no-relax "\|]" .I m680x0-only options: .br .RB "[\|" \-l "\|]" .RB "[\|" \-mc68000 "\||\|" \-mc68010 "\||\|" \-mc68020 "\|]" .ad b .SH DESCRIPTION GNU \c .B as\c \& is really a family of assemblers. If you use (or have used) the GNU assembler on one architecture, you should find a fairly similar environment when you use it on another architecture. Each version has much in common with the others, including object file formats, most assembler directives (often called \c .I pseudo-ops)\c \& and assembler syntax. For information on the syntax and pseudo-ops used by GNU \c .B as\c \&, see `\|\c .B as\c \|' entry in \c .B info \c (or the manual \c .I .I Using as: The GNU Assembler\c \&). \c .B as\c \& is primarily intended to assemble the output of the GNU C compiler \c .B gcc\c \& for use by the linker \c .B ld\c \&. Nevertheless, we've tried to make \c .B as\c \& assemble correctly everything that the native assembler would. This doesn't mean \c .B as\c \& always uses the same syntax as another assembler for the same architecture; for example, we know of several incompatible versions of 680x0 assembly language syntax. Each time you run \c .B as\c \& it assembles exactly one source program. The source program is made up of one or more files. (The standard input is also a file.) If \c .B as\c \& is given no file names it attempts to read one input file from the \c .B as\c \& standard input, which is normally your terminal. You may have to type \c .B ctl-D\c \& to tell \c .B as\c \& there is no more program to assemble. Use `\|\c .B \-\^\-\c \|' if you need to explicitly name the standard input file in your command line. .B as\c \& may write warnings and error messages to the standard error file (usually your terminal). This should not happen when \c .B as\c \& is run automatically by a compiler. Warnings report an assumption made so that \c .B as\c \& could keep assembling a flawed program; errors report a grave problem that stops the assembly. .SH OPTIONS .TP .BR \-a Turn on assembly listings. There are various suboptions. .B d omits debugging directives. .B h includes the high level source code; this is only available if the source file can be found, and the code was compiled with .B \-g. .B l includes an assembly listing. .B n omits forms processing. .B s includes a symbol listing. .B = .I file sets the listing file name; this must be the last suboption. The default suboptions are .B hls. .TP .B \-D This option is accepted only for script compatibility with calls to other assemblers; it has no effect on \c .B as\c \&. .TP .B \-\-defsym SYM=VALUE Define the symbol SYM to be VALUE before assembling the input file. VALUE must be an integer constant. As in C, a leading 0x indicates a hexadecimal value, and a leading 0 indicates an octal value. .TP .B \-f ``fast''--skip preprocessing (assume source is compiler output). .TP .BI "\-I\ " path Add .I path to the search list for .B .include directives. .TP .B \-\-gstabs Generate stabs debugging information for each assembler line. This may help debugging assembler code, if the debugger can handle it. .TP .B \-K Issue warnings when difference tables altered for long displacements. .TP .B \-L Keep (in symbol table) local symbols, starting with `\|\c .B L\c \|' .TP .B \-M, \-\-mri Assemble in MRI compatibility mode. .TP .BI "\-o\ " objfile Name the object-file output from \c .B as .TP .B \-R Fold data section into text section .TP .B \-\-traditional\-format Use same format as native assembler, when possible. .TP .B \-v Announce \c .B as\c \& version .TP .B \-W, \-\-no-warn Suppress warning messages. .TP .B \-\-fatal\-warnings Consider warnings to be fatal. .TP .B \-\-warn Just warn on warnings. .TP .IR "\-\^\-" "\ |\ " "files\|.\|.\|." Source files to assemble, or standard input (\c .BR "\-\^\-" ")" .TP .BI \-A var .I (When configured for Intel 960.) Specify which variant of the 960 architecture is the target. .TP .B \-b .I (When configured for Intel 960.) Add code to collect statistics about branches taken. .TP .B \-no-relax .I (When configured for Intel 960.) Do not alter compare-and-branch instructions for long displacements; error if necessary. .TP .B \-l .I (When configured for Motorola 68000). .br Shorten references to undefined symbols, to one word instead of two. .TP .BR "\-mc68000" "\||\|" "\-mc68010" "\||\|" "\-mc68020" .I (When configured for Motorola 68000). .br Specify what processor in the 68000 family is the target (default 68020) .PP Options may be in any order, and may be before, after, or between file names. The order of file names is significant. `\|\c .B \-\^\-\c \|' (two hyphens) by itself names the standard input file explicitly, as one of the files for \c .B as\c \& to assemble. Except for `\|\c .B \-\^\-\c \|' any command line argument that begins with a hyphen (`\|\c .B \-\c \|') is an option. Each option changes the behavior of \c .B as\c \&. No option changes the way another option works. An option is a `\|\c .B \-\c \|' followed by one or more letters; the case of the letter is important. All options are optional. The `\|\c .B \-o\c \|' option expects exactly one file name to follow. The file name may either immediately follow the option's letter (compatible with older assemblers) or it may be the next command argument (GNU standard). These two command lines are equivalent: .br .B as\ \ \-o\ \ my\-object\-file.o\ \ mumble.s .br .B as\ \ \-omy\-object\-file.o\ \ mumble.s .SH "SEE ALSO" .RB "`\|" as "\|'" entry in .B info\c \&; .I Using as: The GNU Assembler\c \&; .BR gcc "(" 1 ")," .BR ld "(" 1 ")." .SH COPYING Copyright (c) 1991, 1992, 2000 Free Software Foundation, Inc. .PP This document is distributed under the terms of the GNU Free Documentation License, version 1.1. That license is described in the sources for this manual page, but it is not displayed here in order to make this manual more consise. Copies of this license can also be obtained from: http://www.gnu.org/copyleft/. \" GNU Free Documentation License \" Version 1.1, March 2000 \" Copyright (C) 2000 Free Software Foundation, Inc. \" 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA \" Everyone is permitted to copy and distribute verbatim \" copies of this license document, but changing it is \" not allowed. \" .PP \" 0. PREAMBLE \" .PP \" The purpose of this License is to make a manual, textbook, or other \" written document "free" in the sense of freedom: to assure everyone \" the effective freedom to copy and redistribute it, with or without \" modifying it, either commercially or noncommercially. Secondarily, \" this License preserves for the author and publisher a way to get \" credit for their work, while not being considered responsible for \" modifications made by others. \" .PP \" This License is a kind of "copyleft", which means that derivative \" works of the document must themselves be free in the same sense. It \" complements the GNU General Public License, which is a copyleft \" license designed for free software. \" .PP \" We have designed this License in order to use it for manuals for free \" software, because free software needs free documentation: a free \" program should come with manuals providing the same freedoms that the \" software does. But this License is not limited to software manuals; \" it can be used for any textual work, regardless of subject matter or \" whether it is published as a printed book. We recommend this License \" principally for works whose purpose is instruction or reference. \" .PP \" 1. APPLICABILITY AND DEFINITIONS \" .PP \" This License applies to any manual or other work that contains a \" notice placed by the copyright holder saying it can be distributed \" under the terms of this License. The "Document", below, refers to any \" such manual or work. Any member of the public is a licensee, and is \" addressed as "you". \" .PP \" A "Modified Version" of the Document means any work containing the \" Document or a portion of it, either copied verbatim, or with \" modifications and/or translated into another language. \" .PP \" A "Secondary Section" is a named appendix or a front-matter section of \" the Document that deals exclusively with the relationship of the \" publishers or authors of the Document to the Document's overall subject \" (or to related matters) and contains nothing that could fall directly \" within that overall subject. (For example, if the Document is in part a \" textbook of mathematics, a Secondary Section may not explain any \" mathematics.) The relationship could be a matter of historical \" connection with the subject or with related matters, or of legal, \" commercial, philosophical, ethical or political position regarding \" them. \" .PP \" The "Invariant Sections" are certain Secondary Sections whose titles \" are designated, as being those of Invariant Sections, in the notice \" that says that the Document is released under this License. \" .PP \" The "Cover Texts" are certain short passages of text that are listed, \" as Front-Cover Texts or Back-Cover Texts, in the notice that says that \" the Document is released under this License. \" .PP \" A "Transparent" copy of the Document means a machine-readable copy, \" represented in a format whose specification is available to the \" general public, whose contents can be viewed and edited directly and \" straightforwardly with generic text editors or (for images composed of \" pixels) generic paint programs or (for drawings) some widely available \" drawing editor, and that is suitable for input to text formatters or \" for automatic translation to a variety of formats suitable for input \" to text formatters. A copy made in an otherwise Transparent file \" format whose markup has been designed to thwart or discourage \" subsequent modification by readers is not Transparent. A copy that is \" not "Transparent" is called "Opaque". \" .PP \" Examples of suitable formats for Transparent copies include plain \" ASCII without markup, Texinfo input format, LaTeX input format, SGML \" or XML using a publicly available DTD, and standard-conforming simple \" HTML designed for human modification. Opaque formats include \" PostScript, PDF, proprietary formats that can be read and edited only \" by proprietary word processors, SGML or XML for which the DTD and/or \" processing tools are not generally available, and the \" machine-generated HTML produced by some word processors for output \" purposes only. \" .PP \" The "Title Page" means, for a printed book, the title page itself, \" plus such following pages as are needed to hold, legibly, the material \" this License requires to appear in the title page. For works in \" formats which do not have any title page as such, "Title Page" means \" the text near the most prominent appearance of the work's title, \" preceding the beginning of the body of the text. \" .PP \" 2. VERBATIM COPYING \" .PP \" You may copy and distribute the Document in any medium, either \" commercially or noncommercially, provided that this License, the \" copyright notices, and the license notice saying this License applies \" to the Document are reproduced in all copies, and that you add no other \" conditions whatsoever to those of this License. You may not use \" technical measures to obstruct or control the reading or further \" copying of the copies you make or distribute. However, you may accept \" compensation in exchange for copies. If you distribute a large enough \" number of copies you must also follow the conditions in section 3. \" .PP \" You may also lend copies, under the same conditions stated above, and \" you may publicly display copies. \" .PP \" 3. COPYING IN QUANTITY \" .PP \" If you publish printed copies of the Document numbering more than 100, \" and the Document's license notice requires Cover Texts, you must enclose \" the copies in covers that carry, clearly and legibly, all these Cover \" Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on \" the back cover. Both covers must also clearly and legibly identify \" you as the publisher of these copies. The front cover must present \" the full title with all words of the title equally prominent and \" visible. You may add other material on the covers in addition. \" Copying with changes limited to the covers, as long as they preserve \" the title of the Document and satisfy these conditions, can be treated \" as verbatim copying in other respects. \" .PP \" If the required texts for either cover are too voluminous to fit \" legibly, you should put the first ones listed (as many as fit \" reasonably) on the actual cover, and continue the rest onto adjacent \" pages. \" .PP \" If you publish or distribute Opaque copies of the Document numbering \" more than 100, you must either include a machine-readable Transparent \" copy along with each Opaque copy, or state in or with each Opaque copy \" a publicly-accessible computer-network location containing a complete \" Transparent copy of the Document, free of added material, which the \" general network-using public has access to download anonymously at no \" charge using public-standard network protocols. If you use the latter \" option, you must take reasonably prudent steps, when you begin \" distribution of Opaque copies in quantity, to ensure that this \" Transparent copy will remain thus accessible at the stated location \" until at least one year after the last time you distribute an Opaque \" copy (directly or through your agents or retailers) of that edition to \" the public. \" .PP \" It is requested, but not required, that you contact the authors of the \" Document well before redistributing any large number of copies, to give \" them a chance to provide you with an updated version of the Document. \" .PP \" 4. MODIFICATIONS \" .PP \" You may copy and distribute a Modified Version of the Document under \" the conditions of sections 2 and 3 above, provided that you release \" the Modified Version under precisely this License, with the Modified \" Version filling the role of the Document, thus licensing distribution \" and modification of the Modified Version to whoever possesses a copy \" of it. In addition, you must do these things in the Modified Version: \" .PP \" A. Use in the Title Page (and on the covers, if any) a title distinct \" from that of the Document, and from those of previous versions \" (which should, if there were any, be listed in the History section \" of the Document). You may use the same title as a previous version \" if the original publisher of that version gives permission. \" .PP \" B. List on the Title Page, as authors, one or more persons or entities \" responsible for authorship of the modifications in the Modified \" Version, together with at least five of the principal authors of the \" Document (all of its principal authors, if it has less than five). \" .PP \" C. State on the Title page the name of the publisher of the \" Modified Version, as the publisher. \" .PP \" D. Preserve all the copyright notices of the Document. \" .PP \" E. Add an appropriate copyright notice for your modifications \" adjacent to the other copyright notices. \" .PP \" F. Include, immediately after the copyright notices, a license notice \" giving the public permission to use the Modified Version under the \" terms of this License, in the form shown in the Addendum below. \" Preserve in that license notice the full lists of Invariant Sections \" and required Cover Texts given in the Document's license notice. \" .PP \" H. Include an unaltered copy of this License. \" .PP \" I. Preserve the section entitled "History", and its title, and add to \" it an item stating at least the title, year, new authors, and \" publisher of the Modified Version as given on the Title Page. If \" there is no section entitled "History" in the Document, create one \" stating the title, year, authors, and publisher of the Document as \" given on its Title Page, then add an item describing the Modified \" Version as stated in the previous sentence. \" .PP \" J. Preserve the network location, if any, given in the Document for \" public access to a Transparent copy of the Document, and likewise \" the network locations given in the Document for previous versions \" it was based on. These may be placed in the "History" section. \" You may omit a network location for a work that was published at \" least four years before the Document itself, or if the original \" publisher of the version it refers to gives permission. \" .PP \" K. In any section entitled "Acknowledgements" or "Dedications", \" preserve the section's title, and preserve in the section all the \" substance and tone of each of the contributor acknowledgements \" and/or dedications given therein. \" .PP \" L. Preserve all the Invariant Sections of the Document, \" unaltered in their text and in their titles. Section numbers \" or the equivalent are not considered part of the section titles. \" .PP \" M. Delete any section entitled "Endorsements". Such a section \" may not be included in the Modified Version. \" .PP \" N. Do not retitle any existing section as "Endorsements" \" or to conflict in title with any Invariant Section. \" .PP \" If the Modified Version includes new front-matter sections or \" appendices that qualify as Secondary Sections and contain no material \" copied from the Document, you may at your option designate some or all \" of these sections as invariant. To do this, add their titles to the \" list of Invariant Sections in the Modified Version's license notice. \" These titles must be distinct from any other section titles. \" .PP \" You may add a section entitled "Endorsements", provided it contains \" nothing but endorsements of your Modified Version by various \" parties--for example, statements of peer review or that the text has \" been approved by an organization as the authoritative definition of a \" standard. \" .PP \" You may add a passage of up to five words as a Front-Cover Text, and a \" passage of up to 25 words as a Back-Cover Text, to the end of the list \" of Cover Texts in the Modified Version. Only one passage of \" Front-Cover Text and one of Back-Cover Text may be added by (or \" through arrangements made by) any one entity. If the Document already \" includes a cover text for the same cover, previously added by you or \" by arrangement made by the same entity you are acting on behalf of, \" you may not add another; but you may replace the old one, on explicit \" permission from the previous publisher that added the old one. \" .PP \" The author(s) and publisher(s) of the Document do not by this License \" give permission to use their names for publicity for or to assert or \" imply endorsement of any Modified Version. \" .PP \" 5. COMBINING DOCUMENTS \" .PP \" You may combine the Document with other documents released under this \" License, under the terms defined in section 4 above for modified \" versions, provided that you include in the combination all of the \" Invariant Sections of all of the original documents, unmodified, and \" list them all as Invariant Sections of your combined work in its \" license notice. \" .PP \" The combined work need only contain one copy of this License, and \" multiple identical Invariant Sections may be replaced with a single \" copy. If there are multiple Invariant Sections with the same name but \" different contents, make the title of each such section unique by \" adding at the end of it, in parentheses, the name of the original \" author or publisher of that section if known, or else a unique number. \" Make the same adjustment to the section titles in the list of \" Invariant Sections in the license notice of the combined work. \" .PP \" In the combination, you must combine any sections entitled "History" \" in the various original documents, forming one section entitled \" "History"; likewise combine any sections entitled "Acknowledgements", \" and any sections entitled "Dedications". You must delete all sections \" entitled "Endorsements." \" .PP \" 6. COLLECTIONS OF DOCUMENTS \" .PP \" You may make a collection consisting of the Document and other documents \" released under this License, and replace the individual copies of this \" License in the various documents with a single copy that is included in \" the collection, provided that you follow the rules of this License for \" verbatim copying of each of the documents in all other respects. \" .PP \" You may extract a single document from such a collection, and distribute \" it individually under this License, provided you insert a copy of this \" License into the extracted document, and follow this License in all \" other respects regarding verbatim copying of that document. \" .PP \" 7. AGGREGATION WITH INDEPENDENT WORKS \" .PP \" A compilation of the Document or its derivatives with other separate \" and independent documents or works, in or on a volume of a storage or \" distribution medium, does not as a whole count as a Modified Version \" of the Document, provided no compilation copyright is claimed for the \" compilation. Such a compilation is called an "aggregate", and this \" License does not apply to the other self-contained works thus compiled \" with the Document, on account of their being thus compiled, if they \" are not themselves derivative works of the Document. \" .PP \" If the Cover Text requirement of section 3 is applicable to these \" copies of the Document, then if the Document is less than one quarter \" of the entire aggregate, the Document's Cover Texts may be placed on \" covers that surround only the Document within the aggregate. \" Otherwise they must appear on covers around the whole aggregate. \" .PP \" 8. TRANSLATION \" .PP \" Translation is considered a kind of modification, so you may \" distribute translations of the Document under the terms of section 4. \" Replacing Invariant Sections with translations requires special \" permission from their copyright holders, but you may include \" translations of some or all Invariant Sections in addition to the \" original versions of these Invariant Sections. You may include a \" translation of this License provided that you also include the \" original English version of this License. In case of a disagreement \" between the translation and the original English version of this \" License, the original English version will prevail. \" .PP \" 9. TERMINATION \" .PP \" You may not copy, modify, sublicense, or distribute the Document except \" as expressly provided for under this License. Any other attempt to \" copy, modify, sublicense or distribute the Document is void, and will \" automatically terminate your rights under this License. However, \" parties who have received copies, or rights, from you under this \" License will not have their licenses terminated so long as such \" parties remain in full compliance. \" .PP \" 10. FUTURE REVISIONS OF THIS LICENSE \" .PP \" The Free Software Foundation may publish new, revised versions \" of the GNU Free Documentation License from time to time. Such new \" versions will be similar in spirit to the present version, but may \" differ in detail to address new problems or concerns. See \" http://www.gnu.org/copyleft/. \" .PP \" Each version of the License is given a distinguishing version number. \" If the Document specifies that a particular numbered version of this \" License "or any later version" applies to it, you have the option of \" following the terms and conditions either of that specified version or \" of any later version that has been published (not as a draft) by the \" Free Software Foundation. If the Document does not specify a version \" number of this License, you may choose any version ever published (not \" as a draft) by the Free Software Foundation. \" .PP \" ADDENDUM: How to use this License for your documents \" .PP \" To use this License in a document you have written, include a copy of \" the License in the document and put the following copyright and \" license notices just after the title page: \" .PP \" Copyright (c) YEAR YOUR NAME. \" Permission is granted to copy, distribute and/or \" modify this document under the terms of the GNU \" Free Documentation License, Version 1.1 or any later \" version published by the Free Software Foundation; \" with the Invariant Sections being LIST THEIR TITLES, \" with the Front-Cover Texts being LIST, and with the \" Back-Cover Texts being LIST. A copy of the license \" is included in the section entitled "GNU Free \" Documentation License". \" .PP \" If you have no Invariant Sections, write "with no Invariant Sections" \" instead of saying which ones are invariant. If you have no \" Front-Cover Texts, write "no Front-Cover Texts" instead of \" "Front-Cover Texts being LIST"; likewise for Back-Cover Texts. \" .PP \" If your document contains nontrivial examples of program code, we \" recommend releasing these examples in parallel under your choice of \" free software license, such as the GNU General Public License, \" to permit their use in free software. binutils/binutils-MAN/opt/binutils/man/man1/c++filt.1010064400000000000003000000061170732753202200210700ustar000300000000000000.\" Copyright (c) 1991 Free Software Foundation .\" See section COPYING for conditions for redistribution .TH c++filt 1 "June 1993" "cygnus support" "GNU Development Tools" .de BP .sp .ti \-.2i \(** .. .SH NAME c++filt \- demangle C++ symbols .SH SYNOPSIS .hy 0 .na .TP .B c++filt .RB "[\|" \-_ | \-\-strip-underscores "\|]" .RB "[\|" "\-s {gnu,lucid,arm} " | " \-\-format={gnu,lucid,arm}" "\|]" .RB "[\|" \-\-help "\|]" .RB "[\|" \-\-version "\|]" .RB "[\|" symbol "...\|]" .SH DESCRIPTION The C++ language provides function overloading, which means that you can write many functions with the same name (providing each takes parameters of different types). All C++ function names are encoded into a low-level assembly label (this process is known as .I mangling\c ). The .B c++filt program does the inverse mapping: it decodes (\fIdemangles\fR) low-level names into user-level names so that the linker can keep these overloaded functions from clashing. .PP Every alphanumeric word (consisting of letters, digits, underscores, dollars, or periods) seen in the input is a potential label. If the label decodes into a C++ name, the C++ name replaces the low-level name in the output. .PP You can use .B c++filt to decipher individual symbols by specifying these symbols on the command line. .PP If no .B symbol arguments are given, .B c++filt reads symbol names from the standard input and writes the demangled names to the standard output. All results are printed on the standard output. .SH OPTIONS .TP .B \-_ .TP .B \-\-strip\-underscores On some systems, both the C and C++ compilers put an underscore in front of every name. For example, the C name .B foo gets the low-level name .BR _foo . This option removes the leading underscore. .TP .B "\-s {gnu,lucid,arm}" .TP .B \-\-format={gnu,lucid,arm} GNU .B nm can decode three different methods of mangling, used by different C++ compilers. This option selects which method it uses: the one used by the GNU compiler, the one used by the Lucid compiler, or the one specified by the C++ Annotated Reference Manual. The default is the GNU style. .TP .B \-\-help Print a summary of the options to .B c++filt and exit. .TP .B \-\-version Print the version number of .B c++filt and exit. .SH "SEE ALSO" .RB "`\|" binutils "\|'" entry in .B info\c \&; .I The GNU Binary Utilities\c \&, Roland H. Pesch (June 1993). .SH COPYING Copyright (c) 1993 Free Software Foundation, Inc. .PP Permission is granted to make and distribute verbatim copies of this manual provided the copyright notice and this permission notice are preserved on all copies. .PP Permission is granted to copy and distribute modified versions of this manual under the conditions for verbatim copying, provided that the entire resulting derived work is distributed under the terms of a permission notice identical to this one. .PP Permission is granted to copy and distribute translations of this manual into another language, under the above conditions for modified versions, except that this permission notice may be included in translations approved by the Free Software Foundation instead of in the original English. binutils/binutils-MAN/opt/binutils/man/man1/gprof.1010064400000000000003000000166410732753203500207650ustar000300000000000000.\" Copyright (c) 1983, 1990 The Regents of the University of California. .\" All rights reserved. .\" .\" Redistribution and use in source and binary forms are permitted provided .\" that: (1) source distributions retain this entire copyright notice and .\" comment, and (2) distributions including binaries display the following .\" acknowledgement: ``This product includes software developed by the .\" University of California, Berkeley and its contributors'' in the .\" documentation or other materials provided with the distribution and in .\" all advertising materials mentioning features or use of this software. .\" Neither the name of the University nor the names of its contributors may .\" be used to endorse or promote products derived from this software without .\" specific prior written permission. .\" THIS SOFTWARE IS PROVIDED ``AS IS'' AND WITHOUT ANY EXPRESS OR IMPLIED .\" WARRANTIES, INCLUDING, WITHOUT LIMITATION, THE IMPLIED WARRANTIES OF .\" MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. .\" .\" @(#)gprof.1 6.6 (Berkeley) 7/24/90 .\" .TH GPROF 1 "January 29, 1993" .SH NAME gprof \- display call graph profile data .SH SYNOPSIS .B gprof [ \-abcsz ] [ \-e|\-E .I name .B ] [ \-f|\-F .I name .B ] .B [ \-k .I fromname toname .B ] [ .I objfile .B [ .I gmon.out .B ] .B ] .SH DESCRIPTION .B gprof produces an execution profile of C, Pascal, or Fortran77 programs. The effect of called routines is incorporated in the profile of each caller. The profile data is taken from the call graph profile file \&(`gmon.out' default) which is created by programs that are compiled with the .B \-pg option of .BR cc ( 1 ) , .BR pc ( 1 ) , and .BR f77 ( 1 ) . The .B \-pg option also links in versions of the library routines that are compiled for profiling. .B Gprof reads the given object file (the default is `a.out') and establishes the relation between its symbol table and the call graph profile from `gmon.out'. If more than one profile file is specified, the .B gprof output shows the sum of the profile information in the given profile files. .PP .B Gprof calculates the amount of time spent in each routine. Next, these times are propagated along the edges of the call graph. Cycles are discovered, and calls into a cycle are made to share the time of the cycle. The first listing shows the functions sorted according to the time they represent including the time of their call graph descendants. Below each function entry is shown its (direct) call graph children, and how their times are propagated to this function. A similar display above the function shows how this function's time and the time of its descendants is propagated to its (direct) call graph parents. .PP Cycles are also shown, with an entry for the cycle as a whole and a listing of the members of the cycle and their contributions to the time and call counts of the cycle. .PP Second, a flat profile is given, similar to that provided by .BR prof ( 1 ) . This listing gives the total execution times, the call counts, the time in milliseconds the call spent in the routine itself, and the time in milliseconds the call spent in the routine itself including its descendants. .PP Finally, an index of the function names is provided. .SH OPTIONS The following options are available: .TP .B \-a suppresses the printing of statically declared functions. If this option is given, all relevant information about the static function (e.g., time samples, calls to other functions, calls from other functions) belongs to the function loaded just before the static function in the \&`objfile' file. .TP .B \-b suppresses the printing of a description of each field in the profile. .TP .B \-c the static call graph of the program is discovered by a heuristic that examines the text space of the object file. Static-only parents or children are shown with call counts of 0. .TP .BI "\-e " name suppresses the printing of the graph profile entry for routine .I name and all its descendants (unless they have other ancestors that aren't suppressed). More than one .B \-e option may be given. Only one .I name may be given with each .B \-e option. .TP .BI "\-E " name suppresses the printing of the graph profile entry for routine .I name (and its descendants) as .B \-e , above, and also excludes the time spent in .I name (and its descendants) from the total and percentage time computations. (For example, .BI "\-E " mcount .BI "\-E " mcleanup is the default.) .TP .BI "\-f " name prints the graph profile entry of only the specified routine .I name and its descendants. More than one .B \-f option may be given. Only one .I name may be given with each .B \-f option. .TP .BI "\-F " name prints the graph profile entry of only the routine .I name and its descendants (as .B \-f , above) and also uses only the times of the printed routines in total time and percentage computations. More than one .B \-F option may be given. Only one .I name may be given with each .B \-F option. The .B \-F option overrides the .B \-E option. .TP .BI "\-k " "fromname toname" will delete any arcs from routine .I fromname to routine .IR toname . This can be used to break undesired cycles. More than one .B \-k option may be given. Only one pair of routine names may be given with each .B \-k option. .TP .B \-s a profile file `gmon.sum' is produced that represents the sum of the profile information in all the specified profile files. This summary profile file may be given to later executions of gprof (probably also with a .BR \-s ) to accumulate profile data across several runs of an `objfile' file. .TP .B -v prints the version number for gprof, and then exits. .TP .B -z displays routines that have zero usage (as shown by call counts and accumulated time). This is useful with the .B \-c option for discovering which routines were never called. .PP .SH FILES .ta \w'gmon.sum 'u a.out the namelist and text space. .br gmon.out dynamic call graph and profile. .br gmon.sum summarized dynamic call graph and profile. .SH SEE ALSO .BR monitor ( 3 ) , .BR profil ( 2 ) , .BR cc ( 1 ) , .BR prof ( 1 ) .sp ``An Execution Profiler for Modular Programs'', by S. Graham, P. Kessler, M. McKusick; .I Software \- Practice and Experience, Vol. 13, pp. 671-685, 1983. .sp ``gprof: A Call Graph Execution Profiler'', by S. Graham, P. Kessler, M. McKusick; .I Proceedings of the SIGPLAN '82 Symposium on Compiler Construction, SIGPLAN Notices, Vol. 17, No 6, pp. 120-126, June 1982. .SH HISTORY .B Gprof appeared in 4.2 BSD. .SH BUGS The granularity of the sampling is shown, but remains statistical at best. We assume that the time for each execution of a function can be expressed by the total time for the function divided by the number of times the function is called. Thus the time propagated along the call graph arcs to the function's parents is directly proportional to the number of times that arc is traversed. .PP Parents that are not themselves profiled will have the time of their profiled children propagated to them, but they will appear to be spontaneously invoked in the call graph listing, and will not have their time propagated further. Similarly, signal catchers, even though profiled, will appear to be spontaneous (although for more obscure reasons). Any profiled children of signal catchers should have their times propagated properly, unless the signal catcher was invoked during the execution of the profiling routine, in which case all is lost. .PP The profiled program must call .BR exit ( 2 ) or return normally for the profiling information to be saved in the `gmon.out' file. binutils/binutils-MAN/opt/binutils/man/man1/nlmconv.1010064400000000000003000000535550732753202100213240ustar000300000000000000.\" Copyright (c) 1991, 1996, 2000 Free Software Foundation .\" See section COPYING for conditions for redistribution .TH nlmconv 1 "March 1996" "Free Software Foundation" "GNU Development Tools" .de BP .sp .ti \-.2i \(** .. .SH NAME nlmconv \- converts object code into an NLM .SH SYNOPSIS .hy 0 .na .TP .B nlmconv .RB "[\|" \-I\ \fIbfdname\fB\ |\ \-\-input\-target=\fIbfdname\fR "\|]" .RB "[\|" \-O\ \fIbfdname\fB\ |\ \-\-output\-target=\fIbfdname\fR "\|]" .RB "[\|" \-T\ \fIheaderfile\fB\ |\ \-\-header\-file=\fIheaderfile\fR "\|]" .RB "[\|" \-V\ |\ \-\-version\fR "\|]" .RB "[\|" \-\-help\fR "\|]" .B infile .B outfile .SH DESCRIPTION .B nlmconv converts the relocatable object file .B infile into the NetWare Loadable Module .BR outfile , optionally reading .I headerfile for NLM header information. For instructions on writing the NLM command file language used in header files, see .IR "The NetWare Tool Maker Specification Manual" , available from Novell, Inc. .B nlmconv currently works with i386 object files in .BR COFF , .BR ELF , or .B a.out format, and with SPARC object files in .B ELF or .B a.out format. .br .B nlmconv uses the GNU Binary File Descriptor library to read .IR infile . .SH OPTIONS .TP .B \-I \fIbfdname\fR, \fB\-\-input\-target=\fIbfdname Consider the source file's object format to be .IR bfdname , rather than attempting to deduce it. .TP .B \-O \fIbfdname\fR, \fB\-\-output\-target=\fIbfdname Write the output file using the object format .IR bfdname . .B nlmconv infers the output format based on the input format, e.g. for an i386 input file the output format is .IR nlm32\-i386 . .TP .B \-T \fIheaderfile\fR, \fB\-\-header\-file=\fIheaderfile Reads .I headerfile for NLM header information. For instructions on writing the NLM command file language used in header files, see .IR "The NetWare Tool Maker Specification Manual" , available from Novell, Inc. .TP .B \-V\fR, \fB\-\-version Show the version number of .B nlmconv and exit. .TP .B \-h\fR, \fB\-\-help Show a summary of the options to .B nlmconv and exit. .SH "SEE ALSO" .RB "`\|" binutils "\|'" entry in .B info\c \&; .I The GNU Binary Utilities\c \&, Roland H. Pesch (June 1993). .SH COPYING Copyright (c) 1993, 2000 Free Software Foundation, Inc. .PP This document is distributed under the terms of the GNU Free Documenation License. That license is described in the GNU Free Documentation License section. This document is distributed under the terms of the GNU Free Documentation License, version 1.1. That license is described in the sources for this manual page, but it is not displayed here in order to make this manual more consise. Copies of this license can also be obtained from: http://www.gnu.org/copyleft/. \" .SH GNU Free Documentation License \" Version 1.1, March 2000 \" Copyright (C) 2000 Free Software Foundation, Inc. \" 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA \" Everyone is permitted to copy and distribute verbatim \" copies of this license document, but changing it is \" not allowed. \" .PP \" 0. PREAMBLE \" .PP \" The purpose of this License is to make a manual, textbook, or other \" written document "free" in the sense of freedom: to assure everyone \" the effective freedom to copy and redistribute it, with or without \" modifying it, either commercially or noncommercially. Secondarily, \" this License preserves for the author and publisher a way to get \" credit for their work, while not being considered responsible for \" modifications made by others. \" .PP \" This License is a kind of "copyleft", which means that derivative \" works of the document must themselves be free in the same sense. It \" complements the GNU General Public License, which is a copyleft \" license designed for free software. \" .PP \" We have designed this License in order to use it for manuals for free \" software, because free software needs free documentation: a free \" program should come with manuals providing the same freedoms that the \" software does. But this License is not limited to software manuals; \" it can be used for any textual work, regardless of subject matter or \" whether it is published as a printed book. We recommend this License \" principally for works whose purpose is instruction or reference. \" .PP \" 1. APPLICABILITY AND DEFINITIONS \" .PP \" This License applies to any manual or other work that contains a \" notice placed by the copyright holder saying it can be distributed \" under the terms of this License. The "Document", below, refers to any \" such manual or work. Any member of the public is a licensee, and is \" addressed as "you". \" .PP \" A "Modified Version" of the Document means any work containing the \" Document or a portion of it, either copied verbatim, or with \" modifications and/or translated into another language. \" .PP \" A "Secondary Section" is a named appendix or a front-matter section of \" the Document that deals exclusively with the relationship of the \" publishers or authors of the Document to the Document's overall subject \" (or to related matters) and contains nothing that could fall directly \" within that overall subject. (For example, if the Document is in part a \" textbook of mathematics, a Secondary Section may not explain any \" mathematics.) The relationship could be a matter of historical \" connection with the subject or with related matters, or of legal, \" commercial, philosophical, ethical or political position regarding \" them. \" .PP \" The "Invariant Sections" are certain Secondary Sections whose titles \" are designated, as being those of Invariant Sections, in the notice \" that says that the Document is released under this License. \" .PP \" The "Cover Texts" are certain short passages of text that are listed, \" as Front-Cover Texts or Back-Cover Texts, in the notice that says that \" the Document is released under this License. \" .PP \" A "Transparent" copy of the Document means a machine-readable copy, \" represented in a format whose specification is available to the \" general public, whose contents can be viewed and edited directly and \" straightforwardly with generic text editors or (for images composed of \" pixels) generic paint programs or (for drawings) some widely available \" drawing editor, and that is suitable for input to text formatters or \" for automatic translation to a variety of formats suitable for input \" to text formatters. A copy made in an otherwise Transparent file \" format whose markup has been designed to thwart or discourage \" subsequent modification by readers is not Transparent. A copy that is \" not "Transparent" is called "Opaque". \" .PP \" Examples of suitable formats for Transparent copies include plain \" ASCII without markup, Texinfo input format, LaTeX input format, SGML \" or XML using a publicly available DTD, and standard-conforming simple \" HTML designed for human modification. Opaque formats include \" PostScript, PDF, proprietary formats that can be read and edited only \" by proprietary word processors, SGML or XML for which the DTD and/or \" processing tools are not generally available, and the \" machine-generated HTML produced by some word processors for output \" purposes only. \" .PP \" The "Title Page" means, for a printed book, the title page itself, \" plus such following pages as are needed to hold, legibly, the material \" this License requires to appear in the title page. For works in \" formats which do not have any title page as such, "Title Page" means \" the text near the most prominent appearance of the work's title, \" preceding the beginning of the body of the text. \" .PP \" 2. VERBATIM COPYING \" .PP \" You may copy and distribute the Document in any medium, either \" commercially or noncommercially, provided that this License, the \" copyright notices, and the license notice saying this License applies \" to the Document are reproduced in all copies, and that you add no other \" conditions whatsoever to those of this License. You may not use \" technical measures to obstruct or control the reading or further \" copying of the copies you make or distribute. However, you may accept \" compensation in exchange for copies. If you distribute a large enough \" number of copies you must also follow the conditions in section 3. \" .PP \" You may also lend copies, under the same conditions stated above, and \" you may publicly display copies. \" .PP \" 3. COPYING IN QUANTITY \" .PP \" If you publish printed copies of the Document numbering more than 100, \" and the Document's license notice requires Cover Texts, you must enclose \" the copies in covers that carry, clearly and legibly, all these Cover \" Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on \" the back cover. Both covers must also clearly and legibly identify \" you as the publisher of these copies. The front cover must present \" the full title with all words of the title equally prominent and \" visible. You may add other material on the covers in addition. \" Copying with changes limited to the covers, as long as they preserve \" the title of the Document and satisfy these conditions, can be treated \" as verbatim copying in other respects. \" .PP \" If the required texts for either cover are too voluminous to fit \" legibly, you should put the first ones listed (as many as fit \" reasonably) on the actual cover, and continue the rest onto adjacent \" pages. \" .PP \" If you publish or distribute Opaque copies of the Document numbering \" more than 100, you must either include a machine-readable Transparent \" copy along with each Opaque copy, or state in or with each Opaque copy \" a publicly-accessible computer-network location containing a complete \" Transparent copy of the Document, free of added material, which the \" general network-using public has access to download anonymously at no \" charge using public-standard network protocols. If you use the latter \" option, you must take reasonably prudent steps, when you begin \" distribution of Opaque copies in quantity, to ensure that this \" Transparent copy will remain thus accessible at the stated location \" until at least one year after the last time you distribute an Opaque \" copy (directly or through your agents or retailers) of that edition to \" the public. \" .PP \" It is requested, but not required, that you contact the authors of the \" Document well before redistributing any large number of copies, to give \" them a chance to provide you with an updated version of the Document. \" .PP \" 4. MODIFICATIONS \" .PP \" You may copy and distribute a Modified Version of the Document under \" the conditions of sections 2 and 3 above, provided that you release \" the Modified Version under precisely this License, with the Modified \" Version filling the role of the Document, thus licensing distribution \" and modification of the Modified Version to whoever possesses a copy \" of it. In addition, you must do these things in the Modified Version: \" .PP \" A. Use in the Title Page (and on the covers, if any) a title distinct \" from that of the Document, and from those of previous versions \" (which should, if there were any, be listed in the History section \" of the Document). You may use the same title as a previous version \" if the original publisher of that version gives permission. \" .PP \" B. List on the Title Page, as authors, one or more persons or entities \" responsible for authorship of the modifications in the Modified \" Version, together with at least five of the principal authors of the \" Document (all of its principal authors, if it has less than five). \" .PP \" C. State on the Title page the name of the publisher of the \" Modified Version, as the publisher. \" .PP \" D. Preserve all the copyright notices of the Document. \" .PP \" E. Add an appropriate copyright notice for your modifications \" adjacent to the other copyright notices. \" .PP \" F. Include, immediately after the copyright notices, a license notice \" giving the public permission to use the Modified Version under the \" terms of this License, in the form shown in the Addendum below. \" Preserve in that license notice the full lists of Invariant Sections \" and required Cover Texts given in the Document's license notice. \" .PP \" H. Include an unaltered copy of this License. \" .PP \" I. Preserve the section entitled "History", and its title, and add to \" it an item stating at least the title, year, new authors, and \" publisher of the Modified Version as given on the Title Page. If \" there is no section entitled "History" in the Document, create one \" stating the title, year, authors, and publisher of the Document as \" given on its Title Page, then add an item describing the Modified \" Version as stated in the previous sentence. \" .PP \" J. Preserve the network location, if any, given in the Document for \" public access to a Transparent copy of the Document, and likewise \" the network locations given in the Document for previous versions \" it was based on. These may be placed in the "History" section. \" You may omit a network location for a work that was published at \" least four years before the Document itself, or if the original \" publisher of the version it refers to gives permission. \" .PP \" K. In any section entitled "Acknowledgements" or "Dedications", \" preserve the section's title, and preserve in the section all the \" substance and tone of each of the contributor acknowledgements \" and/or dedications given therein. \" .PP \" L. Preserve all the Invariant Sections of the Document, \" unaltered in their text and in their titles. Section numbers \" or the equivalent are not considered part of the section titles. \" .PP \" M. Delete any section entitled "Endorsements". Such a section \" may not be included in the Modified Version. \" .PP \" N. Do not retitle any existing section as "Endorsements" \" or to conflict in title with any Invariant Section. \" .PP \" If the Modified Version includes new front-matter sections or \" appendices that qualify as Secondary Sections and contain no material \" copied from the Document, you may at your option designate some or all \" of these sections as invariant. To do this, add their titles to the \" list of Invariant Sections in the Modified Version's license notice. \" These titles must be distinct from any other section titles. \" .PP \" You may add a section entitled "Endorsements", provided it contains \" nothing but endorsements of your Modified Version by various \" parties--for example, statements of peer review or that the text has \" been approved by an organization as the authoritative definition of a \" standard. \" .PP \" You may add a passage of up to five words as a Front-Cover Text, and a \" passage of up to 25 words as a Back-Cover Text, to the end of the list \" of Cover Texts in the Modified Version. Only one passage of \" Front-Cover Text and one of Back-Cover Text may be added by (or \" through arrangements made by) any one entity. If the Document already \" includes a cover text for the same cover, previously added by you or \" by arrangement made by the same entity you are acting on behalf of, \" you may not add another; but you may replace the old one, on explicit \" permission from the previous publisher that added the old one. \" .PP \" The author(s) and publisher(s) of the Document do not by this License \" give permission to use their names for publicity for or to assert or \" imply endorsement of any Modified Version. \" .PP \" 5. COMBINING DOCUMENTS \" .PP \" You may combine the Document with other documents released under this \" License, under the terms defined in section 4 above for modified \" versions, provided that you include in the combination all of the \" Invariant Sections of all of the original documents, unmodified, and \" list them all as Invariant Sections of your combined work in its \" license notice. \" .PP \" The combined work need only contain one copy of this License, and \" multiple identical Invariant Sections may be replaced with a single \" copy. If there are multiple Invariant Sections with the same name but \" different contents, make the title of each such section unique by \" adding at the end of it, in parentheses, the name of the original \" author or publisher of that section if known, or else a unique number. \" Make the same adjustment to the section titles in the list of \" Invariant Sections in the license notice of the combined work. \" .PP \" In the combination, you must combine any sections entitled "History" \" in the various original documents, forming one section entitled \" "History"; likewise combine any sections entitled "Acknowledgements", \" and any sections entitled "Dedications". You must delete all sections \" entitled "Endorsements." \" .PP \" 6. COLLECTIONS OF DOCUMENTS \" .PP \" You may make a collection consisting of the Document and other documents \" released under this License, and replace the individual copies of this \" License in the various documents with a single copy that is included in \" the collection, provided that you follow the rules of this License for \" verbatim copying of each of the documents in all other respects. \" .PP \" You may extract a single document from such a collection, and distribute \" it individually under this License, provided you insert a copy of this \" License into the extracted document, and follow this License in all \" other respects regarding verbatim copying of that document. \" .PP \" 7. AGGREGATION WITH INDEPENDENT WORKS \" .PP \" A compilation of the Document or its derivatives with other separate \" and independent documents or works, in or on a volume of a storage or \" distribution medium, does not as a whole count as a Modified Version \" of the Document, provided no compilation copyright is claimed for the \" compilation. Such a compilation is called an "aggregate", and this \" License does not apply to the other self-contained works thus compiled \" with the Document, on account of their being thus compiled, if they \" are not themselves derivative works of the Document. \" .PP \" If the Cover Text requirement of section 3 is applicable to these \" copies of the Document, then if the Document is less than one quarter \" of the entire aggregate, the Document's Cover Texts may be placed on \" covers that surround only the Document within the aggregate. \" Otherwise they must appear on covers around the whole aggregate. \" .PP \" 8. TRANSLATION \" .PP \" Translation is considered a kind of modification, so you may \" distribute translations of the Document under the terms of section 4. \" Replacing Invariant Sections with translations requires special \" permission from their copyright holders, but you may include \" translations of some or all Invariant Sections in addition to the \" original versions of these Invariant Sections. You may include a \" translation of this License provided that you also include the \" original English version of this License. In case of a disagreement \" between the translation and the original English version of this \" License, the original English version will prevail. \" .PP \" 9. TERMINATION \" .PP \" You may not copy, modify, sublicense, or distribute the Document except \" as expressly provided for under this License. Any other attempt to \" copy, modify, sublicense or distribute the Document is void, and will \" automatically terminate your rights under this License. However, \" parties who have received copies, or rights, from you under this \" License will not have their licenses terminated so long as such \" parties remain in full compliance. \" .PP \" 10. FUTURE REVISIONS OF THIS LICENSE \" .PP \" The Free Software Foundation may publish new, revised versions \" of the GNU Free Documentation License from time to time. Such new \" versions will be similar in spirit to the present version, but may \" differ in detail to address new problems or concerns. See \" http://www.gnu.org/copyleft/. \" .PP \" Each version of the License is given a distinguishing version number. \" If the Document specifies that a particular numbered version of this \" License "or any later version" applies to it, you have the option of \" following the terms and conditions either of that specified version or \" of any later version that has been published (not as a draft) by the \" Free Software Foundation. If the Document does not specify a version \" number of this License, you may choose any version ever published (not \" as a draft) by the Free Software Foundation. \" .PP \" ADDENDUM: How to use this License for your documents \" .PP \" To use this License in a document you have written, include a copy of \" the License in the document and put the following copyright and \" license notices just after the title page: \" .PP \" Copyright (c) YEAR YOUR NAME. \" Permission is granted to copy, distribute and/or \" modify this document under the terms of the GNU \" Free Documentation License, Version 1.1 or any later \" version published by the Free Software Foundation; \" with the Invariant Sections being LIST THEIR TITLES, \" with the Front-Cover Texts being LIST, and with the \" Back-Cover Texts being LIST. A copy of the license \" is included in the section entitled "GNU Free \" Documentation License". \" .PP \" If you have no Invariant Sections, write "with no Invariant Sections" \" instead of saying which ones are invariant. If you have no \" Front-Cover Texts, write "no Front-Cover Texts" instead of \" "Front-Cover Texts being LIST"; likewise for Back-Cover Texts. \" .PP \" If your document contains nontrivial examples of program code, we \" recommend releasing these examples in parallel under your choice of \" free software license, such as the GNU General Public License, \" to permit their use in free software. binutils/binutils-MAN/opt/binutils/man/man1/nm.1010064400000000000003000000600260732753201700202560ustar000300000000000000.\" Copyright (c) 1991, 2000 Free Software Foundation .\" See section COPYING for conditions for redistribution .TH nm 1 "5 November 1991" "Free Software Foundation" "GNU Development Tools" .de BP .sp .ti \-.2i \(** .. .SH NAME nm \- list symbols from object files. .SH SYNOPSIS .hy 0 .na .TP .B nm .RB "[\|" \-a | \-\-debug\-syms "\|]" .RB "[\|" \-g | \-\-extern\-only "\|]" .RB "[\|" \-B "\|]" .RB "[\|" \-C | \-\-demangle "\|]" .RB "[\|" \-D | \-\-dynamic "\|]" .RB "[\|" \-s | \-\-print\-armap "\|]" .RB "[\|" \-o | \-\-print\-file\-name "\|]" .RB "[\|" \-n | \-\-numeric\-sort "\|]" .RB "[\|" \-p | \-\-no\-sort "\|]" .RB "[\|" \-r | \-\-reverse\-sort "\|]" .RB "[\|" \-\-size\-sort "\|]" .RB "[\|" \-u | \-\-undefined\-only "\|]" .RB "[\|" \-l | \-\-line\-numbers "\|]" .RB "[\|" \-\-help "\|]" .RB "[\|" \-\-version "\|]" .RB "[\|" "\-t \fIradix" | \-\-radix=\fIradix "\|]" .RB "[\|" \-P | --portability "\|]" .RB "[\|" "\-f \fIformat" | \-\-format=\fIformat "\|]" .RB "[\|" "\-\-target=\fIbfdname" "\|]" .RB "[\|" \c .I objfile\c \&.\|.\|.\|] .ad b .hy 1 .SH DESCRIPTION GNU \c .B nm\c \& lists the symbols from object files \c .I objfile\c \&. If no object files are given as arguments, \c .B nm\c \& assumes `\|\c .B a.out\c \|'. .SH OPTIONS The long and short forms of options, shown here as alternatives, are equivalent. .TP .B \-A .TP .B \-o .TP .B \-\-print\-file\-name Precede each symbol by the name of the input file where it was found, rather than identifying the input file once only before all of its symbols. .TP .B \-a .TP .B \-\-debug\-syms Display debugger-only symbols; normally these are not listed. .TP .B \-B The same as .B \-\-format=bsd (for compatibility with the MIPS \fBnm\fP). .TP .B \-C .TP .B \-\-demangle Decode (\fIdemangle\fP) low-level symbol names into user-level names. Besides removing any initial underscore prepended by the system, this makes C++ function names readable. .TP .B \-D .TP .B \-\-dynamic Display the dynamic symbols rather than the normal symbols. This is only meaningful for dynamic objects, such as certain types of shared libraries. .TP .B "\-f \fIformat" Use the output format \fIformat\fP, which can be ``bsd'', ``sysv'', or ``posix''. The default is ``bsd''. Only the first character of \fIformat\fP is significant; it can be either upper or lower case. .TP .B \-g .TP .B \-\-extern\-only Display only external symbols. .TP .B \-n .TP .B \-v .TP .B \-\-numeric\-sort Sort symbols numerically by their addresses, not alphabetically by their names. .TP .B \-p .TP .B \-\-no\-sort Don't bother to sort the symbols in any order; just print them in the order encountered. .TP .B \-P .TP .B \-\-portability Use the POSIX.2 standard output format instead of the default format. Equivalent to ``\-f posix''. .TP .B \-s .TP .B \-\-print\-armap When listing symbols from archive members, include the index: a mapping (stored in the archive by \c .B ar\c \& or \c .B ranlib\c \&) of what modules contain definitions for what names. .TP .B \-r .TP .B \-\-reverse\-sort Reverse the sense of the sort (whether numeric or alphabetic); let the last come first. .TP .B \-\-size\-sort Sort symbols by size. The size is computed as the difference between the value of the symbol and the value of the symbol with the next higher value. The size of the symbol is printed, rather than the value. .TP .B "\-t \fIradix" .TP .B "\-\-radix=\fIradix" Use \fIradix\fP as the radix for printing the symbol values. It must be ``d'' for decimal, ``o'' for octal, or ``x'' for hexadecimal. .TP .BI "\-\-target=" "bfdname" Specify an object code format other than your system's default format. See .BR objdump ( 1 ), for information on listing available formats. .TP .B \-u .TP .B \-\-undefined\-only Display only undefined symbols (those external to each object file). .TP .B \-l .TP .B \-\-line\-numbers For each symbol, use debugging information to try to find a filename and line number. For a defined symbol, look for the line number of the address of the symbol. For an undefined symbol, look for the line number of a relocation entry which refers to the symbol. If line number information can be found, print it after the other symbol information. .TP .B \-V .TP .B \-\-version Show the version number of .B nm and exit. .TP .B \-\-help Show a summary of the options to .B nm and exit. .SH "SEE ALSO" .RB "`\|" binutils "\|'" entry in .B info\c \&; .I The GNU Binary Utilities\c \&, Roland H. Pesch (October 1991); .BR ar "(" 1 ")," .BR objdump ( 1 ), .BR ranlib "(" 1 ")." .SH COPYING Copyright (c) 1991, 2000 Free Software Foundation, Inc. .PP This document is distributed under the terms of the GNU Free Documentation License, version 1.1. That license is described in the sources for this manual page, but it is not displayed here in order to make this manual more consise. Copies of this license can also be obtained from: http://www.gnu.org/copyleft/. \" .SH GNU Free Documentation License \" Version 1.1, March 2000 \" Copyright (C) 2000 Free Software Foundation, Inc. \" 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA \" Everyone is permitted to copy and distribute verbatim \" copies of this license document, but changing it is \" not allowed. \" .PP \" 0. PREAMBLE \" .PP \" The purpose of this License is to make a manual, textbook, or other \" written document "free" in the sense of freedom: to assure everyone \" the effective freedom to copy and redistribute it, with or without \" modifying it, either commercially or noncommercially. Secondarily, \" this License preserves for the author and publisher a way to get \" credit for their work, while not being considered responsible for \" modifications made by others. \" .PP \" This License is a kind of "copyleft", which means that derivative \" works of the document must themselves be free in the same sense. It \" complements the GNU General Public License, which is a copyleft \" license designed for free software. \" .PP \" We have designed this License in order to use it for manuals for free \" software, because free software needs free documentation: a free \" program should come with manuals providing the same freedoms that the \" software does. But this License is not limited to software manuals; \" it can be used for any textual work, regardless of subject matter or \" whether it is published as a printed book. We recommend this License \" principally for works whose purpose is instruction or reference. \" .PP \" 1. APPLICABILITY AND DEFINITIONS \" .PP \" This License applies to any manual or other work that contains a \" notice placed by the copyright holder saying it can be distributed \" under the terms of this License. The "Document", below, refers to any \" such manual or work. Any member of the public is a licensee, and is \" addressed as "you". \" .PP \" A "Modified Version" of the Document means any work containing the \" Document or a portion of it, either copied verbatim, or with \" modifications and/or translated into another language. \" .PP \" A "Secondary Section" is a named appendix or a front-matter section of \" the Document that deals exclusively with the relationship of the \" publishers or authors of the Document to the Document's overall subject \" (or to related matters) and contains nothing that could fall directly \" within that overall subject. (For example, if the Document is in part a \" textbook of mathematics, a Secondary Section may not explain any \" mathematics.) The relationship could be a matter of historical \" connection with the subject or with related matters, or of legal, \" commercial, philosophical, ethical or political position regarding \" them. \" .PP \" The "Invariant Sections" are certain Secondary Sections whose titles \" are designated, as being those of Invariant Sections, in the notice \" that says that the Document is released under this License. \" .PP \" The "Cover Texts" are certain short passages of text that are listed, \" as Front-Cover Texts or Back-Cover Texts, in the notice that says that \" the Document is released under this License. \" .PP \" A "Transparent" copy of the Document means a machine-readable copy, \" represented in a format whose specification is available to the \" general public, whose contents can be viewed and edited directly and \" straightforwardly with generic text editors or (for images composed of \" pixels) generic paint programs or (for drawings) some widely available \" drawing editor, and that is suitable for input to text formatters or \" for automatic translation to a variety of formats suitable for input \" to text formatters. A copy made in an otherwise Transparent file \" format whose markup has been designed to thwart or discourage \" subsequent modification by readers is not Transparent. A copy that is \" not "Transparent" is called "Opaque". \" .PP \" Examples of suitable formats for Transparent copies include plain \" ASCII without markup, Texinfo input format, LaTeX input format, SGML \" or XML using a publicly available DTD, and standard-conforming simple \" HTML designed for human modification. Opaque formats include \" PostScript, PDF, proprietary formats that can be read and edited only \" by proprietary word processors, SGML or XML for which the DTD and/or \" processing tools are not generally available, and the \" machine-generated HTML produced by some word processors for output \" purposes only. \" .PP \" The "Title Page" means, for a printed book, the title page itself, \" plus such following pages as are needed to hold, legibly, the material \" this License requires to appear in the title page. For works in \" formats which do not have any title page as such, "Title Page" means \" the text near the most prominent appearance of the work's title, \" preceding the beginning of the body of the text. \" .PP \" 2. VERBATIM COPYING \" .PP \" You may copy and distribute the Document in any medium, either \" commercially or noncommercially, provided that this License, the \" copyright notices, and the license notice saying this License applies \" to the Document are reproduced in all copies, and that you add no other \" conditions whatsoever to those of this License. You may not use \" technical measures to obstruct or control the reading or further \" copying of the copies you make or distribute. However, you may accept \" compensation in exchange for copies. If you distribute a large enough \" number of copies you must also follow the conditions in section 3. \" .PP \" You may also lend copies, under the same conditions stated above, and \" you may publicly display copies. \" .PP \" 3. COPYING IN QUANTITY \" .PP \" If you publish printed copies of the Document numbering more than 100, \" and the Document's license notice requires Cover Texts, you must enclose \" the copies in covers that carry, clearly and legibly, all these Cover \" Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on \" the back cover. Both covers must also clearly and legibly identify \" you as the publisher of these copies. The front cover must present \" the full title with all words of the title equally prominent and \" visible. You may add other material on the covers in addition. \" Copying with changes limited to the covers, as long as they preserve \" the title of the Document and satisfy these conditions, can be treated \" as verbatim copying in other respects. \" .PP \" If the required texts for either cover are too voluminous to fit \" legibly, you should put the first ones listed (as many as fit \" reasonably) on the actual cover, and continue the rest onto adjacent \" pages. \" .PP \" If you publish or distribute Opaque copies of the Document numbering \" more than 100, you must either include a machine-readable Transparent \" copy along with each Opaque copy, or state in or with each Opaque copy \" a publicly-accessible computer-network location containing a complete \" Transparent copy of the Document, free of added material, which the \" general network-using public has access to download anonymously at no \" charge using public-standard network protocols. If you use the latter \" option, you must take reasonably prudent steps, when you begin \" distribution of Opaque copies in quantity, to ensure that this \" Transparent copy will remain thus accessible at the stated location \" until at least one year after the last time you distribute an Opaque \" copy (directly or through your agents or retailers) of that edition to \" the public. \" .PP \" It is requested, but not required, that you contact the authors of the \" Document well before redistributing any large number of copies, to give \" them a chance to provide you with an updated version of the Document. \" .PP \" 4. MODIFICATIONS \" .PP \" You may copy and distribute a Modified Version of the Document under \" the conditions of sections 2 and 3 above, provided that you release \" the Modified Version under precisely this License, with the Modified \" Version filling the role of the Document, thus licensing distribution \" and modification of the Modified Version to whoever possesses a copy \" of it. In addition, you must do these things in the Modified Version: \" .PP \" A. Use in the Title Page (and on the covers, if any) a title distinct \" from that of the Document, and from those of previous versions \" (which should, if there were any, be listed in the History section \" of the Document). You may use the same title as a previous version \" if the original publisher of that version gives permission. \" .PP \" B. List on the Title Page, as authors, one or more persons or entities \" responsible for authorship of the modifications in the Modified \" Version, together with at least five of the principal authors of the \" Document (all of its principal authors, if it has less than five). \" .PP \" C. State on the Title page the name of the publisher of the \" Modified Version, as the publisher. \" .PP \" D. Preserve all the copyright notices of the Document. \" .PP \" E. Add an appropriate copyright notice for your modifications \" adjacent to the other copyright notices. \" .PP \" F. Include, immediately after the copyright notices, a license notice \" giving the public permission to use the Modified Version under the \" terms of this License, in the form shown in the Addendum below. \" Preserve in that license notice the full lists of Invariant Sections \" and required Cover Texts given in the Document's license notice. \" .PP \" H. Include an unaltered copy of this License. \" .PP \" I. Preserve the section entitled "History", and its title, and add to \" it an item stating at least the title, year, new authors, and \" publisher of the Modified Version as given on the Title Page. If \" there is no section entitled "History" in the Document, create one \" stating the title, year, authors, and publisher of the Document as \" given on its Title Page, then add an item describing the Modified \" Version as stated in the previous sentence. \" .PP \" J. Preserve the network location, if any, given in the Document for \" public access to a Transparent copy of the Document, and likewise \" the network locations given in the Document for previous versions \" it was based on. These may be placed in the "History" section. \" You may omit a network location for a work that was published at \" least four years before the Document itself, or if the original \" publisher of the version it refers to gives permission. \" .PP \" K. In any section entitled "Acknowledgements" or "Dedications", \" preserve the section's title, and preserve in the section all the \" substance and tone of each of the contributor acknowledgements \" and/or dedications given therein. \" .PP \" L. Preserve all the Invariant Sections of the Document, \" unaltered in their text and in their titles. Section numbers \" or the equivalent are not considered part of the section titles. \" .PP \" M. Delete any section entitled "Endorsements". Such a section \" may not be included in the Modified Version. \" .PP \" N. Do not retitle any existing section as "Endorsements" \" or to conflict in title with any Invariant Section. \" .PP \" If the Modified Version includes new front-matter sections or \" appendices that qualify as Secondary Sections and contain no material \" copied from the Document, you may at your option designate some or all \" of these sections as invariant. To do this, add their titles to the \" list of Invariant Sections in the Modified Version's license notice. \" These titles must be distinct from any other section titles. \" .PP \" You may add a section entitled "Endorsements", provided it contains \" nothing but endorsements of your Modified Version by various \" parties--for example, statements of peer review or that the text has \" been approved by an organization as the authoritative definition of a \" standard. \" .PP \" You may add a passage of up to five words as a Front-Cover Text, and a \" passage of up to 25 words as a Back-Cover Text, to the end of the list \" of Cover Texts in the Modified Version. Only one passage of \" Front-Cover Text and one of Back-Cover Text may be added by (or \" through arrangements made by) any one entity. If the Document already \" includes a cover text for the same cover, previously added by you or \" by arrangement made by the same entity you are acting on behalf of, \" you may not add another; but you may replace the old one, on explicit \" permission from the previous publisher that added the old one. \" .PP \" The author(s) and publisher(s) of the Document do not by this License \" give permission to use their names for publicity for or to assert or \" imply endorsement of any Modified Version. \" .PP \" 5. COMBINING DOCUMENTS \" .PP \" You may combine the Document with other documents released under this \" License, under the terms defined in section 4 above for modified \" versions, provided that you include in the combination all of the \" Invariant Sections of all of the original documents, unmodified, and \" list them all as Invariant Sections of your combined work in its \" license notice. \" .PP \" The combined work need only contain one copy of this License, and \" multiple identical Invariant Sections may be replaced with a single \" copy. If there are multiple Invariant Sections with the same name but \" different contents, make the title of each such section unique by \" adding at the end of it, in parentheses, the name of the original \" author or publisher of that section if known, or else a unique number. \" Make the same adjustment to the section titles in the list of \" Invariant Sections in the license notice of the combined work. \" .PP \" In the combination, you must combine any sections entitled "History" \" in the various original documents, forming one section entitled \" "History"; likewise combine any sections entitled "Acknowledgements", \" and any sections entitled "Dedications". You must delete all sections \" entitled "Endorsements." \" .PP \" 6. COLLECTIONS OF DOCUMENTS \" .PP \" You may make a collection consisting of the Document and other documents \" released under this License, and replace the individual copies of this \" License in the various documents with a single copy that is included in \" the collection, provided that you follow the rules of this License for \" verbatim copying of each of the documents in all other respects. \" .PP \" You may extract a single document from such a collection, and distribute \" it individually under this License, provided you insert a copy of this \" License into the extracted document, and follow this License in all \" other respects regarding verbatim copying of that document. \" .PP \" 7. AGGREGATION WITH INDEPENDENT WORKS \" .PP \" A compilation of the Document or its derivatives with other separate \" and independent documents or works, in or on a volume of a storage or \" distribution medium, does not as a whole count as a Modified Version \" of the Document, provided no compilation copyright is claimed for the \" compilation. Such a compilation is called an "aggregate", and this \" License does not apply to the other self-contained works thus compiled \" with the Document, on account of their being thus compiled, if they \" are not themselves derivative works of the Document. \" .PP \" If the Cover Text requirement of section 3 is applicable to these \" copies of the Document, then if the Document is less than one quarter \" of the entire aggregate, the Document's Cover Texts may be placed on \" covers that surround only the Document within the aggregate. \" Otherwise they must appear on covers around the whole aggregate. \" .PP \" 8. TRANSLATION \" .PP \" Translation is considered a kind of modification, so you may \" distribute translations of the Document under the terms of section 4. \" Replacing Invariant Sections with translations requires special \" permission from their copyright holders, but you may include \" translations of some or all Invariant Sections in addition to the \" original versions of these Invariant Sections. You may include a \" translation of this License provided that you also include the \" original English version of this License. In case of a disagreement \" between the translation and the original English version of this \" License, the original English version will prevail. \" .PP \" 9. TERMINATION \" .PP \" You may not copy, modify, sublicense, or distribute the Document except \" as expressly provided for under this License. Any other attempt to \" copy, modify, sublicense or distribute the Document is void, and will \" automatically terminate your rights under this License. However, \" parties who have received copies, or rights, from you under this \" License will not have their licenses terminated so long as such \" parties remain in full compliance. \" .PP \" 10. FUTURE REVISIONS OF THIS LICENSE \" .PP \" The Free Software Foundation may publish new, revised versions \" of the GNU Free Documentation License from time to time. Such new \" versions will be similar in spirit to the present version, but may \" differ in detail to address new problems or concerns. See \" http://www.gnu.org/copyleft/. \" .PP \" Each version of the License is given a distinguishing version number. \" If the Document specifies that a particular numbered version of this \" License "or any later version" applies to it, you have the option of \" following the terms and conditions either of that specified version or \" of any later version that has been published (not as a draft) by the \" Free Software Foundation. If the Document does not specify a version \" number of this License, you may choose any version ever published (not \" as a draft) by the Free Software Foundation. \" .PP \" ADDENDUM: How to use this License for your documents \" .PP \" To use this License in a document you have written, include a copy of \" the License in the document and put the following copyright and \" license notices just after the title page: \" .PP \" Copyright (c) YEAR YOUR NAME. \" Permission is granted to copy, distribute and/or \" modify this document under the terms of the GNU \" Free Documentation License, Version 1.1 or any later \" version published by the Free Software Foundation; \" with the Invariant Sections being LIST THEIR TITLES, \" with the Front-Cover Texts being LIST, and with the \" Back-Cover Texts being LIST. A copy of the license \" is included in the section entitled "GNU Free \" Documentation License". \" .PP \" If you have no Invariant Sections, write "with no Invariant Sections" \" instead of saying which ones are invariant. If you have no \" Front-Cover Texts, write "no Front-Cover Texts" instead of \" "Front-Cover Texts being LIST"; likewise for Back-Cover Texts. \" .PP \" If your document contains nontrivial examples of program code, we \" recommend releasing these examples in parallel under your choice of \" free software license, such as the GNU General Public License, \" to permit their use in free software. binutils/binutils-MAN/opt/binutils/man/man1/objcopy.1010064400000000000003000000621610732753202100213060ustar000300000000000000.\" Automatically generated by Pod::Man version 1.02 .\" Wed May 30 12:24:28 2001 .\" .\" Standard preamble: .\" ====================================================================== .de Sh \" Subsection heading .br .if t .Sp .ne 5 .PP \fB\\$1\fR .PP .. .de Sp \" Vertical space (when we can't use .PP) .if t .sp .5v .if n .sp .. .de Ip \" List item .br .ie \\n(.$>=3 .ne \\$3 .el .ne 3 .IP "\\$1" \\$2 .. .de Vb \" Begin verbatim text .ft CW .nf .ne \\$1 .. .de Ve \" End verbatim text .ft R .fi .. .\" Set up some character translations and predefined strings. \*(-- will .\" give an unbreakable dash, \*(PI will give pi, \*(L" will give a left .\" double quote, and \*(R" will give a right double quote. | will give a .\" real vertical bar. \*(C+ will give a nicer C++. Capital omega is used .\" to do unbreakable dashes and therefore won't be available. \*(C` and .\" \*(C' expand to `' in nroff, nothing in troff, for use with C<> .tr \(*W-|\(bv\*(Tr .ds C+ C\v'-.1v'\h'-1p'\s-2+\h'-1p'+\s0\v'.1v'\h'-1p' .ie n \{\ . ds -- \(*W- . ds PI pi . if (\n(.H=4u)&(1m=24u) .ds -- \(*W\h'-12u'\(*W\h'-12u'-\" diablo 10 pitch . if (\n(.H=4u)&(1m=20u) .ds -- \(*W\h'-12u'\(*W\h'-8u'-\" diablo 12 pitch . ds L" "" . ds R" "" . ds C` ` . ds C' ' 'br\} .el\{\ . ds -- \|\(em\| . ds PI \(*p . ds L" `` . ds R" '' 'br\} .\" .\" If the F register is turned on, we'll generate index entries on stderr .\" for titles (.TH), headers (.SH), subsections (.Sh), items (.Ip), and .\" index entries marked with X<> in POD. Of course, you'll have to process .\" the output yourself in some meaningful fashion. .if \nF \{\ . de IX . tm Index:\\$1\t\\n%\t"\\$2" . . . nr % 0 . rr F .\} .\" .\" For nroff, turn off justification. Always turn off hyphenation; it .\" makes way too many mistakes in technical documents. .hy 0 .\" .\" Accent mark definitions (@(#)ms.acc 1.5 88/02/08 SMI; from UCB 4.2). .\" Fear. Run. Save yourself. No user-serviceable parts. .bd B 3 . \" fudge factors for nroff and troff .if n \{\ . ds #H 0 . ds #V .8m . ds #F .3m . ds #[ \f1 . ds #] \fP .\} .if t \{\ . ds #H ((1u-(\\\\n(.fu%2u))*.13m) . ds #V .6m . ds #F 0 . ds #[ \& . ds #] \& .\} . \" simple accents for nroff and troff .if n \{\ . ds ' \& . ds ` \& . ds ^ \& . ds , \& . ds ~ ~ . ds / .\} .if t \{\ . ds ' \\k:\h'-(\\n(.wu*8/10-\*(#H)'\'\h"|\\n:u" . ds ` \\k:\h'-(\\n(.wu*8/10-\*(#H)'\`\h'|\\n:u' . ds ^ \\k:\h'-(\\n(.wu*10/11-\*(#H)'^\h'|\\n:u' . ds , \\k:\h'-(\\n(.wu*8/10)',\h'|\\n:u' . ds ~ \\k:\h'-(\\n(.wu-\*(#H-.1m)'~\h'|\\n:u' . ds / \\k:\h'-(\\n(.wu*8/10-\*(#H)'\z\(sl\h'|\\n:u' .\} . \" troff and (daisy-wheel) nroff accents .ds : \\k:\h'-(\\n(.wu*8/10-\*(#H+.1m+\*(#F)'\v'-\*(#V'\z.\h'.2m+\*(#F'.\h'|\\n:u'\v'\*(#V' .ds 8 \h'\*(#H'\(*b\h'-\*(#H' .ds o \\k:\h'-(\\n(.wu+\w'\(de'u-\*(#H)/2u'\v'-.3n'\*(#[\z\(de\v'.3n'\h'|\\n:u'\*(#] .ds d- \h'\*(#H'\(pd\h'-\w'~'u'\v'-.25m'\f2\(hy\fP\v'.25m'\h'-\*(#H' .ds D- D\\k:\h'-\w'D'u'\v'-.11m'\z\(hy\v'.11m'\h'|\\n:u' .ds th \*(#[\v'.3m'\s+1I\s-1\v'-.3m'\h'-(\w'I'u*2/3)'\s-1o\s+1\*(#] .ds Th \*(#[\s+2I\s-2\h'-\w'I'u*3/5'\v'-.3m'o\v'.3m'\*(#] .ds ae a\h'-(\w'a'u*4/10)'e .ds Ae A\h'-(\w'A'u*4/10)'E . \" corrections for vroff .if v .ds ~ \\k:\h'-(\\n(.wu*9/10-\*(#H)'\s-2\u~\d\s+2\h'|\\n:u' .if v .ds ^ \\k:\h'-(\\n(.wu*10/11-\*(#H)'\v'-.4m'^\v'.4m'\h'|\\n:u' . \" for low resolution devices (crt and lpr) .if \n(.H>23 .if \n(.V>19 \ \{\ . ds : e . ds 8 ss . ds o a . ds d- d\h'-1'\(ga . ds D- D\h'-1'\(hy . ds th \o'bp' . ds Th \o'LP' . ds ae ae . ds Ae AE .\} .rm #[ #] #H #V #F C .\" ====================================================================== .\" .IX Title "OBJCOPY.1 1" .TH OBJCOPY.1 1 "binutils-2.11.90" "2001-05-30" "GNU" .UC .SH "NAME" objcopy \- copy and translate object files .SH "SYNOPSIS" .IX Header "SYNOPSIS" objcopy [ \-F \fIbfdname\fR | \-\-target=\fIbfdname\fR ] [ \-I \fIbfdname\fR | \-\-input-target=\fIbfdname\fR ] [ \-O \fIbfdname\fR | \-\-output-target=\fIbfdname\fR ] [ \-B \fIbfdarch\fR | \-\-binary-architecture=\fIbfdarch\fR ] [ \-S | \-\-strip-all ] [ \-g | \-\-strip-debug ] [ \-K \fIsymbolname\fR | \-\-keep-symbol=\fIsymbolname\fR ] [ \-N \fIsymbolname\fR | \-\-strip-symbol=\fIsymbolname\fR ] [ \-G \fIsymbolname\fR | \-\-keep-global-symbol=\fIsymbolname\fR] [ \-L \fIsymbolname\fR | \-\-localize-symbol=\fIsymbolname\fR ] [ \-W \fIsymbolname\fR | \-\-weaken-symbol=\fIsymbolname\fR ] [ \-x | \-\-discard-all ] [ \-X | \-\-discard-locals ] [ \-b \fIbyte\fR | \-\-byte=\fIbyte\fR ] [ \-i \fIinterleave\fR | \-\-interleave=\fIinterleave\fR ] [ \-j \fIsectionname\fR | \-\-only-section=\fIsectionname\fR ] [ \-R \fIsectionname\fR | \-\-remove-section=\fIsectionname\fR ] [ \-p | \-\-preserve-dates ] [ \-\-debugging ] [ \-\-gap-fill=\fIval\fR ] [ \-\-pad-to=\fIaddress\fR ] [ \-\-set-start=\fIval\fR ] [ \-\-adjust-start=\fIincr\fR ] [ \-\-change-addresses=\fIincr\fR ] [ \-\-change-section-address \fIsection\fR{=,+,\-}\fIval\fR ] [ \-\-change-section-lma \fIsection\fR{=,+,\-}\fIval\fR ] [ \-\-change-section-vma \fIsection\fR{=,+,\-}\fIval\fR ] [ \-\-change-warnings ] [ \-\-no-change-warnings ] [ \-\-set-section-flags \fIsection\fR=\fIflags\fR ] [ \-\-add-section \fIsectionname\fR=\fIfilename\fR ] [ \-\-change-leading-char ] [ \-\-remove-leading-char ] [ \-\-srec-len=\fIival\fR ] [ \-\-srec-forceS3 ] [ \-\-redefine-sym \fIold\fR=\fInew\fR ] [ \-\-weaken ] [ \-\-keep-symbols=\fIfilename\fR ] [ \-\-strip-symbols=\fIfilename\fR ] [ \-\-keep-global-symbols=\fIfilename\fR ] [ \-\-localize-symbols=\fIfilename\fR ] [ \-\-weaken-symbols=\fIfilename\fR ] [ \-v | \-\-verbose ] [ \-V | \-\-version ] [ \-\-help ] \fIinfile\fR [\fIoutfile\fR] .SH "DESCRIPTION" .IX Header "DESCRIPTION" The \s-1GNU\s0 \f(CW\*(C`objcopy\*(C'\fR utility copies the contents of an object file to another. \f(CW\*(C`objcopy\*(C'\fR uses the \s-1GNU\s0 \s-1BFD\s0 Library to read and write the object files. It can write the destination object file in a format different from that of the source object file. The exact behavior of \f(CW\*(C`objcopy\*(C'\fR is controlled by command-line options. Note that \f(CW\*(C`objcopy\*(C'\fR should be able to copy a fully linked file between any two formats. However, copying a relocatable object file between any two formats may not work as expected. .PP \&\f(CW\*(C`objcopy\*(C'\fR creates temporary files to do its translations and deletes them afterward. \f(CW\*(C`objcopy\*(C'\fR uses \s-1BFD\s0 to do all its translation work; it has access to all the formats described in \s-1BFD\s0 and thus is able to recognize most formats without being told explicitly. .PP \&\f(CW\*(C`objcopy\*(C'\fR can be used to generate S-records by using an output target of \fBsrec\fR (e.g., use \fB\-O srec\fR). .PP \&\f(CW\*(C`objcopy\*(C'\fR can be used to generate a raw binary file by using an output target of \fBbinary\fR (e.g., use \fB\-O binary\fR). When \&\f(CW\*(C`objcopy\*(C'\fR generates a raw binary file, it will essentially produce a memory dump of the contents of the input object file. All symbols and relocation information will be discarded. The memory dump will start at the load address of the lowest section copied into the output file. .PP When generating an S-record or a raw binary file, it may be helpful to use \fB\-S\fR to remove sections containing debugging information. In some cases \fB\-R\fR will be useful to remove sections which contain information that is not needed by the binary file. .PP Note \- \f(CW\*(C`objcopy\*(C'\fR is not able to change the endianness of its input files. If the input format has an endianness, (some formats do not), \&\f(CW\*(C`objcopy\*(C'\fR can only copy the inputs into file formats that have the same endianness or which have no endianness (eg \fBsrec\fR). .SH "OPTIONS" .IX Header "OPTIONS" .Ip "\f(CW\*(C`\f(CIinfile\f(CW\*(C'\fR" 4 .IX Item "infile" .Ip "\f(CW\*(C`\f(CIoutfile\f(CW\*(C'\fR" 4 .IX Item "outfile" The input and output files, respectively. If you do not specify \fIoutfile\fR, \f(CW\*(C`objcopy\*(C'\fR creates a temporary file and destructively renames the result with the name of \fIinfile\fR. .Ip "\f(CW\*(C`\-I \f(CIbfdname\f(CW \*(C'\fR" 4 .IX Item "-I bfdname " .Ip "\f(CW\*(C`\-\-input\-target=\f(CIbfdname\f(CW\*(C'\fR" 4 .IX Item "--input-target=bfdname" Consider the source file's object format to be \fIbfdname\fR, rather than attempting to deduce it. .Ip "\f(CW\*(C`\-O \f(CIbfdname\f(CW\*(C'\fR" 4 .IX Item "-O bfdname" .Ip "\f(CW\*(C`\-\-output\-target=\f(CIbfdname\f(CW\*(C'\fR" 4 .IX Item "--output-target=bfdname" Write the output file using the object format \fIbfdname\fR. .Ip "\f(CW\*(C`\-F \f(CIbfdname\f(CW\*(C'\fR" 4 .IX Item "-F bfdname" .Ip "\f(CW\*(C`\-\-target=\f(CIbfdname\f(CW\*(C'\fR" 4 .IX Item "--target=bfdname" Use \fIbfdname\fR as the object format for both the input and the output file; i.e., simply transfer data from source to destination with no translation. .Ip "\f(CW\*(C`\-B \f(CIbfdarch\f(CW\*(C'\fR" 4 .IX Item "-B bfdarch" .Ip "\f(CW\*(C`\-\-binary\-architecture=\f(CIbfdarch\f(CW\*(C'\fR" 4 .IX Item "--binary-architecture=bfdarch" Useful when transforming a raw binary input file into an object file. In this case the output architecture can be set to \fIbfdarch\fR. This option will be ignored if the input file has a known \fIbfdarch\fR. You can access this binary data inside a program by referencing the special symbols that are created by the conversion process. These symbols are called _binary_\fIobjfile\fR_start, _binary_\fIobjfile\fR_end and _binary_\fIobjfile\fR_size. e.g. you can transform a picture file into an object file and then access it in your code using these symbols. .Ip "\f(CW\*(C`\-j \f(CIsectionname\f(CW\*(C'\fR" 4 .IX Item "-j sectionname" .Ip "\f(CW\*(C`\-\-only\-section=\f(CIsectionname\f(CW\*(C'\fR" 4 .IX Item "--only-section=sectionname" Copy only the named section from the input file to the output file. This option may be given more than once. Note that using this option inappropriately may make the output file unusable. .Ip "\f(CW\*(C`\-R \f(CIsectionname\f(CW\*(C'\fR" 4 .IX Item "-R sectionname" .Ip "\f(CW\*(C`\-\-remove\-section=\f(CIsectionname\f(CW\*(C'\fR" 4 .IX Item "--remove-section=sectionname" Remove any section named \fIsectionname\fR from the output file. This option may be given more than once. Note that using this option inappropriately may make the output file unusable. .Ip "\f(CW\*(C`\-S\*(C'\fR" 4 .IX Item "-S" .Ip "\f(CW\*(C`\-\-strip\-all\*(C'\fR" 4 .IX Item "--strip-all" Do not copy relocation and symbol information from the source file. .Ip "\f(CW\*(C`\-g\*(C'\fR" 4 .IX Item "-g" .Ip "\f(CW\*(C`\-\-strip\-debug\*(C'\fR" 4 .IX Item "--strip-debug" Do not copy debugging symbols from the source file. .Ip "\f(CW\*(C`\-\-strip\-unneeded\*(C'\fR" 4 .IX Item "--strip-unneeded" Strip all symbols that are not needed for relocation processing. .Ip "\f(CW\*(C`\-K \f(CIsymbolname\f(CW\*(C'\fR" 4 .IX Item "-K symbolname" .Ip "\f(CW\*(C`\-\-keep\-symbol=\f(CIsymbolname\f(CW\*(C'\fR" 4 .IX Item "--keep-symbol=symbolname" Copy only symbol \fIsymbolname\fR from the source file. This option may be given more than once. .Ip "\f(CW\*(C`\-N \f(CIsymbolname\f(CW\*(C'\fR" 4 .IX Item "-N symbolname" .Ip "\f(CW\*(C`\-\-strip\-symbol=\f(CIsymbolname\f(CW\*(C'\fR" 4 .IX Item "--strip-symbol=symbolname" Do not copy symbol \fIsymbolname\fR from the source file. This option may be given more than once. .Ip "\f(CW\*(C`\-G \f(CIsymbolname\f(CW\*(C'\fR" 4 .IX Item "-G symbolname" .Ip "\f(CW\*(C`\-\-keep\-global\-symbol=\f(CIsymbolname\f(CW\*(C'\fR" 4 .IX Item "--keep-global-symbol=symbolname" Keep only symbol \fIsymbolname\fR global. Make all other symbols local to the file, so that they are not visible externally. This option may be given more than once. .Ip "\f(CW\*(C`\-L \f(CIsymbolname\f(CW\*(C'\fR" 4 .IX Item "-L symbolname" .Ip "\f(CW\*(C`\-\-localize\-symbol=\f(CIsymbolname\f(CW\*(C'\fR" 4 .IX Item "--localize-symbol=symbolname" Make symbol \fIsymbolname\fR local to the file, so that it is not visible externally. This option may be given more than once. .Ip "\f(CW\*(C`\-W \f(CIsymbolname\f(CW\*(C'\fR" 4 .IX Item "-W symbolname" .Ip "\f(CW\*(C`\-\-weaken\-symbol=\f(CIsymbolname\f(CW\*(C'\fR" 4 .IX Item "--weaken-symbol=symbolname" Make symbol \fIsymbolname\fR weak. This option may be given more than once. .Ip "\f(CW\*(C`\-x\*(C'\fR" 4 .IX Item "-x" .Ip "\f(CW\*(C`\-\-discard\-all\*(C'\fR" 4 .IX Item "--discard-all" Do not copy non-global symbols from the source file. .Ip "\f(CW\*(C`\-X\*(C'\fR" 4 .IX Item "-X" .Ip "\f(CW\*(C`\-\-discard\-locals\*(C'\fR" 4 .IX Item "--discard-locals" Do not copy compiler-generated local symbols. (These usually start with \fBL\fR or \fB.\fR.) .Ip "\f(CW\*(C`\-b \f(CIbyte\f(CW\*(C'\fR" 4 .IX Item "-b byte" .Ip "\f(CW\*(C`\-\-byte=\f(CIbyte\f(CW\*(C'\fR" 4 .IX Item "--byte=byte" Keep only every \fIbyte\fRth byte of the input file (header data is not affected). \fIbyte\fR can be in the range from 0 to \fIinterleave\fR\-1, where \fIinterleave\fR is given by the \fB\-i\fR or \fB\*(--interleave\fR option, or the default of 4. This option is useful for creating files to program \s-1ROM\s0. It is typically used with an \f(CW\*(C`srec\*(C'\fR output target. .Ip "\f(CW\*(C`\-i \f(CIinterleave\f(CW\*(C'\fR" 4 .IX Item "-i interleave" .Ip "\f(CW\*(C`\-\-interleave=\f(CIinterleave\f(CW\*(C'\fR" 4 .IX Item "--interleave=interleave" Only copy one out of every \fIinterleave\fR bytes. Select which byte to copy with the \fI\-b\fR or \fB\*(--byte\fR option. The default is 4. \&\f(CW\*(C`objcopy\*(C'\fR ignores this option if you do not specify either \fB\-b\fR or \&\fB\*(--byte\fR. .Ip "\f(CW\*(C`\-p\*(C'\fR" 4 .IX Item "-p" .Ip "\f(CW\*(C`\-\-preserve\-dates\*(C'\fR" 4 .IX Item "--preserve-dates" Set the access and modification dates of the output file to be the same as those of the input file. .Ip "\f(CW\*(C`\-\-debugging\*(C'\fR" 4 .IX Item "--debugging" Convert debugging information, if possible. This is not the default because only certain debugging formats are supported, and the conversion process can be time consuming. .Ip "\f(CW\*(C`\-\-gap\-fill \f(CIval\f(CW\*(C'\fR" 4 .IX Item "--gap-fill val" Fill gaps between sections with \fIval\fR. This operation applies to the \fIload address\fR (\s-1LMA\s0) of the sections. It is done by increasing the size of the section with the lower address, and filling in the extra space created with \fIval\fR. .Ip "\f(CW\*(C`\-\-pad\-to \f(CIaddress\f(CW\*(C'\fR" 4 .IX Item "--pad-to address" Pad the output file up to the load address \fIaddress\fR. This is done by increasing the size of the last section. The extra space is filled in with the value specified by \fB\*(--gap-fill\fR (default zero). .Ip "\f(CW\*(C`\-\-set\-start \f(CIval\f(CW\*(C'\fR" 4 .IX Item "--set-start val" Set the start address of the new file to \fIval\fR. Not all object file formats support setting the start address. .Ip "\f(CW\*(C`\-\-change\-start \f(CIincr\f(CW\*(C'\fR" 4 .IX Item "--change-start incr" .Ip "\f(CW\*(C`\-\-adjust\-start \f(CIincr\f(CW\*(C'\fR" 4 .IX Item "--adjust-start incr" Change the start address by adding \fIincr\fR. Not all object file formats support setting the start address. .Ip "\f(CW\*(C`\-\-change\-addresses \f(CIincr\f(CW\*(C'\fR" 4 .IX Item "--change-addresses incr" .Ip "\f(CW\*(C`\-\-adjust\-vma \f(CIincr\f(CW\*(C'\fR" 4 .IX Item "--adjust-vma incr" Change the \s-1VMA\s0 and \s-1LMA\s0 addresses of all sections, as well as the start address, by adding \fIincr\fR. Some object file formats do not permit section addresses to be changed arbitrarily. Note that this does not relocate the sections; if the program expects sections to be loaded at a certain address, and this option is used to change the sections such that they are loaded at a different address, the program may fail. .Ip "\f(CW\*(C`\-\-change\-section\-address \f(CIsection\f(CW{=,+,\-}\f(CIval\f(CW\*(C'\fR" 4 .IX Item "--change-section-address section{=,+,-}val" .Ip "\f(CW\*(C`\-\-adjust\-section\-vma \f(CIsection\f(CW{=,+,\-}\f(CIval\f(CW\*(C'\fR" 4 .IX Item "--adjust-section-vma section{=,+,-}val" Set or change both the \s-1VMA\s0 address and the \s-1LMA\s0 address of the named \&\fIsection\fR. If \fB=\fR is used, the section address is set to \&\fIval\fR. Otherwise, \fIval\fR is added to or subtracted from the section address. See the comments under \fB\*(--change-addresses\fR, above. If \fIsection\fR does not exist in the input file, a warning will be issued, unless \fB\*(--no-change-warnings\fR is used. .Ip "\f(CW\*(C`\-\-change\-section\-lma \f(CIsection\f(CW{=,+,\-}\f(CIval\f(CW\*(C'\fR" 4 .IX Item "--change-section-lma section{=,+,-}val" Set or change the \s-1LMA\s0 address of the named \fIsection\fR. The \s-1LMA\s0 address is the address where the section will be loaded into memory at program load time. Normally this is the same as the \s-1VMA\s0 address, which is the address of the section at program run time, but on some systems, especially those where a program is held in \s-1ROM\s0, the two can be different. If \fB=\fR is used, the section address is set to \&\fIval\fR. Otherwise, \fIval\fR is added to or subtracted from the section address. See the comments under \fB\*(--change-addresses\fR, above. If \fIsection\fR does not exist in the input file, a warning will be issued, unless \fB\*(--no-change-warnings\fR is used. .Ip "\f(CW\*(C`\-\-change\-section\-vma \f(CIsection\f(CW{=,+,\-}\f(CIval\f(CW\*(C'\fR" 4 .IX Item "--change-section-vma section{=,+,-}val" Set or change the \s-1VMA\s0 address of the named \fIsection\fR. The \s-1VMA\s0 address is the address where the section will be located once the program has started executing. Normally this is the same as the \s-1LMA\s0 address, which is the address where the section will be loaded into memory, but on some systems, especially those where a program is held in \&\s-1ROM\s0, the two can be different. If \fB=\fR is used, the section address is set to \fIval\fR. Otherwise, \fIval\fR is added to or subtracted from the section address. See the comments under \&\fB\*(--change-addresses\fR, above. If \fIsection\fR does not exist in the input file, a warning will be issued, unless \&\fB\*(--no-change-warnings\fR is used. .Ip "\f(CW\*(C`\-\-change\-warnings\*(C'\fR" 4 .IX Item "--change-warnings" .Ip "\f(CW\*(C`\-\-adjust\-warnings\*(C'\fR" 4 .IX Item "--adjust-warnings" If \fB\*(--change-section-address\fR or \fB\*(--change-section-lma\fR or \&\fB\*(--change-section-vma\fR is used, and the named section does not exist, issue a warning. This is the default. .Ip "\f(CW\*(C`\-\-no\-change\-warnings\*(C'\fR" 4 .IX Item "--no-change-warnings" .Ip "\f(CW\*(C`\-\-no\-adjust\-warnings\*(C'\fR" 4 .IX Item "--no-adjust-warnings" Do not issue a warning if \fB\*(--change-section-address\fR or \&\fB\*(--adjust-section-lma\fR or \fB\*(--adjust-section-vma\fR is used, even if the named section does not exist. .Ip "\f(CW\*(C`\-\-set\-section\-flags \f(CIsection\f(CW=\f(CIflags\f(CW\*(C'\fR" 4 .IX Item "--set-section-flags section=flags" Set the flags for the named section. The \fIflags\fR argument is a comma separated string of flag names. The recognized names are \&\fBalloc\fR, \fBcontents\fR, \fBload\fR, \fBnoload\fR, \&\fBreadonly\fR, \fBcode\fR, \fBdata\fR, \fBrom\fR, \fBshare\fR, and \&\fBdebug\fR. You can set the \fBcontents\fR flag for a section which does not have contents, but it is not meaningful to clear the \&\fBcontents\fR flag of a section which does have contents\*(--just remove the section instead. Not all flags are meaningful for all object file formats. .Ip "\f(CW\*(C`\-\-add\-section \f(CIsectionname\f(CW=\f(CIfilename\f(CW\*(C'\fR" 4 .IX Item "--add-section sectionname=filename" Add a new section named \fIsectionname\fR while copying the file. The contents of the new section are taken from the file \fIfilename\fR. The size of the section will be the size of the file. This option only works on file formats which can support sections with arbitrary names. .Ip "\f(CW\*(C`\-\-change\-leading\-char\*(C'\fR" 4 .IX Item "--change-leading-char" Some object file formats use special characters at the start of symbols. The most common such character is underscore, which compilers often add before every symbol. This option tells \f(CW\*(C`objcopy\*(C'\fR to change the leading character of every symbol when it converts between object file formats. If the object file formats use the same leading character, this option has no effect. Otherwise, it will add a character, or remove a character, or change a character, as appropriate. .Ip "\f(CW\*(C`\-\-remove\-leading\-char\*(C'\fR" 4 .IX Item "--remove-leading-char" If the first character of a global symbol is a special symbol leading character used by the object file format, remove the character. The most common symbol leading character is underscore. This option will remove a leading underscore from all global symbols. This can be useful if you want to link together objects of different file formats with different conventions for symbol names. This is different from \&\f(CW\*(C`\-\-change\-leading\-char\*(C'\fR because it always changes the symbol name when appropriate, regardless of the object file format of the output file. .Ip "\f(CW\*(C`\-\-srec\-len=\f(CIival\f(CW\*(C'\fR" 4 .IX Item "--srec-len=ival" Meaningful only for srec output. Set the maximum length of the Srecords being produced to \fIival\fR. This length covers both address, data and crc fields. .Ip "\f(CW\*(C`\-\-srec\-forceS3\*(C'\fR" 4 .IX Item "--srec-forceS3" Meaningful only for srec output. Avoid generation of S1/S2 records, creating S3\-only record format. .Ip "\f(CW\*(C`\-\-redefine\-sym \f(CIold\f(CW=\f(CInew\f(CW\*(C'\fR" 4 .IX Item "--redefine-sym old=new" Change the name of a symbol \fIold\fR, to \fInew\fR. This can be useful when one is trying link two things together for which you have no source, and there are name collisions. .Ip "\f(CW\*(C`\-\-weaken\*(C'\fR" 4 .IX Item "--weaken" Change all global symbols in the file to be weak. This can be useful when building an object which will be linked against other objects using the \f(CW\*(C`\-R\*(C'\fR option to the linker. This option is only effective when using an object file format which supports weak symbols. .Ip "\f(CW\*(C`\-\-keep\-symbols=\f(CIfilename\f(CW\*(C'\fR" 4 .IX Item "--keep-symbols=filename" Apply \fB\*(--keep-symbol\fR option to each symbol listed in the file \&\fIfilename\fR. \fIfilename\fR is simply a flat file, with one symbol name per line. Line comments may be introduced by the hash character. This option may be given more than once. .Ip "\f(CW\*(C`\-\-strip\-symbols=\f(CIfilename\f(CW\*(C'\fR" 4 .IX Item "--strip-symbols=filename" Apply \fB\*(--strip-symbol\fR option to each symbol listed in the file \&\fIfilename\fR. \fIfilename\fR is simply a flat file, with one symbol name per line. Line comments may be introduced by the hash character. This option may be given more than once. .Ip "\f(CW\*(C`\-\-keep\-global\-symbols=\f(CIfilename\f(CW\*(C'\fR" 4 .IX Item "--keep-global-symbols=filename" Apply \fB\*(--keep-global-symbol\fR option to each symbol listed in the file \fIfilename\fR. \fIfilename\fR is simply a flat file, with one symbol name per line. Line comments may be introduced by the hash character. This option may be given more than once. .Ip "\f(CW\*(C`\-\-localize\-symbols=\f(CIfilename\f(CW\*(C'\fR" 4 .IX Item "--localize-symbols=filename" Apply \fB\*(--localize-symbol\fR option to each symbol listed in the file \&\fIfilename\fR. \fIfilename\fR is simply a flat file, with one symbol name per line. Line comments may be introduced by the hash character. This option may be given more than once. .Ip "\f(CW\*(C`\-\-weaken\-symbols=\f(CIfilename\f(CW\*(C'\fR" 4 .IX Item "--weaken-symbols=filename" Apply \fB\*(--weaken-symbol\fR option to each symbol listed in the file \&\fIfilename\fR. \fIfilename\fR is simply a flat file, with one symbol name per line. Line comments may be introduced by the hash character. This option may be given more than once. .Ip "\f(CW\*(C`\-V\*(C'\fR" 4 .IX Item "-V" .Ip "\f(CW\*(C`\-\-version\*(C'\fR" 4 .IX Item "--version" Show the version number of \f(CW\*(C`objcopy\*(C'\fR. .Ip "\f(CW\*(C`\-v\*(C'\fR" 4 .IX Item "-v" .Ip "\f(CW\*(C`\-\-verbose\*(C'\fR" 4 .IX Item "--verbose" Verbose output: list all object files modified. In the case of archives, \fBobjcopy \-V\fR lists all members of the archive. .Ip "\f(CW\*(C`\-\-help\*(C'\fR" 4 .IX Item "--help" Show a summary of the options to \f(CW\*(C`objcopy\*(C'\fR. .SH "SEE ALSO" .IX Header "SEE ALSO" \&\fIld\fR\|(1), \fIobjdump\fR\|(1), and the Info entries for \fIbinutils\fR. .SH "COPYRIGHT" .IX Header "COPYRIGHT" Copyright (c) 1991, 92, 93, 94, 95, 96, 97, 98, 99, 2000, 2001 Free Software Foundation, Inc. .PP Permission is granted to copy, distribute and/or modify this document under the terms of the \s-1GNU\s0 Free Documentation License, Version 1.1 or any later version published by the Free Software Foundation; with no Invariant Sections, with no Front-Cover Texts, and with no Back-Cover Texts. A copy of the license is included in the section entitled \*(L"\s-1GNU\s0 Free Documentation License\*(R". binutils/binutils-MAN/opt/binutils/man/man1/objdump.1010064400000000000003000000703750732753202000213060ustar000300000000000000.\" Copyright (c) 1991, 92, 93, 94, 95, 96, 97, 1998, 2000 Free Software Foundation .\" See section COPYING for conditions for redistribution .TH objdump 1 "5 November 1991" "Free Software Foundation" "GNU Development Tools" .de BP .sp .ti \-.2i \(** .. .SH NAME objdump \- display information from object files. .SH SYNOPSIS .hy 0 .na .TP .B objdump .RB "[\|" \-a | \-\-archive\-headers "\|]" .RB "[\|" "\-b\ "\c .I bfdname\c .RB " | " "\-\-target="\c .I bfdname\c \&\|] .RB "[\|" \-C | \-\-demangle "\|]" .RB "[\|" \-\-debugging "\|]" .RB "[\|" \-d | \-\-disassemble "\|]" .RB "[\|" \-D | \-\-disassemble-all "\|]" .RB "[\|" \-\-disassemble\-zeroes "\|]" .RB "[\|" \-EB | \-EL | \-\-endian=\c .I {big|little}\c \&\|] .RB "[\|" \-f | \-\-file\-headers "\|]" .RB "[\|" \-h | \-\-section\-headers .RB "| " \-\-headers "\|]" .RB "[\|" \-i | \-\-info "\|]" .RB "[\|" "\-j\ "\c .I section\c .RB " | " "\-\-section="\c .I section\c \&\|] .RB "[\|" \-l | \-\-line\-numbers "\|]" .RB "[\|" "\-m\ "\c .I machine\c .RB " | " "\-\-architecture="\c .I machine\c \&\|] .RB "[\|" \-p | \-\-private\-headers "\|]" .RB "[\|" \-\-prefix\-addresses "\|]" .RB "[\|" \-r | \-\-reloc "\|]" .RB "[\|" \-R | \-\-dynamic\-reloc "\|]" .RB "[\|" \-s | \-\-full\-contents "\|]" .RB "[\|" \-S | \-\-source "\|]" .RB "[\|" \-\-[no\-]show\-raw\-insn "\|]" .RB "[\|" \-\-stabs "\|]" .RB "[\|" \-t | \-\-syms "\|]" .RB "[\|" \-T | \-\-dynamic\-syms "\|]" .RB "[\|" \-x | \-\-all\-headers "\|]" .RB "[\|" "\-\-start\-address="\c .I address\c \&\|] .RB "[\|" "\-\-stop\-address="\c .I address\c \&\|] .RB "[\|" "\-\-adjust\-vma="\c .I offset\c \&\|] .RB "[\|" \-\-version "\|]" .RB "[\|" \-\-help "\|]" .I objfile\c \&.\|.\|. .ad b .hy 1 .SH DESCRIPTION \c .B objdump\c \& displays information about one or more object files. The options control what particular information to display. This information is mostly useful to programmers who are working on the compilation tools, as opposed to programmers who just want their program to compile and work. .PP .IR "objfile" .\|.\|. are the object files to be examined. When you specify archives, \c .B objdump\c \& shows information on each of the member object files. .SH OPTIONS Where long and short forms of an option are shown together, they are equivalent. At least one option besides .B \-l (\fB\-\-line\-numbers\fP) must be given. .TP .B \-a .TP .B \-\-archive\-headers If any files from \c .I objfile\c \& are archives, display the archive header information (in a format similar to `\|\c .B ls \-l\c \|'). Besides the information you could list with `\|\c .B ar tv\c \|', `\|\c .B objdump \-a\c \|' shows the object file format of each archive member. .TP .BI "\-\-adjust\-vma=" "offset" When dumping information, first add .I offset to all the section addresses. This is useful if the section addresses do not correspond to the symbol table, which can happen when putting sections at particular addresses when using a format which can not represent section addresses, such as a.out. .TP .BI "\-b " "bfdname"\c .TP .BI "\-\-target=" "bfdname" Specify the object-code format for the object files to be \c .I bfdname\c \&. This may not be necessary; \c .I objdump\c \& can automatically recognize many formats. For example, .sp .br objdump\ \-b\ oasys\ \-m\ vax\ \-h\ fu.o .br .sp display summary information from the section headers (`\|\c .B \-h\c \|') of `\|\c .B fu.o\c \|', which is explicitly identified (`\|\c .B \-m\c \|') as a Vax object file in the format produced by Oasys compilers. You can list the formats available with the `\|\c .B \-i\c \|' option. .TP .B \-C .TP .B \-\-demangle Decode (\fIdemangle\fP) low-level symbol names into user-level names. Besides removing any initial underscore prepended by the system, this makes C++ function names readable. .TP .B \-\-debugging Display debugging information. This attempts to parse debugging information stored in the file and print it out using a C like syntax. Only certain types of debugging information have been implemented. .TP .B \-d .TP .B \-\-disassemble Display the assembler mnemonics for the machine instructions from \c .I objfile\c \&. This option only disassembles those sections which are expected to contain instructions. .TP .B \-D .TP .B \-\-disassemble-all Like \fB\-d\fP, but disassemble the contents of all sections, not just those expected to contain instructions. .TP .B \-\-prefix\-addresses When disassembling, print the complete address on each line. This is the older disassembly format. .TP .B \-\-disassemble\-zeroes Normally the disassembly output will skip blocks of zeroes. This option directs the disassembler to disassemble those blocks, just like any other data. .TP .B \-EB .TP .B \-EL .TP .BI "\-\-endian=" "{big|little}" Specify the endianness of the object files. This only affects disassembly. This can be useful when disassembling a file format which does not describe endianness information, such as S-records. .TP .B \-f .TP .B \-\-file\-headers Display summary information from the overall header of each file in \c .I objfile\c \&. .TP .B \-h .TP .B \-\-section\-headers .TP .B \-\-headers Display summary information from the section headers of the object file. .TP .B \-\-help Print a summary of the options to .B objdump and exit. .TP .B \-i .TP .B \-\-info Display a list showing all architectures and object formats available for specification with \c .B \-b\c \& or \c .B \-m\c \&. .TP .BI "\-j " "name"\c .TP .BI "\-\-section=" "name" Display information only for section \c .I name\c \&. .TP .B \-l .TP .B \-\-line\-numbers Label the display (using debugging information) with the filename and source line numbers corresponding to the object code shown. Only useful with \fB\-d\fP, \fB\-D\fP, or \fB\-r\fP. .TP .BI "\-m " "machine"\c .TP .BI "\-\-architecture=" "machine" Specify the architecture to use when disassembling object files. This can be useful when disassembling object files which do not describe architecture information, such as S-records. You can list the available architectures with the \fB\-i\fP option. .TP .B \-p .TP .B \-\-private\-headers Print information that is specific to the object file format. The exact information printed depends upon the object file format. For some object file formats, no additional information is printed. .TP .B \-r .TP .B \-\-reloc Print the relocation entries of the file. If used with \fB\-d\fP or \fB\-D\fP, the relocations are printed interspersed with the disassembly. .TP .B \-R .TP .B \-\-dynamic\-reloc Print the dynamic relocation entries of the file. This is only meaningful for dynamic objects, such as certain types of shared libraries. .TP .B \-s .TP .B \-\-full\-contents Display the full contents of any sections requested. .TP .B \-S .TP .B \-\-source Display source code intermixed with disassembly, if possible. Implies \fB-d\fP. .TP .B \-\-show\-raw\-insn When disassembling instructions, print the instruction in hex as well as in symbolic form. This is the default except when .B \-\-prefix\-addresses is used. .TP .B \-\-no\-show\-raw\-insn When disassembling instructions, do not print the instruction bytes. This is the default when .B \-\-prefix\-addresses is used. .TP .B \-\-stabs Display the contents of the .stab, .stab.index, and .stab.excl sections from an ELF file. This is only useful on systems (such as Solaris 2.0) in which .stab debugging symbol-table entries are carried in an ELF section. In most other file formats, debugging symbol-table entries are interleaved with linkage symbols, and are visible in the .B \-\-syms output. .TP .BI "\-\-start\-address=" "address" Start displaying data at the specified address. This affects the output of the .B \-d\c , .B \-r and .B \-s options. .TP .BI "\-\-stop\-address=" "address" Stop displaying data at the specified address. This affects the output of the .B \-d\c , .B \-r and .B \-s options. .TP .B \-t .TP .B \-\-syms Symbol Table. Print the symbol table entries of the file. This is similar to the information provided by the `\|\c .B nm\c \|' program. .TP .B \-T .TP .B \-\-dynamic\-syms Dynamic Symbol Table. Print the dynamic symbol table entries of the file. This is only meaningful for dynamic objects, such as certain types of shared libraries. This is similar to the information provided by the `\|\c .B nm\c \|' program when given the .B \-D (\-\-dynamic) option. .TP .B \-\-version Print the version number of .B objdump and exit. .TP .B \-x .TP .B \-\-all\-headers Display all available header information, including the symbol table and relocation entries. Using `\|\c .B \-x\c \|' is equivalent to specifying all of `\|\c .B \-a \-f \-h \-r \-t\c \|'. .SH "SEE ALSO" .RB "`\|" binutils "\|'" entry in .B info\c \&; .I The GNU Binary Utilities\c \&, Roland H. Pesch (October 1991); .BR nm "(" 1 ")." .SH COPYING Copyright (c) 1991, 92, 93, 94, 95, 1996 Free Software Foundation, Inc. .PP .PP This document is distributed under the terms of the GNU Free Documentation License, version 1.1. That license is described in the sources for this manual page, but it is not displayed here in order to make this manual more consise. Copies of this license can also be obtained from: http://www.gnu.org/copyleft/. \" .SH GNU Free Documentation License \" Version 1.1, March 2000 \" Copyright (C) 2000 Free Software Foundation, Inc. \" 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA \" Everyone is permitted to copy and distribute verbatim \" copies of this license document, but changing it is \" not allowed. \" .PP \" 0. PREAMBLE \" .PP \" The purpose of this License is to make a manual, textbook, or other \" written document "free" in the sense of freedom: to assure everyone \" the effective freedom to copy and redistribute it, with or without \" modifying it, either commercially or noncommercially. Secondarily, \" this License preserves for the author and publisher a way to get \" credit for their work, while not being considered responsible for \" modifications made by others. \" .PP \" This License is a kind of "copyleft", which means that derivative \" works of the document must themselves be free in the same sense. It \" complements the GNU General Public License, which is a copyleft \" license designed for free software. \" .PP \" We have designed this License in order to use it for manuals for free \" software, because free software needs free documentation: a free \" program should come with manuals providing the same freedoms that the \" software does. But this License is not limited to software manuals; \" it can be used for any textual work, regardless of subject matter or \" whether it is published as a printed book. We recommend this License \" principally for works whose purpose is instruction or reference. \" .PP \" 1. APPLICABILITY AND DEFINITIONS \" .PP \" This License applies to any manual or other work that contains a \" notice placed by the copyright holder saying it can be distributed \" under the terms of this License. The "Document", below, refers to any \" such manual or work. Any member of the public is a licensee, and is \" addressed as "you". \" .PP \" A "Modified Version" of the Document means any work containing the \" Document or a portion of it, either copied verbatim, or with \" modifications and/or translated into another language. \" .PP \" A "Secondary Section" is a named appendix or a front-matter section of \" the Document that deals exclusively with the relationship of the \" publishers or authors of the Document to the Document's overall subject \" (or to related matters) and contains nothing that could fall directly \" within that overall subject. (For example, if the Document is in part a \" textbook of mathematics, a Secondary Section may not explain any \" mathematics.) The relationship could be a matter of historical \" connection with the subject or with related matters, or of legal, \" commercial, philosophical, ethical or political position regarding \" them. \" .PP \" The "Invariant Sections" are certain Secondary Sections whose titles \" are designated, as being those of Invariant Sections, in the notice \" that says that the Document is released under this License. \" .PP \" The "Cover Texts" are certain short passages of text that are listed, \" as Front-Cover Texts or Back-Cover Texts, in the notice that says that \" the Document is released under this License. \" .PP \" A "Transparent" copy of the Document means a machine-readable copy, \" represented in a format whose specification is available to the \" general public, whose contents can be viewed and edited directly and \" straightforwardly with generic text editors or (for images composed of \" pixels) generic paint programs or (for drawings) some widely available \" drawing editor, and that is suitable for input to text formatters or \" for automatic translation to a variety of formats suitable for input \" to text formatters. A copy made in an otherwise Transparent file \" format whose markup has been designed to thwart or discourage \" subsequent modification by readers is not Transparent. A copy that is \" not "Transparent" is called "Opaque". \" .PP \" Examples of suitable formats for Transparent copies include plain \" ASCII without markup, Texinfo input format, LaTeX input format, SGML \" or XML using a publicly available DTD, and standard-conforming simple \" HTML designed for human modification. Opaque formats include \" PostScript, PDF, proprietary formats that can be read and edited only \" by proprietary word processors, SGML or XML for which the DTD and/or \" processing tools are not generally available, and the \" machine-generated HTML produced by some word processors for output \" purposes only. \" .PP \" The "Title Page" means, for a printed book, the title page itself, \" plus such following pages as are needed to hold, legibly, the material \" this License requires to appear in the title page. For works in \" formats which do not have any title page as such, "Title Page" means \" the text near the most prominent appearance of the work's title, \" preceding the beginning of the body of the text. \" .PP \" 2. VERBATIM COPYING \" .PP \" You may copy and distribute the Document in any medium, either \" commercially or noncommercially, provided that this License, the \" copyright notices, and the license notice saying this License applies \" to the Document are reproduced in all copies, and that you add no other \" conditions whatsoever to those of this License. You may not use \" technical measures to obstruct or control the reading or further \" copying of the copies you make or distribute. However, you may accept \" compensation in exchange for copies. If you distribute a large enough \" number of copies you must also follow the conditions in section 3. \" .PP \" You may also lend copies, under the same conditions stated above, and \" you may publicly display copies. \" .PP \" 3. COPYING IN QUANTITY \" .PP \" If you publish printed copies of the Document numbering more than 100, \" and the Document's license notice requires Cover Texts, you must enclose \" the copies in covers that carry, clearly and legibly, all these Cover \" Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on \" the back cover. Both covers must also clearly and legibly identify \" you as the publisher of these copies. The front cover must present \" the full title with all words of the title equally prominent and \" visible. You may add other material on the covers in addition. \" Copying with changes limited to the covers, as long as they preserve \" the title of the Document and satisfy these conditions, can be treated \" as verbatim copying in other respects. \" .PP \" If the required texts for either cover are too voluminous to fit \" legibly, you should put the first ones listed (as many as fit \" reasonably) on the actual cover, and continue the rest onto adjacent \" pages. \" .PP \" If you publish or distribute Opaque copies of the Document numbering \" more than 100, you must either include a machine-readable Transparent \" copy along with each Opaque copy, or state in or with each Opaque copy \" a publicly-accessible computer-network location containing a complete \" Transparent copy of the Document, free of added material, which the \" general network-using public has access to download anonymously at no \" charge using public-standard network protocols. If you use the latter \" option, you must take reasonably prudent steps, when you begin \" distribution of Opaque copies in quantity, to ensure that this \" Transparent copy will remain thus accessible at the stated location \" until at least one year after the last time you distribute an Opaque \" copy (directly or through your agents or retailers) of that edition to \" the public. \" .PP \" It is requested, but not required, that you contact the authors of the \" Document well before redistributing any large number of copies, to give \" them a chance to provide you with an updated version of the Document. \" .PP \" 4. MODIFICATIONS \" .PP \" You may copy and distribute a Modified Version of the Document under \" the conditions of sections 2 and 3 above, provided that you release \" the Modified Version under precisely this License, with the Modified \" Version filling the role of the Document, thus licensing distribution \" and modification of the Modified Version to whoever possesses a copy \" of it. In addition, you must do these things in the Modified Version: \" .PP \" A. Use in the Title Page (and on the covers, if any) a title distinct \" from that of the Document, and from those of previous versions \" (which should, if there were any, be listed in the History section \" of the Document). You may use the same title as a previous version \" if the original publisher of that version gives permission. \" .PP \" B. List on the Title Page, as authors, one or more persons or entities \" responsible for authorship of the modifications in the Modified \" Version, together with at least five of the principal authors of the \" Document (all of its principal authors, if it has less than five). \" .PP \" C. State on the Title page the name of the publisher of the \" Modified Version, as the publisher. \" .PP \" D. Preserve all the copyright notices of the Document. \" .PP \" E. Add an appropriate copyright notice for your modifications \" adjacent to the other copyright notices. \" .PP \" F. Include, immediately after the copyright notices, a license notice \" giving the public permission to use the Modified Version under the \" terms of this License, in the form shown in the Addendum below. \" Preserve in that license notice the full lists of Invariant Sections \" and required Cover Texts given in the Document's license notice. \" .PP \" H. Include an unaltered copy of this License. \" .PP \" I. Preserve the section entitled "History", and its title, and add to \" it an item stating at least the title, year, new authors, and \" publisher of the Modified Version as given on the Title Page. If \" there is no section entitled "History" in the Document, create one \" stating the title, year, authors, and publisher of the Document as \" given on its Title Page, then add an item describing the Modified \" Version as stated in the previous sentence. \" .PP \" J. Preserve the network location, if any, given in the Document for \" public access to a Transparent copy of the Document, and likewise \" the network locations given in the Document for previous versions \" it was based on. These may be placed in the "History" section. \" You may omit a network location for a work that was published at \" least four years before the Document itself, or if the original \" publisher of the version it refers to gives permission. \" .PP \" K. In any section entitled "Acknowledgements" or "Dedications", \" preserve the section's title, and preserve in the section all the \" substance and tone of each of the contributor acknowledgements \" and/or dedications given therein. \" .PP \" L. Preserve all the Invariant Sections of the Document, \" unaltered in their text and in their titles. Section numbers \" or the equivalent are not considered part of the section titles. \" .PP \" M. Delete any section entitled "Endorsements". Such a section \" may not be included in the Modified Version. \" .PP \" N. Do not retitle any existing section as "Endorsements" \" or to conflict in title with any Invariant Section. \" .PP \" If the Modified Version includes new front-matter sections or \" appendices that qualify as Secondary Sections and contain no material \" copied from the Document, you may at your option designate some or all \" of these sections as invariant. To do this, add their titles to the \" list of Invariant Sections in the Modified Version's license notice. \" These titles must be distinct from any other section titles. \" .PP \" You may add a section entitled "Endorsements", provided it contains \" nothing but endorsements of your Modified Version by various \" parties--for example, statements of peer review or that the text has \" been approved by an organization as the authoritative definition of a \" standard. \" .PP \" You may add a passage of up to five words as a Front-Cover Text, and a \" passage of up to 25 words as a Back-Cover Text, to the end of the list \" of Cover Texts in the Modified Version. Only one passage of \" Front-Cover Text and one of Back-Cover Text may be added by (or \" through arrangements made by) any one entity. If the Document already \" includes a cover text for the same cover, previously added by you or \" by arrangement made by the same entity you are acting on behalf of, \" you may not add another; but you may replace the old one, on explicit \" permission from the previous publisher that added the old one. \" .PP \" The author(s) and publisher(s) of the Document do not by this License \" give permission to use their names for publicity for or to assert or \" imply endorsement of any Modified Version. \" .PP \" 5. COMBINING DOCUMENTS \" .PP \" You may combine the Document with other documents released under this \" License, under the terms defined in section 4 above for modified \" versions, provided that you include in the combination all of the \" Invariant Sections of all of the original documents, unmodified, and \" list them all as Invariant Sections of your combined work in its \" license notice. \" .PP \" The combined work need only contain one copy of this License, and \" multiple identical Invariant Sections may be replaced with a single \" copy. If there are multiple Invariant Sections with the same name but \" different contents, make the title of each such section unique by \" adding at the end of it, in parentheses, the name of the original \" author or publisher of that section if known, or else a unique number. \" Make the same adjustment to the section titles in the list of \" Invariant Sections in the license notice of the combined work. \" .PP \" In the combination, you must combine any sections entitled "History" \" in the various original documents, forming one section entitled \" "History"; likewise combine any sections entitled "Acknowledgements", \" and any sections entitled "Dedications". You must delete all sections \" entitled "Endorsements." \" .PP \" 6. COLLECTIONS OF DOCUMENTS \" .PP \" You may make a collection consisting of the Document and other documents \" released under this License, and replace the individual copies of this \" License in the various documents with a single copy that is included in \" the collection, provided that you follow the rules of this License for \" verbatim copying of each of the documents in all other respects. \" .PP \" You may extract a single document from such a collection, and distribute \" it individually under this License, provided you insert a copy of this \" License into the extracted document, and follow this License in all \" other respects regarding verbatim copying of that document. \" .PP \" 7. AGGREGATION WITH INDEPENDENT WORKS \" .PP \" A compilation of the Document or its derivatives with other separate \" and independent documents or works, in or on a volume of a storage or \" distribution medium, does not as a whole count as a Modified Version \" of the Document, provided no compilation copyright is claimed for the \" compilation. Such a compilation is called an "aggregate", and this \" License does not apply to the other self-contained works thus compiled \" with the Document, on account of their being thus compiled, if they \" are not themselves derivative works of the Document. \" .PP \" If the Cover Text requirement of section 3 is applicable to these \" copies of the Document, then if the Document is less than one quarter \" of the entire aggregate, the Document's Cover Texts may be placed on \" covers that surround only the Document within the aggregate. \" Otherwise they must appear on covers around the whole aggregate. \" .PP \" 8. TRANSLATION \" .PP \" Translation is considered a kind of modification, so you may \" distribute translations of the Document under the terms of section 4. \" Replacing Invariant Sections with translations requires special \" permission from their copyright holders, but you may include \" translations of some or all Invariant Sections in addition to the \" original versions of these Invariant Sections. You may include a \" translation of this License provided that you also include the \" original English version of this License. In case of a disagreement \" between the translation and the original English version of this \" License, the original English version will prevail. \" .PP \" 9. TERMINATION \" .PP \" You may not copy, modify, sublicense, or distribute the Document except \" as expressly provided for under this License. Any other attempt to \" copy, modify, sublicense or distribute the Document is void, and will \" automatically terminate your rights under this License. However, \" parties who have received copies, or rights, from you under this \" License will not have their licenses terminated so long as such \" parties remain in full compliance. \" .PP \" 10. FUTURE REVISIONS OF THIS LICENSE \" .PP \" The Free Software Foundation may publish new, revised versions \" of the GNU Free Documentation License from time to time. Such new \" versions will be similar in spirit to the present version, but may \" differ in detail to address new problems or concerns. See \" http://www.gnu.org/copyleft/. \" .PP \" Each version of the License is given a distinguishing version number. \" If the Document specifies that a particular numbered version of this \" License "or any later version" applies to it, you have the option of \" following the terms and conditions either of that specified version or \" of any later version that has been published (not as a draft) by the \" Free Software Foundation. If the Document does not specify a version \" number of this License, you may choose any version ever published (not \" as a draft) by the Free Software Foundation. \" .PP \" ADDENDUM: How to use this License for your documents \" .PP \" To use this License in a document you have written, include a copy of \" the License in the document and put the following copyright and \" license notices just after the title page: \" .PP \" Copyright (c) YEAR YOUR NAME. \" Permission is granted to copy, distribute and/or \" modify this document under the terms of the GNU \" Free Documentation License, Version 1.1 or any later \" version published by the Free Software Foundation; \" with the Invariant Sections being LIST THEIR TITLES, \" with the Front-Cover Texts being LIST, and with the \" Back-Cover Texts being LIST. A copy of the license \" is included in the section entitled "GNU Free \" Documentation License". \" .PP \" If you have no Invariant Sections, write "with no Invariant Sections" \" instead of saying which ones are invariant. If you have no \" Front-Cover Texts, write "no Front-Cover Texts" instead of \" "Front-Cover Texts being LIST"; likewise for Back-Cover Texts. \" .PP \" If your document contains nontrivial examples of program code, we \" recommend releasing these examples in parallel under your choice of \" free software license, such as the GNU General Public License, \" to permit their use in free software. binutils/binutils-MAN/opt/binutils/man/man1/ranlib.1010064400000000000003000000513500732753202000211050ustar000300000000000000.\" Copyright (c) 1991, 2000 Free Software Foundation .\" See section COPYING for conditions for redistribution .TH ranlib 1 "5 November 1991" "Free Software Foundation" "GNU Development Tools" .de BP .sp .ti \-.2i \(** .. .SH NAME ranlib \- generate index to archive. .SH SYNOPSIS .hy 0 .na .B ranlib \c .RB "[\|" \-v | \-V "\|]" .I archive\c \& .ad b .hy 1 .SH DESCRIPTION .B ranlib generates an index to the contents of an archive, and stores it in the archive. The index lists each symbol defined by a member of an archive that is a relocatable object file. .PP You may use .RB ` "nm \-s" ' or .RB ` "nm \-\-print-armap" ' to list this index. .PP An archive with such an index speeds up linking to the library, and allows routines in the library to call each other without regard to their placement in the archive. .PP The GNU .B ranlib program is another form of GNU .BR ar ; running .B ranlib is completely equivalent to executing .RB ` "ar \-s" '. .SH OPTIONS .TP .B \-v Print the version number of .B ranlib and exit. .SH "SEE ALSO" .RB "`\|" binutils "\|'" entry in .B info\c \&; .I The GNU Binary Utilities\c \&, Roland H. Pesch (October 1991); .BR ar "(" 1 ")," .BR nm "(" 1 ")." .SH COPYING Copyright (c) 1991, 2000 Free Software Foundation, Inc. .PP This document is distributed under the terms of the GNU Free Documentation License, version 1.1. That license is described in the sources for this manual page, but it is not displayed here in order to make this manual more consise. Copies of this license can also be obtained from: http://www.gnu.org/copyleft/. \" .SH GNU Free Documentation License \" Version 1.1, March 2000 \" Copyright (C) 2000 Free Software Foundation, Inc. \" 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA \" Everyone is permitted to copy and distribute verbatim \" copies of this license document, but changing it is \" not allowed. \" .PP \" 0. PREAMBLE \" .PP \" The purpose of this License is to make a manual, textbook, or other \" written document "free" in the sense of freedom: to assure everyone \" the effective freedom to copy and redistribute it, with or without \" modifying it, either commercially or noncommercially. Secondarily, \" this License preserves for the author and publisher a way to get \" credit for their work, while not being considered responsible for \" modifications made by others. \" .PP \" This License is a kind of "copyleft", which means that derivative \" works of the document must themselves be free in the same sense. It \" complements the GNU General Public License, which is a copyleft \" license designed for free software. \" .PP \" We have designed this License in order to use it for manuals for free \" software, because free software needs free documentation: a free \" program should come with manuals providing the same freedoms that the \" software does. But this License is not limited to software manuals; \" it can be used for any textual work, regardless of subject matter or \" whether it is published as a printed book. We recommend this License \" principally for works whose purpose is instruction or reference. \" .PP \" 1. APPLICABILITY AND DEFINITIONS \" .PP \" This License applies to any manual or other work that contains a \" notice placed by the copyright holder saying it can be distributed \" under the terms of this License. The "Document", below, refers to any \" such manual or work. Any member of the public is a licensee, and is \" addressed as "you". \" .PP \" A "Modified Version" of the Document means any work containing the \" Document or a portion of it, either copied verbatim, or with \" modifications and/or translated into another language. \" .PP \" A "Secondary Section" is a named appendix or a front-matter section of \" the Document that deals exclusively with the relationship of the \" publishers or authors of the Document to the Document's overall subject \" (or to related matters) and contains nothing that could fall directly \" within that overall subject. (For example, if the Document is in part a \" textbook of mathematics, a Secondary Section may not explain any \" mathematics.) The relationship could be a matter of historical \" connection with the subject or with related matters, or of legal, \" commercial, philosophical, ethical or political position regarding \" them. \" .PP \" The "Invariant Sections" are certain Secondary Sections whose titles \" are designated, as being those of Invariant Sections, in the notice \" that says that the Document is released under this License. \" .PP \" The "Cover Texts" are certain short passages of text that are listed, \" as Front-Cover Texts or Back-Cover Texts, in the notice that says that \" the Document is released under this License. \" .PP \" A "Transparent" copy of the Document means a machine-readable copy, \" represented in a format whose specification is available to the \" general public, whose contents can be viewed and edited directly and \" straightforwardly with generic text editors or (for images composed of \" pixels) generic paint programs or (for drawings) some widely available \" drawing editor, and that is suitable for input to text formatters or \" for automatic translation to a variety of formats suitable for input \" to text formatters. A copy made in an otherwise Transparent file \" format whose markup has been designed to thwart or discourage \" subsequent modification by readers is not Transparent. A copy that is \" not "Transparent" is called "Opaque". \" .PP \" Examples of suitable formats for Transparent copies include plain \" ASCII without markup, Texinfo input format, LaTeX input format, SGML \" or XML using a publicly available DTD, and standard-conforming simple \" HTML designed for human modification. Opaque formats include \" PostScript, PDF, proprietary formats that can be read and edited only \" by proprietary word processors, SGML or XML for which the DTD and/or \" processing tools are not generally available, and the \" machine-generated HTML produced by some word processors for output \" purposes only. \" .PP \" The "Title Page" means, for a printed book, the title page itself, \" plus such following pages as are needed to hold, legibly, the material \" this License requires to appear in the title page. For works in \" formats which do not have any title page as such, "Title Page" means \" the text near the most prominent appearance of the work's title, \" preceding the beginning of the body of the text. \" .PP \" 2. VERBATIM COPYING \" .PP \" You may copy and distribute the Document in any medium, either \" commercially or noncommercially, provided that this License, the \" copyright notices, and the license notice saying this License applies \" to the Document are reproduced in all copies, and that you add no other \" conditions whatsoever to those of this License. You may not use \" technical measures to obstruct or control the reading or further \" copying of the copies you make or distribute. However, you may accept \" compensation in exchange for copies. If you distribute a large enough \" number of copies you must also follow the conditions in section 3. \" .PP \" You may also lend copies, under the same conditions stated above, and \" you may publicly display copies. \" .PP \" 3. COPYING IN QUANTITY \" .PP \" If you publish printed copies of the Document numbering more than 100, \" and the Document's license notice requires Cover Texts, you must enclose \" the copies in covers that carry, clearly and legibly, all these Cover \" Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on \" the back cover. Both covers must also clearly and legibly identify \" you as the publisher of these copies. The front cover must present \" the full title with all words of the title equally prominent and \" visible. You may add other material on the covers in addition. \" Copying with changes limited to the covers, as long as they preserve \" the title of the Document and satisfy these conditions, can be treated \" as verbatim copying in other respects. \" .PP \" If the required texts for either cover are too voluminous to fit \" legibly, you should put the first ones listed (as many as fit \" reasonably) on the actual cover, and continue the rest onto adjacent \" pages. \" .PP \" If you publish or distribute Opaque copies of the Document numbering \" more than 100, you must either include a machine-readable Transparent \" copy along with each Opaque copy, or state in or with each Opaque copy \" a publicly-accessible computer-network location containing a complete \" Transparent copy of the Document, free of added material, which the \" general network-using public has access to download anonymously at no \" charge using public-standard network protocols. If you use the latter \" option, you must take reasonably prudent steps, when you begin \" distribution of Opaque copies in quantity, to ensure that this \" Transparent copy will remain thus accessible at the stated location \" until at least one year after the last time you distribute an Opaque \" copy (directly or through your agents or retailers) of that edition to \" the public. \" .PP \" It is requested, but not required, that you contact the authors of the \" Document well before redistributing any large number of copies, to give \" them a chance to provide you with an updated version of the Document. \" .PP \" 4. MODIFICATIONS \" .PP \" You may copy and distribute a Modified Version of the Document under \" the conditions of sections 2 and 3 above, provided that you release \" the Modified Version under precisely this License, with the Modified \" Version filling the role of the Document, thus licensing distribution \" and modification of the Modified Version to whoever possesses a copy \" of it. In addition, you must do these things in the Modified Version: \" .PP \" A. Use in the Title Page (and on the covers, if any) a title distinct \" from that of the Document, and from those of previous versions \" (which should, if there were any, be listed in the History section \" of the Document). You may use the same title as a previous version \" if the original publisher of that version gives permission. \" .PP \" B. List on the Title Page, as authors, one or more persons or entities \" responsible for authorship of the modifications in the Modified \" Version, together with at least five of the principal authors of the \" Document (all of its principal authors, if it has less than five). \" .PP \" C. State on the Title page the name of the publisher of the \" Modified Version, as the publisher. \" .PP \" D. Preserve all the copyright notices of the Document. \" .PP \" E. Add an appropriate copyright notice for your modifications \" adjacent to the other copyright notices. \" .PP \" F. Include, immediately after the copyright notices, a license notice \" giving the public permission to use the Modified Version under the \" terms of this License, in the form shown in the Addendum below. \" Preserve in that license notice the full lists of Invariant Sections \" and required Cover Texts given in the Document's license notice. \" .PP \" H. Include an unaltered copy of this License. \" .PP \" I. Preserve the section entitled "History", and its title, and add to \" it an item stating at least the title, year, new authors, and \" publisher of the Modified Version as given on the Title Page. If \" there is no section entitled "History" in the Document, create one \" stating the title, year, authors, and publisher of the Document as \" given on its Title Page, then add an item describing the Modified \" Version as stated in the previous sentence. \" .PP \" J. Preserve the network location, if any, given in the Document for \" public access to a Transparent copy of the Document, and likewise \" the network locations given in the Document for previous versions \" it was based on. These may be placed in the "History" section. \" You may omit a network location for a work that was published at \" least four years before the Document itself, or if the original \" publisher of the version it refers to gives permission. \" .PP \" K. In any section entitled "Acknowledgements" or "Dedications", \" preserve the section's title, and preserve in the section all the \" substance and tone of each of the contributor acknowledgements \" and/or dedications given therein. \" .PP \" L. Preserve all the Invariant Sections of the Document, \" unaltered in their text and in their titles. Section numbers \" or the equivalent are not considered part of the section titles. \" .PP \" M. Delete any section entitled "Endorsements". Such a section \" may not be included in the Modified Version. \" .PP \" N. Do not retitle any existing section as "Endorsements" \" or to conflict in title with any Invariant Section. \" .PP \" If the Modified Version includes new front-matter sections or \" appendices that qualify as Secondary Sections and contain no material \" copied from the Document, you may at your option designate some or all \" of these sections as invariant. To do this, add their titles to the \" list of Invariant Sections in the Modified Version's license notice. \" These titles must be distinct from any other section titles. \" .PP \" You may add a section entitled "Endorsements", provided it contains \" nothing but endorsements of your Modified Version by various \" parties--for example, statements of peer review or that the text has \" been approved by an organization as the authoritative definition of a \" standard. \" .PP \" You may add a passage of up to five words as a Front-Cover Text, and a \" passage of up to 25 words as a Back-Cover Text, to the end of the list \" of Cover Texts in the Modified Version. Only one passage of \" Front-Cover Text and one of Back-Cover Text may be added by (or \" through arrangements made by) any one entity. If the Document already \" includes a cover text for the same cover, previously added by you or \" by arrangement made by the same entity you are acting on behalf of, \" you may not add another; but you may replace the old one, on explicit \" permission from the previous publisher that added the old one. \" .PP \" The author(s) and publisher(s) of the Document do not by this License \" give permission to use their names for publicity for or to assert or \" imply endorsement of any Modified Version. \" .PP \" 5. COMBINING DOCUMENTS \" .PP \" You may combine the Document with other documents released under this \" License, under the terms defined in section 4 above for modified \" versions, provided that you include in the combination all of the \" Invariant Sections of all of the original documents, unmodified, and \" list them all as Invariant Sections of your combined work in its \" license notice. \" .PP \" The combined work need only contain one copy of this License, and \" multiple identical Invariant Sections may be replaced with a single \" copy. If there are multiple Invariant Sections with the same name but \" different contents, make the title of each such section unique by \" adding at the end of it, in parentheses, the name of the original \" author or publisher of that section if known, or else a unique number. \" Make the same adjustment to the section titles in the list of \" Invariant Sections in the license notice of the combined work. \" .PP \" In the combination, you must combine any sections entitled "History" \" in the various original documents, forming one section entitled \" "History"; likewise combine any sections entitled "Acknowledgements", \" and any sections entitled "Dedications". You must delete all sections \" entitled "Endorsements." \" .PP \" 6. COLLECTIONS OF DOCUMENTS \" .PP \" You may make a collection consisting of the Document and other documents \" released under this License, and replace the individual copies of this \" License in the various documents with a single copy that is included in \" the collection, provided that you follow the rules of this License for \" verbatim copying of each of the documents in all other respects. \" .PP \" You may extract a single document from such a collection, and distribute \" it individually under this License, provided you insert a copy of this \" License into the extracted document, and follow this License in all \" other respects regarding verbatim copying of that document. \" .PP \" 7. AGGREGATION WITH INDEPENDENT WORKS \" .PP \" A compilation of the Document or its derivatives with other separate \" and independent documents or works, in or on a volume of a storage or \" distribution medium, does not as a whole count as a Modified Version \" of the Document, provided no compilation copyright is claimed for the \" compilation. Such a compilation is called an "aggregate", and this \" License does not apply to the other self-contained works thus compiled \" with the Document, on account of their being thus compiled, if they \" are not themselves derivative works of the Document. \" .PP \" If the Cover Text requirement of section 3 is applicable to these \" copies of the Document, then if the Document is less than one quarter \" of the entire aggregate, the Document's Cover Texts may be placed on \" covers that surround only the Document within the aggregate. \" Otherwise they must appear on covers around the whole aggregate. \" .PP \" 8. TRANSLATION \" .PP \" Translation is considered a kind of modification, so you may \" distribute translations of the Document under the terms of section 4. \" Replacing Invariant Sections with translations requires special \" permission from their copyright holders, but you may include \" translations of some or all Invariant Sections in addition to the \" original versions of these Invariant Sections. You may include a \" translation of this License provided that you also include the \" original English version of this License. In case of a disagreement \" between the translation and the original English version of this \" License, the original English version will prevail. \" .PP \" 9. TERMINATION \" .PP \" You may not copy, modify, sublicense, or distribute the Document except \" as expressly provided for under this License. Any other attempt to \" copy, modify, sublicense or distribute the Document is void, and will \" automatically terminate your rights under this License. However, \" parties who have received copies, or rights, from you under this \" License will not have their licenses terminated so long as such \" parties remain in full compliance. \" .PP \" 10. FUTURE REVISIONS OF THIS LICENSE \" .PP \" The Free Software Foundation may publish new, revised versions \" of the GNU Free Documentation License from time to time. Such new \" versions will be similar in spirit to the present version, but may \" differ in detail to address new problems or concerns. See \" http://www.gnu.org/copyleft/. \" .PP \" Each version of the License is given a distinguishing version number. \" If the Document specifies that a particular numbered version of this \" License "or any later version" applies to it, you have the option of \" following the terms and conditions either of that specified version or \" of any later version that has been published (not as a draft) by the \" Free Software Foundation. If the Document does not specify a version \" number of this License, you may choose any version ever published (not \" as a draft) by the Free Software Foundation. \" .PP \" ADDENDUM: How to use this License for your documents \" .PP \" To use this License in a document you have written, include a copy of \" the License in the document and put the following copyright and \" license notices just after the title page: \" .PP \" Copyright (c) YEAR YOUR NAME. \" Permission is granted to copy, distribute and/or \" modify this document under the terms of the GNU \" Free Documentation License, Version 1.1 or any later \" version published by the Free Software Foundation; \" with the Invariant Sections being LIST THEIR TITLES, \" with the Front-Cover Texts being LIST, and with the \" Back-Cover Texts being LIST. A copy of the license \" is included in the section entitled "GNU Free \" Documentation License". \" .PP \" If you have no Invariant Sections, write "with no Invariant Sections" \" instead of saying which ones are invariant. If you have no \" Front-Cover Texts, write "no Front-Cover Texts" instead of \" "Front-Cover Texts being LIST"; likewise for Back-Cover Texts. \" .PP \" If your document contains nontrivial examples of program code, we \" recommend releasing these examples in parallel under your choice of \" free software license, such as the GNU General Public License, \" to permit their use in free software. binutils/binutils-MAN/opt/binutils/man/man1/size.1010064400000000000003000000540310732753202000206070ustar000300000000000000.\" Copyright (c) 1991, 2000 Free Software Foundation .\" See section COPYING for conditions for redistribution .TH size 1 "5 November 1991" "Free Software Foundation" "GNU Development Tools" .de BP .sp .ti \-.2i \(** .. .SH NAME size \- list section sizes and total size. .SH SYNOPSIS .hy 0 .na .TP .B size .RB "[\|" \-A \||\| \-B \||\| \c .BI "\-\-format=" compatibility\c \&\|] .RB "[\|" \-\-help "\|]" .RB "[\|" \-d \||\| \-o \||\| \-x\c \||\|\c .BI "\-\-radix=" number\c \&\|] .RB "[\|" \c .BI "\-\-target=" bfdname\c \&\|] .RB "[\|" \-V \||\| \-\-version "\|]" .I objfile\c \&.\|.\|. .ad b .hy 1 .SH DESCRIPTION The GNU \c .B size\c \& utility lists the section sizes\(em\&and the total size\(em\&for each of the object files .I objfile in its argument list. By default, one line of output is generated for each object file or each module in an archive. .SH OPTIONS .TP .B \-A .TP .B \-B .TP .BI "\-\-format " "compatibility" Using one of these options, you can choose whether the output from GNU \c .B size\c \& resembles output from System V \c .B size\c \& (using `\|\c .B \-A\c \|', or `\|\c .B \-\-format=sysv\c \|'), or Berkeley \c .B size\c \& (using `\|\c .B \-B\c \|', or `\|\c .B \-\-format=berkeley\c \|'). The default is the one-line format similar to Berkeley's. .TP .B \-\-help Show a summary of acceptable arguments and options. .TP .B \-d .TP .B \-o .TP .B \-x .TP .BI "\-\-radix " "number" Using one of these options, you can control whether the size of each section is given in decimal (`\|\c .B \-d\c \|', or `\|\c .B \-\-radix 10\c \|'); octal (`\|\c .B \-o\c \|', or `\|\c .B \-\-radix 8\c \|'); or hexadecimal (`\|\c .B \-x\c \|', or `\|\c .B \-\-radix 16\c \|'). In `\|\c .B \-\-radix \c .I number\c \&\c \|', only the three values (8, 10, 16) are supported. The total size is always given in two radices; decimal and hexadecimal for `\|\c .B \-d\c \|' or `\|\c .B \-x\c \|' output, or octal and hexadecimal if you're using `\|\c .B \-o\c \|'. .TP .BI "\-\-target " "bfdname" You can specify a particular object-code format for \c .I objfile\c \& as \c .I bfdname\c \&. This may not be necessary; \c .I size\c \& can automatically recognize many formats. See .BR objdump ( 1 ) for information on listing available formats. .TP .B \-V .TP .B \-\-version Display version number information on \c .B size\c \& itself. .SH "SEE ALSO" .RB "`\|" binutils "\|'" entry in .BR info ; .IR "The GNU Binary Utilities" , Roland H. Pesch (October 1991); .BR ar "(" 1 ")," .BR objdump ( 1 ). .SH COPYING Copyright (c) 1991, 2000 Free Software Foundation, Inc. .PP This document is distributed under the terms of the GNU Free Documentation License, version 1.1. That license is described in the sources for this manual page, but it is not displayed here in order to make this manual more consise. Copies of this license can also be obtained from: http://www.gnu.org/copyleft/. \" .SH GNU Free Documentation License \" Version 1.1, March 2000 \" Copyright (C) 2000 Free Software Foundation, Inc. \" 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA \" Everyone is permitted to copy and distribute verbatim \" copies of this license document, but changing it is \" not allowed. \" .PP \" 0. PREAMBLE \" .PP \" The purpose of this License is to make a manual, textbook, or other \" written document "free" in the sense of freedom: to assure everyone \" the effective freedom to copy and redistribute it, with or without \" modifying it, either commercially or noncommercially. Secondarily, \" this License preserves for the author and publisher a way to get \" credit for their work, while not being considered responsible for \" modifications made by others. \" .PP \" This License is a kind of "copyleft", which means that derivative \" works of the document must themselves be free in the same sense. It \" complements the GNU General Public License, which is a copyleft \" license designed for free software. \" .PP \" We have designed this License in order to use it for manuals for free \" software, because free software needs free documentation: a free \" program should come with manuals providing the same freedoms that the \" software does. But this License is not limited to software manuals; \" it can be used for any textual work, regardless of subject matter or \" whether it is published as a printed book. We recommend this License \" principally for works whose purpose is instruction or reference. \" .PP \" 1. APPLICABILITY AND DEFINITIONS \" .PP \" This License applies to any manual or other work that contains a \" notice placed by the copyright holder saying it can be distributed \" under the terms of this License. The "Document", below, refers to any \" such manual or work. Any member of the public is a licensee, and is \" addressed as "you". \" .PP \" A "Modified Version" of the Document means any work containing the \" Document or a portion of it, either copied verbatim, or with \" modifications and/or translated into another language. \" .PP \" A "Secondary Section" is a named appendix or a front-matter section of \" the Document that deals exclusively with the relationship of the \" publishers or authors of the Document to the Document's overall subject \" (or to related matters) and contains nothing that could fall directly \" within that overall subject. (For example, if the Document is in part a \" textbook of mathematics, a Secondary Section may not explain any \" mathematics.) The relationship could be a matter of historical \" connection with the subject or with related matters, or of legal, \" commercial, philosophical, ethical or political position regarding \" them. \" .PP \" The "Invariant Sections" are certain Secondary Sections whose titles \" are designated, as being those of Invariant Sections, in the notice \" that says that the Document is released under this License. \" .PP \" The "Cover Texts" are certain short passages of text that are listed, \" as Front-Cover Texts or Back-Cover Texts, in the notice that says that \" the Document is released under this License. \" .PP \" A "Transparent" copy of the Document means a machine-readable copy, \" represented in a format whose specification is available to the \" general public, whose contents can be viewed and edited directly and \" straightforwardly with generic text editors or (for images composed of \" pixels) generic paint programs or (for drawings) some widely available \" drawing editor, and that is suitable for input to text formatters or \" for automatic translation to a variety of formats suitable for input \" to text formatters. A copy made in an otherwise Transparent file \" format whose markup has been designed to thwart or discourage \" subsequent modification by readers is not Transparent. A copy that is \" not "Transparent" is called "Opaque". \" .PP \" Examples of suitable formats for Transparent copies include plain \" ASCII without markup, Texinfo input format, LaTeX input format, SGML \" or XML using a publicly available DTD, and standard-conforming simple \" HTML designed for human modification. Opaque formats include \" PostScript, PDF, proprietary formats that can be read and edited only \" by proprietary word processors, SGML or XML for which the DTD and/or \" processing tools are not generally available, and the \" machine-generated HTML produced by some word processors for output \" purposes only. \" .PP \" The "Title Page" means, for a printed book, the title page itself, \" plus such following pages as are needed to hold, legibly, the material \" this License requires to appear in the title page. For works in \" formats which do not have any title page as such, "Title Page" means \" the text near the most prominent appearance of the work's title, \" preceding the beginning of the body of the text. \" .PP \" 2. VERBATIM COPYING \" .PP \" You may copy and distribute the Document in any medium, either \" commercially or noncommercially, provided that this License, the \" copyright notices, and the license notice saying this License applies \" to the Document are reproduced in all copies, and that you add no other \" conditions whatsoever to those of this License. You may not use \" technical measures to obstruct or control the reading or further \" copying of the copies you make or distribute. However, you may accept \" compensation in exchange for copies. If you distribute a large enough \" number of copies you must also follow the conditions in section 3. \" .PP \" You may also lend copies, under the same conditions stated above, and \" you may publicly display copies. \" .PP \" 3. COPYING IN QUANTITY \" .PP \" If you publish printed copies of the Document numbering more than 100, \" and the Document's license notice requires Cover Texts, you must enclose \" the copies in covers that carry, clearly and legibly, all these Cover \" Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on \" the back cover. Both covers must also clearly and legibly identify \" you as the publisher of these copies. The front cover must present \" the full title with all words of the title equally prominent and \" visible. You may add other material on the covers in addition. \" Copying with changes limited to the covers, as long as they preserve \" the title of the Document and satisfy these conditions, can be treated \" as verbatim copying in other respects. \" .PP \" If the required texts for either cover are too voluminous to fit \" legibly, you should put the first ones listed (as many as fit \" reasonably) on the actual cover, and continue the rest onto adjacent \" pages. \" .PP \" If you publish or distribute Opaque copies of the Document numbering \" more than 100, you must either include a machine-readable Transparent \" copy along with each Opaque copy, or state in or with each Opaque copy \" a publicly-accessible computer-network location containing a complete \" Transparent copy of the Document, free of added material, which the \" general network-using public has access to download anonymously at no \" charge using public-standard network protocols. If you use the latter \" option, you must take reasonably prudent steps, when you begin \" distribution of Opaque copies in quantity, to ensure that this \" Transparent copy will remain thus accessible at the stated location \" until at least one year after the last time you distribute an Opaque \" copy (directly or through your agents or retailers) of that edition to \" the public. \" .PP \" It is requested, but not required, that you contact the authors of the \" Document well before redistributing any large number of copies, to give \" them a chance to provide you with an updated version of the Document. \" .PP \" 4. MODIFICATIONS \" .PP \" You may copy and distribute a Modified Version of the Document under \" the conditions of sections 2 and 3 above, provided that you release \" the Modified Version under precisely this License, with the Modified \" Version filling the role of the Document, thus licensing distribution \" and modification of the Modified Version to whoever possesses a copy \" of it. In addition, you must do these things in the Modified Version: \" .PP \" A. Use in the Title Page (and on the covers, if any) a title distinct \" from that of the Document, and from those of previous versions \" (which should, if there were any, be listed in the History section \" of the Document). You may use the same title as a previous version \" if the original publisher of that version gives permission. \" .PP \" B. List on the Title Page, as authors, one or more persons or entities \" responsible for authorship of the modifications in the Modified \" Version, together with at least five of the principal authors of the \" Document (all of its principal authors, if it has less than five). \" .PP \" C. State on the Title page the name of the publisher of the \" Modified Version, as the publisher. \" .PP \" D. Preserve all the copyright notices of the Document. \" .PP \" E. Add an appropriate copyright notice for your modifications \" adjacent to the other copyright notices. \" .PP \" F. Include, immediately after the copyright notices, a license notice \" giving the public permission to use the Modified Version under the \" terms of this License, in the form shown in the Addendum below. \" Preserve in that license notice the full lists of Invariant Sections \" and required Cover Texts given in the Document's license notice. \" .PP \" H. Include an unaltered copy of this License. \" .PP \" I. Preserve the section entitled "History", and its title, and add to \" it an item stating at least the title, year, new authors, and \" publisher of the Modified Version as given on the Title Page. If \" there is no section entitled "History" in the Document, create one \" stating the title, year, authors, and publisher of the Document as \" given on its Title Page, then add an item describing the Modified \" Version as stated in the previous sentence. \" .PP \" J. Preserve the network location, if any, given in the Document for \" public access to a Transparent copy of the Document, and likewise \" the network locations given in the Document for previous versions \" it was based on. These may be placed in the "History" section. \" You may omit a network location for a work that was published at \" least four years before the Document itself, or if the original \" publisher of the version it refers to gives permission. \" .PP \" K. In any section entitled "Acknowledgements" or "Dedications", \" preserve the section's title, and preserve in the section all the \" substance and tone of each of the contributor acknowledgements \" and/or dedications given therein. \" .PP \" L. Preserve all the Invariant Sections of the Document, \" unaltered in their text and in their titles. Section numbers \" or the equivalent are not considered part of the section titles. \" .PP \" M. Delete any section entitled "Endorsements". Such a section \" may not be included in the Modified Version. \" .PP \" N. Do not retitle any existing section as "Endorsements" \" or to conflict in title with any Invariant Section. \" .PP \" If the Modified Version includes new front-matter sections or \" appendices that qualify as Secondary Sections and contain no material \" copied from the Document, you may at your option designate some or all \" of these sections as invariant. To do this, add their titles to the \" list of Invariant Sections in the Modified Version's license notice. \" These titles must be distinct from any other section titles. \" .PP \" You may add a section entitled "Endorsements", provided it contains \" nothing but endorsements of your Modified Version by various \" parties--for example, statements of peer review or that the text has \" been approved by an organization as the authoritative definition of a \" standard. \" .PP \" You may add a passage of up to five words as a Front-Cover Text, and a \" passage of up to 25 words as a Back-Cover Text, to the end of the list \" of Cover Texts in the Modified Version. Only one passage of \" Front-Cover Text and one of Back-Cover Text may be added by (or \" through arrangements made by) any one entity. If the Document already \" includes a cover text for the same cover, previously added by you or \" by arrangement made by the same entity you are acting on behalf of, \" you may not add another; but you may replace the old one, on explicit \" permission from the previous publisher that added the old one. \" .PP \" The author(s) and publisher(s) of the Document do not by this License \" give permission to use their names for publicity for or to assert or \" imply endorsement of any Modified Version. \" .PP \" 5. COMBINING DOCUMENTS \" .PP \" You may combine the Document with other documents released under this \" License, under the terms defined in section 4 above for modified \" versions, provided that you include in the combination all of the \" Invariant Sections of all of the original documents, unmodified, and \" list them all as Invariant Sections of your combined work in its \" license notice. \" .PP \" The combined work need only contain one copy of this License, and \" multiple identical Invariant Sections may be replaced with a single \" copy. If there are multiple Invariant Sections with the same name but \" different contents, make the title of each such section unique by \" adding at the end of it, in parentheses, the name of the original \" author or publisher of that section if known, or else a unique number. \" Make the same adjustment to the section titles in the list of \" Invariant Sections in the license notice of the combined work. \" .PP \" In the combination, you must combine any sections entitled "History" \" in the various original documents, forming one section entitled \" "History"; likewise combine any sections entitled "Acknowledgements", \" and any sections entitled "Dedications". You must delete all sections \" entitled "Endorsements." \" .PP \" 6. COLLECTIONS OF DOCUMENTS \" .PP \" You may make a collection consisting of the Document and other documents \" released under this License, and replace the individual copies of this \" License in the various documents with a single copy that is included in \" the collection, provided that you follow the rules of this License for \" verbatim copying of each of the documents in all other respects. \" .PP \" You may extract a single document from such a collection, and distribute \" it individually under this License, provided you insert a copy of this \" License into the extracted document, and follow this License in all \" other respects regarding verbatim copying of that document. \" .PP \" 7. AGGREGATION WITH INDEPENDENT WORKS \" .PP \" A compilation of the Document or its derivatives with other separate \" and independent documents or works, in or on a volume of a storage or \" distribution medium, does not as a whole count as a Modified Version \" of the Document, provided no compilation copyright is claimed for the \" compilation. Such a compilation is called an "aggregate", and this \" License does not apply to the other self-contained works thus compiled \" with the Document, on account of their being thus compiled, if they \" are not themselves derivative works of the Document. \" .PP \" If the Cover Text requirement of section 3 is applicable to these \" copies of the Document, then if the Document is less than one quarter \" of the entire aggregate, the Document's Cover Texts may be placed on \" covers that surround only the Document within the aggregate. \" Otherwise they must appear on covers around the whole aggregate. \" .PP \" 8. TRANSLATION \" .PP \" Translation is considered a kind of modification, so you may \" distribute translations of the Document under the terms of section 4. \" Replacing Invariant Sections with translations requires special \" permission from their copyright holders, but you may include \" translations of some or all Invariant Sections in addition to the \" original versions of these Invariant Sections. You may include a \" translation of this License provided that you also include the \" original English version of this License. In case of a disagreement \" between the translation and the original English version of this \" License, the original English version will prevail. \" .PP \" 9. TERMINATION \" .PP \" You may not copy, modify, sublicense, or distribute the Document except \" as expressly provided for under this License. Any other attempt to \" copy, modify, sublicense or distribute the Document is void, and will \" automatically terminate your rights under this License. However, \" parties who have received copies, or rights, from you under this \" License will not have their licenses terminated so long as such \" parties remain in full compliance. \" .PP \" 10. FUTURE REVISIONS OF THIS LICENSE \" .PP \" The Free Software Foundation may publish new, revised versions \" of the GNU Free Documentation License from time to time. Such new \" versions will be similar in spirit to the present version, but may \" differ in detail to address new problems or concerns. See \" http://www.gnu.org/copyleft/. \" .PP \" Each version of the License is given a distinguishing version number. \" If the Document specifies that a particular numbered version of this \" License "or any later version" applies to it, you have the option of \" following the terms and conditions either of that specified version or \" of any later version that has been published (not as a draft) by the \" Free Software Foundation. If the Document does not specify a version \" number of this License, you may choose any version ever published (not \" as a draft) by the Free Software Foundation. \" .PP \" ADDENDUM: How to use this License for your documents \" .PP \" To use this License in a document you have written, include a copy of \" the License in the document and put the following copyright and \" license notices just after the title page: \" .PP \" Copyright (c) YEAR YOUR NAME. \" Permission is granted to copy, distribute and/or \" modify this document under the terms of the GNU \" Free Documentation License, Version 1.1 or any later \" version published by the Free Software Foundation; \" with the Invariant Sections being LIST THEIR TITLES, \" with the Front-Cover Texts being LIST, and with the \" Back-Cover Texts being LIST. A copy of the license \" is included in the section entitled "GNU Free \" Documentation License". \" .PP \" If you have no Invariant Sections, write "with no Invariant Sections" \" instead of saying which ones are invariant. If you have no \" Front-Cover Texts, write "no Front-Cover Texts" instead of \" "Front-Cover Texts being LIST"; likewise for Back-Cover Texts. \" .PP \" If your document contains nontrivial examples of program code, we \" recommend releasing these examples in parallel under your choice of \" free software license, such as the GNU General Public License, \" to permit their use in free software. binutils/binutils-MAN/opt/binutils/man/man1/strings.1010064400000000000003000000540120732753202000213250ustar000300000000000000.\" Copyright (c) 1993, 94, 95, 2000 Free Software Foundation .\" See section COPYING for conditions for redistribution .TH strings 1 "09 March 2000" "Free Software Foundation" "GNU Development Tools" .de BP .sp .ti \-.2i \(** .. .SH NAME strings \- print the strings of printable characters in files .SH SYNOPSIS .hy 0 .na .TP .B strings .RB "[\|" \-a | \-\c .RB | \-\-all "\|]" .RB "[\|" \-f | \-\-print\-file\-name "\|]" .RB "[\|" \-o "\|]" .RB "[\|" \-\-help "\|]" .RB "[\|" \-v | \-\-version "\|]" .RB "[\|" \-n .I min\-len\c .RI | \-min\-len\c .RB | "\-\-bytes="\c .I min\-len\c \&\|] .RB "[\|" \-t .I {o,x,d}\c .RB "[\|" "\-\-target=\fIbfdname" "\|]" .RB | "\-\-radix="\c .I {o,x,d}\c \&\|] .I file\c .ad b .hy 1 .SH DESCRIPTION For each .I file given, GNU \c .B strings prints the printable character sequences that are at least 4 characters long (or the number given with the options below) and are followed by an unprintable character. By default, it only prints the strings from the initialized and loaded sections of object files; for other types of files, it prints the strings from the whole file. .PP .B strings is mainly useful for determining the contents of non-text files. .SH OPTIONS The long and short forms of options, shown here as alternatives, are equivalent. .TP .B \-a .TP .B \-\-all .TP .B \- Do not scan only the initialized and loaded sections of object files; scan the whole files. .TP .B \-f .TP .B \-\-print\-file\-name Print the name of the file before each string. .TP .B \-\-help Print a summary of the options to .B strings on the standard output and exit. .TP .B \-v .TP .B \-\-version Print the version number of .B strings on the standard output and exit. .TP .B "\-n \fImin\-len\fP" .TP .B "\-\fImin\-len\fP" .TP .B "\-\-bytes=\fImin\-len\fP" Print sequences of characters that are at least .I min\-len characters long, instead of the default 4. .TP .BR "\-t " {o,x,d} .TP .BR "\-\-radix=" {o,x,d} Print the offset within the file before each string. The single character argument specifies the radix of the offset\(emoctal, hexadecimal, or decimal. .TP .BI "\-\-target=" "bfdname" Specify an object code format other than your system's default format. See .BR objdump ( 1 ), for information on listing available formats. .TP .B \-o Like .BR "\-t o" . .PP .SH "SEE ALSO" .RB "`\|" binutils "\|'" entry in .B info\c \&; .I The GNU Binary Utilities\c \&, Roland H. Pesch (October 1991); .BR ar ( 1 ), .BR nm ( 1 ), .BR objdump ( 1 ), .BR ranlib ( 1 ). .SH COPYING Copyright (c) 1993, 2000 Free Software Foundation, Inc. .PP This document is distributed under the terms of the GNU Free Documentation License, version 1.1. That license is described in the sources for this manual page, but it is not displayed here in order to make this manual more consise. Copies of this license can also be obtained from: http://www.gnu.org/copyleft/. \" .SH GNU Free Documentation License \" Version 1.1, March 2000 \" Copyright (C) 2000 Free Software Foundation, Inc. \" 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA \" Everyone is permitted to copy and distribute verbatim \" copies of this license document, but changing it is \" not allowed. \" .PP \" 0. PREAMBLE \" .PP \" The purpose of this License is to make a manual, textbook, or other \" written document "free" in the sense of freedom: to assure everyone \" the effective freedom to copy and redistribute it, with or without \" modifying it, either commercially or noncommercially. Secondarily, \" this License preserves for the author and publisher a way to get \" credit for their work, while not being considered responsible for \" modifications made by others. \" .PP \" This License is a kind of "copyleft", which means that derivative \" works of the document must themselves be free in the same sense. It \" complements the GNU General Public License, which is a copyleft \" license designed for free software. \" .PP \" We have designed this License in order to use it for manuals for free \" software, because free software needs free documentation: a free \" program should come with manuals providing the same freedoms that the \" software does. But this License is not limited to software manuals; \" it can be used for any textual work, regardless of subject matter or \" whether it is published as a printed book. We recommend this License \" principally for works whose purpose is instruction or reference. \" .PP \" 1. APPLICABILITY AND DEFINITIONS \" .PP \" This License applies to any manual or other work that contains a \" notice placed by the copyright holder saying it can be distributed \" under the terms of this License. The "Document", below, refers to any \" such manual or work. Any member of the public is a licensee, and is \" addressed as "you". \" .PP \" A "Modified Version" of the Document means any work containing the \" Document or a portion of it, either copied verbatim, or with \" modifications and/or translated into another language. \" .PP \" A "Secondary Section" is a named appendix or a front-matter section of \" the Document that deals exclusively with the relationship of the \" publishers or authors of the Document to the Document's overall subject \" (or to related matters) and contains nothing that could fall directly \" within that overall subject. (For example, if the Document is in part a \" textbook of mathematics, a Secondary Section may not explain any \" mathematics.) The relationship could be a matter of historical \" connection with the subject or with related matters, or of legal, \" commercial, philosophical, ethical or political position regarding \" them. \" .PP \" The "Invariant Sections" are certain Secondary Sections whose titles \" are designated, as being those of Invariant Sections, in the notice \" that says that the Document is released under this License. \" .PP \" The "Cover Texts" are certain short passages of text that are listed, \" as Front-Cover Texts or Back-Cover Texts, in the notice that says that \" the Document is released under this License. \" .PP \" A "Transparent" copy of the Document means a machine-readable copy, \" represented in a format whose specification is available to the \" general public, whose contents can be viewed and edited directly and \" straightforwardly with generic text editors or (for images composed of \" pixels) generic paint programs or (for drawings) some widely available \" drawing editor, and that is suitable for input to text formatters or \" for automatic translation to a variety of formats suitable for input \" to text formatters. A copy made in an otherwise Transparent file \" format whose markup has been designed to thwart or discourage \" subsequent modification by readers is not Transparent. A copy that is \" not "Transparent" is called "Opaque". \" .PP \" Examples of suitable formats for Transparent copies include plain \" ASCII without markup, Texinfo input format, LaTeX input format, SGML \" or XML using a publicly available DTD, and standard-conforming simple \" HTML designed for human modification. Opaque formats include \" PostScript, PDF, proprietary formats that can be read and edited only \" by proprietary word processors, SGML or XML for which the DTD and/or \" processing tools are not generally available, and the \" machine-generated HTML produced by some word processors for output \" purposes only. \" .PP \" The "Title Page" means, for a printed book, the title page itself, \" plus such following pages as are needed to hold, legibly, the material \" this License requires to appear in the title page. For works in \" formats which do not have any title page as such, "Title Page" means \" the text near the most prominent appearance of the work's title, \" preceding the beginning of the body of the text. \" .PP \" 2. VERBATIM COPYING \" .PP \" You may copy and distribute the Document in any medium, either \" commercially or noncommercially, provided that this License, the \" copyright notices, and the license notice saying this License applies \" to the Document are reproduced in all copies, and that you add no other \" conditions whatsoever to those of this License. You may not use \" technical measures to obstruct or control the reading or further \" copying of the copies you make or distribute. However, you may accept \" compensation in exchange for copies. If you distribute a large enough \" number of copies you must also follow the conditions in section 3. \" .PP \" You may also lend copies, under the same conditions stated above, and \" you may publicly display copies. \" .PP \" 3. COPYING IN QUANTITY \" .PP \" If you publish printed copies of the Document numbering more than 100, \" and the Document's license notice requires Cover Texts, you must enclose \" the copies in covers that carry, clearly and legibly, all these Cover \" Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on \" the back cover. Both covers must also clearly and legibly identify \" you as the publisher of these copies. The front cover must present \" the full title with all words of the title equally prominent and \" visible. You may add other material on the covers in addition. \" Copying with changes limited to the covers, as long as they preserve \" the title of the Document and satisfy these conditions, can be treated \" as verbatim copying in other respects. \" .PP \" If the required texts for either cover are too voluminous to fit \" legibly, you should put the first ones listed (as many as fit \" reasonably) on the actual cover, and continue the rest onto adjacent \" pages. \" .PP \" If you publish or distribute Opaque copies of the Document numbering \" more than 100, you must either include a machine-readable Transparent \" copy along with each Opaque copy, or state in or with each Opaque copy \" a publicly-accessible computer-network location containing a complete \" Transparent copy of the Document, free of added material, which the \" general network-using public has access to download anonymously at no \" charge using public-standard network protocols. If you use the latter \" option, you must take reasonably prudent steps, when you begin \" distribution of Opaque copies in quantity, to ensure that this \" Transparent copy will remain thus accessible at the stated location \" until at least one year after the last time you distribute an Opaque \" copy (directly or through your agents or retailers) of that edition to \" the public. \" .PP \" It is requested, but not required, that you contact the authors of the \" Document well before redistributing any large number of copies, to give \" them a chance to provide you with an updated version of the Document. \" .PP \" 4. MODIFICATIONS \" .PP \" You may copy and distribute a Modified Version of the Document under \" the conditions of sections 2 and 3 above, provided that you release \" the Modified Version under precisely this License, with the Modified \" Version filling the role of the Document, thus licensing distribution \" and modification of the Modified Version to whoever possesses a copy \" of it. In addition, you must do these things in the Modified Version: \" .PP \" A. Use in the Title Page (and on the covers, if any) a title distinct \" from that of the Document, and from those of previous versions \" (which should, if there were any, be listed in the History section \" of the Document). You may use the same title as a previous version \" if the original publisher of that version gives permission. \" .PP \" B. List on the Title Page, as authors, one or more persons or entities \" responsible for authorship of the modifications in the Modified \" Version, together with at least five of the principal authors of the \" Document (all of its principal authors, if it has less than five). \" .PP \" C. State on the Title page the name of the publisher of the \" Modified Version, as the publisher. \" .PP \" D. Preserve all the copyright notices of the Document. \" .PP \" E. Add an appropriate copyright notice for your modifications \" adjacent to the other copyright notices. \" .PP \" F. Include, immediately after the copyright notices, a license notice \" giving the public permission to use the Modified Version under the \" terms of this License, in the form shown in the Addendum below. \" Preserve in that license notice the full lists of Invariant Sections \" and required Cover Texts given in the Document's license notice. \" .PP \" H. Include an unaltered copy of this License. \" .PP \" I. Preserve the section entitled "History", and its title, and add to \" it an item stating at least the title, year, new authors, and \" publisher of the Modified Version as given on the Title Page. If \" there is no section entitled "History" in the Document, create one \" stating the title, year, authors, and publisher of the Document as \" given on its Title Page, then add an item describing the Modified \" Version as stated in the previous sentence. \" .PP \" J. Preserve the network location, if any, given in the Document for \" public access to a Transparent copy of the Document, and likewise \" the network locations given in the Document for previous versions \" it was based on. These may be placed in the "History" section. \" You may omit a network location for a work that was published at \" least four years before the Document itself, or if the original \" publisher of the version it refers to gives permission. \" .PP \" K. In any section entitled "Acknowledgements" or "Dedications", \" preserve the section's title, and preserve in the section all the \" substance and tone of each of the contributor acknowledgements \" and/or dedications given therein. \" .PP \" L. Preserve all the Invariant Sections of the Document, \" unaltered in their text and in their titles. Section numbers \" or the equivalent are not considered part of the section titles. \" .PP \" M. Delete any section entitled "Endorsements". Such a section \" may not be included in the Modified Version. \" .PP \" N. Do not retitle any existing section as "Endorsements" \" or to conflict in title with any Invariant Section. \" .PP \" If the Modified Version includes new front-matter sections or \" appendices that qualify as Secondary Sections and contain no material \" copied from the Document, you may at your option designate some or all \" of these sections as invariant. To do this, add their titles to the \" list of Invariant Sections in the Modified Version's license notice. \" These titles must be distinct from any other section titles. \" .PP \" You may add a section entitled "Endorsements", provided it contains \" nothing but endorsements of your Modified Version by various \" parties--for example, statements of peer review or that the text has \" been approved by an organization as the authoritative definition of a \" standard. \" .PP \" You may add a passage of up to five words as a Front-Cover Text, and a \" passage of up to 25 words as a Back-Cover Text, to the end of the list \" of Cover Texts in the Modified Version. Only one passage of \" Front-Cover Text and one of Back-Cover Text may be added by (or \" through arrangements made by) any one entity. If the Document already \" includes a cover text for the same cover, previously added by you or \" by arrangement made by the same entity you are acting on behalf of, \" you may not add another; but you may replace the old one, on explicit \" permission from the previous publisher that added the old one. \" .PP \" The author(s) and publisher(s) of the Document do not by this License \" give permission to use their names for publicity for or to assert or \" imply endorsement of any Modified Version. \" .PP \" 5. COMBINING DOCUMENTS \" .PP \" You may combine the Document with other documents released under this \" License, under the terms defined in section 4 above for modified \" versions, provided that you include in the combination all of the \" Invariant Sections of all of the original documents, unmodified, and \" list them all as Invariant Sections of your combined work in its \" license notice. \" .PP \" The combined work need only contain one copy of this License, and \" multiple identical Invariant Sections may be replaced with a single \" copy. If there are multiple Invariant Sections with the same name but \" different contents, make the title of each such section unique by \" adding at the end of it, in parentheses, the name of the original \" author or publisher of that section if known, or else a unique number. \" Make the same adjustment to the section titles in the list of \" Invariant Sections in the license notice of the combined work. \" .PP \" In the combination, you must combine any sections entitled "History" \" in the various original documents, forming one section entitled \" "History"; likewise combine any sections entitled "Acknowledgements", \" and any sections entitled "Dedications". You must delete all sections \" entitled "Endorsements." \" .PP \" 6. COLLECTIONS OF DOCUMENTS \" .PP \" You may make a collection consisting of the Document and other documents \" released under this License, and replace the individual copies of this \" License in the various documents with a single copy that is included in \" the collection, provided that you follow the rules of this License for \" verbatim copying of each of the documents in all other respects. \" .PP \" You may extract a single document from such a collection, and distribute \" it individually under this License, provided you insert a copy of this \" License into the extracted document, and follow this License in all \" other respects regarding verbatim copying of that document. \" .PP \" 7. AGGREGATION WITH INDEPENDENT WORKS \" .PP \" A compilation of the Document or its derivatives with other separate \" and independent documents or works, in or on a volume of a storage or \" distribution medium, does not as a whole count as a Modified Version \" of the Document, provided no compilation copyright is claimed for the \" compilation. Such a compilation is called an "aggregate", and this \" License does not apply to the other self-contained works thus compiled \" with the Document, on account of their being thus compiled, if they \" are not themselves derivative works of the Document. \" .PP \" If the Cover Text requirement of section 3 is applicable to these \" copies of the Document, then if the Document is less than one quarter \" of the entire aggregate, the Document's Cover Texts may be placed on \" covers that surround only the Document within the aggregate. \" Otherwise they must appear on covers around the whole aggregate. \" .PP \" 8. TRANSLATION \" .PP \" Translation is considered a kind of modification, so you may \" distribute translations of the Document under the terms of section 4. \" Replacing Invariant Sections with translations requires special \" permission from their copyright holders, but you may include \" translations of some or all Invariant Sections in addition to the \" original versions of these Invariant Sections. You may include a \" translation of this License provided that you also include the \" original English version of this License. In case of a disagreement \" between the translation and the original English version of this \" License, the original English version will prevail. \" .PP \" 9. TERMINATION \" .PP \" You may not copy, modify, sublicense, or distribute the Document except \" as expressly provided for under this License. Any other attempt to \" copy, modify, sublicense or distribute the Document is void, and will \" automatically terminate your rights under this License. However, \" parties who have received copies, or rights, from you under this \" License will not have their licenses terminated so long as such \" parties remain in full compliance. \" .PP \" 10. FUTURE REVISIONS OF THIS LICENSE \" .PP \" The Free Software Foundation may publish new, revised versions \" of the GNU Free Documentation License from time to time. Such new \" versions will be similar in spirit to the present version, but may \" differ in detail to address new problems or concerns. See \" http://www.gnu.org/copyleft/. \" .PP \" Each version of the License is given a distinguishing version number. \" If the Document specifies that a particular numbered version of this \" License "or any later version" applies to it, you have the option of \" following the terms and conditions either of that specified version or \" of any later version that has been published (not as a draft) by the \" Free Software Foundation. If the Document does not specify a version \" number of this License, you may choose any version ever published (not \" as a draft) by the Free Software Foundation. \" .PP \" ADDENDUM: How to use this License for your documents \" .PP \" To use this License in a document you have written, include a copy of \" the License in the document and put the following copyright and \" license notices just after the title page: \" .PP \" Copyright (c) YEAR YOUR NAME. \" Permission is granted to copy, distribute and/or \" modify this document under the terms of the GNU \" Free Documentation License, Version 1.1 or any later \" version published by the Free Software Foundation; \" with the Invariant Sections being LIST THEIR TITLES, \" with the Front-Cover Texts being LIST, and with the \" Back-Cover Texts being LIST. A copy of the license \" is included in the section entitled "GNU Free \" Documentation License". \" .PP \" If you have no Invariant Sections, write "with no Invariant Sections" \" instead of saying which ones are invariant. If you have no \" Front-Cover Texts, write "no Front-Cover Texts" instead of \" "Front-Cover Texts being LIST"; likewise for Back-Cover Texts. \" .PP \" If your document contains nontrivial examples of program code, we \" recommend releasing these examples in parallel under your choice of \" free software license, such as the GNU General Public License, \" to permit their use in free software. binutils/binutils-MAN/opt/binutils/man/man1/strip.1010064400000000000003000000567100732753202100210050ustar000300000000000000.\" Copyright (c) 1991, 92, 93, 94, 95, 96, 97, 1998, 2000 Free Software Foundation .\" See section COPYING for conditions for redistribution .TH strip 1 "5 November 1991" "Free Software Foundation" "GNU Development Tools" .de BP .sp .ti \-.2i \(** .. .SH NAME strip \- Discard symbols from object files. .SH SYNOPSIS .hy 0 .na .TP .B strip .RB "[\|" \-F\ \fIbfdname\fR\ |\ \fB\-\-target=\fIbfdname\fP "\|]" .RB "[\|" \-I\ \fIbfdname\fR\ |\ \fB\-\-input\-target=\fIbfdname\fP "\|]" .RB "[\|" \-O\ \fIbfdname\fR\ |\ \fB\-\-output\-target=\fIbfdname\fP "\|]" .RB "[\|" \-R\ \fIsectionname\fR\ |\ \fB\-\-remove\-section=\fIsectionname\fP "\|]" .RB "[\|" \-s\fR\ |\ \fB\-\-strip\-all "\|]" .RB "[\|" \-S\fR\ |\ \fB\-g\fR\ |\ \fB\-\-strip\-debug "\|]" .RB "[\|" \-\-strip\-unneeded\fR "\|]" .RB "[\|" \-x\fR\ |\ \fB\-\-discard\-all "\|]" .RB "[\|" \-X\fR\ |\ \fB\-\-discard\-locals "\|]" .RB "[\|" \-K\ \fIsymbolname\fR\ |\ \fB\-\-keep\-symbol=\fIsymbolname\fR "\|]" .RB "[\|" \-N\ \fIsymbolname\fR\ |\ \fB\-\-strip\-symbol=\fIsymbolname\fR "\|]" .RB "[\|" \-o\ \fIfile\fR "\|]" .RB "[\|" \-p\fR\ |\ \fB\-\-preserve\-dates "\|]" .RB "[\|" \-v\fR\ |\ \fB\-\-verbose "\|]" .RB "[\|" \-V\fR\ |\ \fB\-\-version "\|]" .RB "[\|" \-V\fR\ |\ \fB\-\-help "\|]" .I objfile\c \&.\|.\|. .SH DESCRIPTION GNU .B strip discards all symbols from the object files .IR objfile . The list of object files may include archives. At least one object file must be given. .P .B strip modifies the files named in its argument, rather than writing modified copies under different names. .SH OPTIONS .TP .B "\-F \fIbfdname" .TP .B "\-\-target=\fIbfdname" Treat the original \fIobjfile\fP as a file with the object code format \fIbfdname\fP, and rewrite it in the same format. .TP .B \-\-help Show a summary of the options to .B strip and exit. .TP .B "\-I \fIbfdname .TP .B "\-\-input\-target=\fIbfdname" Treat the original \fIobjfile\fP as a file with the object code format \fIbfdname\fP. .TP .B "\-O \fIbfdname\fP" .TP .B "\-\-output\-target=\fIbfdname" Replace \fIobjfile\fP with a file in the output format \fIbfdname\fP. .TP .B "\-R \fIsectionname\fP" .TP .B "\-\-remove\-section=\fIsectionname" Remove the named section from the file. This option may be given more than once. Note that using this option inappropriately may make the object file unusable. .TP .B \-s .TP .B \-\-strip\-all Remove all symbols. .TP .B \-S .TP .B \-g .TP .B \-\-strip\-debug Remove debugging symbols only. .TP .B \-\-strip\-unneeded Strip all symbols that are not needed for relocation processing. .TP .B \-N \fIsymbolname\fR .TP .B \-\-strip\-symbol=\fIsymbolname Remove symbol \fIsymbolname\fP from the source file. This option may be given more than once, and may be combined with other strip options. .TP .B \-o \fIfile\fR Put the stripped output in \fIfile\fR, rather than replacing the existing file. When this argument is used, only one \fIobjfile\fR argument may be specified. .TP .B \-p .TP .B \-\-preserve-dates Preserve the access and modification dates of the file. .TP .B \-x .TP .B \-\-discard\-all Remove non-global symbols. .TP .B \-X .TP .B \-\-discard\-locals Remove compiler-generated local symbols. (These usually start with ``L'' or ``.''.) .TP .B \-K \fIsymbolname\fR, \fB\-\-keep\-symbol=\fIsymbolname Copy only symbol \fIsymbolname\fP from the source file. This option may be given more than once. .TP .B \-N \fIsymbolname\fR, \fB\-\-strip\-symbol=\fIsymbolname Do not copy symbol \fIsymbolname\fP from the source file. This option may be given more than once, and may be combined with strip options other than \fB\-K\fR. .TP .B \-v .TP .B \-\-verbose Verbose output: list all object files modified. In the case of archives, .B "strip \-v" lists all members of the archive. .TP .B \-V .TP .B \-\-version Show the version number for \fBstrip\fP and exit. .SH "SEE ALSO" .RB "`\|" binutils "\|'" entry in .BR info ; .IR "The GNU Binary Utilities" , Roland H. Pesch (October 1991). .SH COPYING Copyright (c) 1991, 2000 Free Software Foundation, Inc. .PP This document is distributed under the terms of the GNU Free Documentation License, version 1.1. That license is described in the sources for this manual page, but it is not displayed here in order to make this manual more consise. Copies of this license can also be obtained from: http://www.gnu.org/copyleft/. \" .SH GNU Free Documentation License \" Version 1.1, March 2000 \" Copyright (C) 2000 Free Software Foundation, Inc. \" 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA \" Everyone is permitted to copy and distribute verbatim \" copies of this license document, but changing it is \" not allowed. \" .PP \" 0. PREAMBLE \" .PP \" The purpose of this License is to make a manual, textbook, or other \" written document "free" in the sense of freedom: to assure everyone \" the effective freedom to copy and redistribute it, with or without \" modifying it, either commercially or noncommercially. Secondarily, \" this License preserves for the author and publisher a way to get \" credit for their work, while not being considered responsible for \" modifications made by others. \" .PP \" This License is a kind of "copyleft", which means that derivative \" works of the document must themselves be free in the same sense. It \" complements the GNU General Public License, which is a copyleft \" license designed for free software. \" .PP \" We have designed this License in order to use it for manuals for free \" software, because free software needs free documentation: a free \" program should come with manuals providing the same freedoms that the \" software does. But this License is not limited to software manuals; \" it can be used for any textual work, regardless of subject matter or \" whether it is published as a printed book. We recommend this License \" principally for works whose purpose is instruction or reference. \" .PP \" 1. APPLICABILITY AND DEFINITIONS \" .PP \" This License applies to any manual or other work that contains a \" notice placed by the copyright holder saying it can be distributed \" under the terms of this License. The "Document", below, refers to any \" such manual or work. Any member of the public is a licensee, and is \" addressed as "you". \" .PP \" A "Modified Version" of the Document means any work containing the \" Document or a portion of it, either copied verbatim, or with \" modifications and/or translated into another language. \" .PP \" A "Secondary Section" is a named appendix or a front-matter section of \" the Document that deals exclusively with the relationship of the \" publishers or authors of the Document to the Document's overall subject \" (or to related matters) and contains nothing that could fall directly \" within that overall subject. (For example, if the Document is in part a \" textbook of mathematics, a Secondary Section may not explain any \" mathematics.) The relationship could be a matter of historical \" connection with the subject or with related matters, or of legal, \" commercial, philosophical, ethical or political position regarding \" them. \" .PP \" The "Invariant Sections" are certain Secondary Sections whose titles \" are designated, as being those of Invariant Sections, in the notice \" that says that the Document is released under this License. \" .PP \" The "Cover Texts" are certain short passages of text that are listed, \" as Front-Cover Texts or Back-Cover Texts, in the notice that says that \" the Document is released under this License. \" .PP \" A "Transparent" copy of the Document means a machine-readable copy, \" represented in a format whose specification is available to the \" general public, whose contents can be viewed and edited directly and \" straightforwardly with generic text editors or (for images composed of \" pixels) generic paint programs or (for drawings) some widely available \" drawing editor, and that is suitable for input to text formatters or \" for automatic translation to a variety of formats suitable for input \" to text formatters. A copy made in an otherwise Transparent file \" format whose markup has been designed to thwart or discourage \" subsequent modification by readers is not Transparent. A copy that is \" not "Transparent" is called "Opaque". \" .PP \" Examples of suitable formats for Transparent copies include plain \" ASCII without markup, Texinfo input format, LaTeX input format, SGML \" or XML using a publicly available DTD, and standard-conforming simple \" HTML designed for human modification. Opaque formats include \" PostScript, PDF, proprietary formats that can be read and edited only \" by proprietary word processors, SGML or XML for which the DTD and/or \" processing tools are not generally available, and the \" machine-generated HTML produced by some word processors for output \" purposes only. \" .PP \" The "Title Page" means, for a printed book, the title page itself, \" plus such following pages as are needed to hold, legibly, the material \" this License requires to appear in the title page. For works in \" formats which do not have any title page as such, "Title Page" means \" the text near the most prominent appearance of the work's title, \" preceding the beginning of the body of the text. \" .PP \" 2. VERBATIM COPYING \" .PP \" You may copy and distribute the Document in any medium, either \" commercially or noncommercially, provided that this License, the \" copyright notices, and the license notice saying this License applies \" to the Document are reproduced in all copies, and that you add no other \" conditions whatsoever to those of this License. You may not use \" technical measures to obstruct or control the reading or further \" copying of the copies you make or distribute. However, you may accept \" compensation in exchange for copies. If you distribute a large enough \" number of copies you must also follow the conditions in section 3. \" .PP \" You may also lend copies, under the same conditions stated above, and \" you may publicly display copies. \" .PP \" 3. COPYING IN QUANTITY \" .PP \" If you publish printed copies of the Document numbering more than 100, \" and the Document's license notice requires Cover Texts, you must enclose \" the copies in covers that carry, clearly and legibly, all these Cover \" Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on \" the back cover. Both covers must also clearly and legibly identify \" you as the publisher of these copies. The front cover must present \" the full title with all words of the title equally prominent and \" visible. You may add other material on the covers in addition. \" Copying with changes limited to the covers, as long as they preserve \" the title of the Document and satisfy these conditions, can be treated \" as verbatim copying in other respects. \" .PP \" If the required texts for either cover are too voluminous to fit \" legibly, you should put the first ones listed (as many as fit \" reasonably) on the actual cover, and continue the rest onto adjacent \" pages. \" .PP \" If you publish or distribute Opaque copies of the Document numbering \" more than 100, you must either include a machine-readable Transparent \" copy along with each Opaque copy, or state in or with each Opaque copy \" a publicly-accessible computer-network location containing a complete \" Transparent copy of the Document, free of added material, which the \" general network-using public has access to download anonymously at no \" charge using public-standard network protocols. If you use the latter \" option, you must take reasonably prudent steps, when you begin \" distribution of Opaque copies in quantity, to ensure that this \" Transparent copy will remain thus accessible at the stated location \" until at least one year after the last time you distribute an Opaque \" copy (directly or through your agents or retailers) of that edition to \" the public. \" .PP \" It is requested, but not required, that you contact the authors of the \" Document well before redistributing any large number of copies, to give \" them a chance to provide you with an updated version of the Document. \" .PP \" 4. MODIFICATIONS \" .PP \" You may copy and distribute a Modified Version of the Document under \" the conditions of sections 2 and 3 above, provided that you release \" the Modified Version under precisely this License, with the Modified \" Version filling the role of the Document, thus licensing distribution \" and modification of the Modified Version to whoever possesses a copy \" of it. In addition, you must do these things in the Modified Version: \" .PP \" A. Use in the Title Page (and on the covers, if any) a title distinct \" from that of the Document, and from those of previous versions \" (which should, if there were any, be listed in the History section \" of the Document). You may use the same title as a previous version \" if the original publisher of that version gives permission. \" .PP \" B. List on the Title Page, as authors, one or more persons or entities \" responsible for authorship of the modifications in the Modified \" Version, together with at least five of the principal authors of the \" Document (all of its principal authors, if it has less than five). \" .PP \" C. State on the Title page the name of the publisher of the \" Modified Version, as the publisher. \" .PP \" D. Preserve all the copyright notices of the Document. \" .PP \" E. Add an appropriate copyright notice for your modifications \" adjacent to the other copyright notices. \" .PP \" F. Include, immediately after the copyright notices, a license notice \" giving the public permission to use the Modified Version under the \" terms of this License, in the form shown in the Addendum below. \" Preserve in that license notice the full lists of Invariant Sections \" and required Cover Texts given in the Document's license notice. \" .PP \" H. Include an unaltered copy of this License. \" .PP \" I. Preserve the section entitled "History", and its title, and add to \" it an item stating at least the title, year, new authors, and \" publisher of the Modified Version as given on the Title Page. If \" there is no section entitled "History" in the Document, create one \" stating the title, year, authors, and publisher of the Document as \" given on its Title Page, then add an item describing the Modified \" Version as stated in the previous sentence. \" .PP \" J. Preserve the network location, if any, given in the Document for \" public access to a Transparent copy of the Document, and likewise \" the network locations given in the Document for previous versions \" it was based on. These may be placed in the "History" section. \" You may omit a network location for a work that was published at \" least four years before the Document itself, or if the original \" publisher of the version it refers to gives permission. \" .PP \" K. In any section entitled "Acknowledgements" or "Dedications", \" preserve the section's title, and preserve in the section all the \" substance and tone of each of the contributor acknowledgements \" and/or dedications given therein. \" .PP \" L. Preserve all the Invariant Sections of the Document, \" unaltered in their text and in their titles. Section numbers \" or the equivalent are not considered part of the section titles. \" .PP \" M. Delete any section entitled "Endorsements". Such a section \" may not be included in the Modified Version. \" .PP \" N. Do not retitle any existing section as "Endorsements" \" or to conflict in title with any Invariant Section. \" .PP \" If the Modified Version includes new front-matter sections or \" appendices that qualify as Secondary Sections and contain no material \" copied from the Document, you may at your option designate some or all \" of these sections as invariant. To do this, add their titles to the \" list of Invariant Sections in the Modified Version's license notice. \" These titles must be distinct from any other section titles. \" .PP \" You may add a section entitled "Endorsements", provided it contains \" nothing but endorsements of your Modified Version by various \" parties--for example, statements of peer review or that the text has \" been approved by an organization as the authoritative definition of a \" standard. \" .PP \" You may add a passage of up to five words as a Front-Cover Text, and a \" passage of up to 25 words as a Back-Cover Text, to the end of the list \" of Cover Texts in the Modified Version. Only one passage of \" Front-Cover Text and one of Back-Cover Text may be added by (or \" through arrangements made by) any one entity. If the Document already \" includes a cover text for the same cover, previously added by you or \" by arrangement made by the same entity you are acting on behalf of, \" you may not add another; but you may replace the old one, on explicit \" permission from the previous publisher that added the old one. \" .PP \" The author(s) and publisher(s) of the Document do not by this License \" give permission to use their names for publicity for or to assert or \" imply endorsement of any Modified Version. \" .PP \" 5. COMBINING DOCUMENTS \" .PP \" You may combine the Document with other documents released under this \" License, under the terms defined in section 4 above for modified \" versions, provided that you include in the combination all of the \" Invariant Sections of all of the original documents, unmodified, and \" list them all as Invariant Sections of your combined work in its \" license notice. \" .PP \" The combined work need only contain one copy of this License, and \" multiple identical Invariant Sections may be replaced with a single \" copy. If there are multiple Invariant Sections with the same name but \" different contents, make the title of each such section unique by \" adding at the end of it, in parentheses, the name of the original \" author or publisher of that section if known, or else a unique number. \" Make the same adjustment to the section titles in the list of \" Invariant Sections in the license notice of the combined work. \" .PP \" In the combination, you must combine any sections entitled "History" \" in the various original documents, forming one section entitled \" "History"; likewise combine any sections entitled "Acknowledgements", \" and any sections entitled "Dedications". You must delete all sections \" entitled "Endorsements." \" .PP \" 6. COLLECTIONS OF DOCUMENTS \" .PP \" You may make a collection consisting of the Document and other documents \" released under this License, and replace the individual copies of this \" License in the various documents with a single copy that is included in \" the collection, provided that you follow the rules of this License for \" verbatim copying of each of the documents in all other respects. \" .PP \" You may extract a single document from such a collection, and distribute \" it individually under this License, provided you insert a copy of this \" License into the extracted document, and follow this License in all \" other respects regarding verbatim copying of that document. \" .PP \" 7. AGGREGATION WITH INDEPENDENT WORKS \" .PP \" A compilation of the Document or its derivatives with other separate \" and independent documents or works, in or on a volume of a storage or \" distribution medium, does not as a whole count as a Modified Version \" of the Document, provided no compilation copyright is claimed for the \" compilation. Such a compilation is called an "aggregate", and this \" License does not apply to the other self-contained works thus compiled \" with the Document, on account of their being thus compiled, if they \" are not themselves derivative works of the Document. \" .PP \" If the Cover Text requirement of section 3 is applicable to these \" copies of the Document, then if the Document is less than one quarter \" of the entire aggregate, the Document's Cover Texts may be placed on \" covers that surround only the Document within the aggregate. \" Otherwise they must appear on covers around the whole aggregate. \" .PP \" 8. TRANSLATION \" .PP \" Translation is considered a kind of modification, so you may \" distribute translations of the Document under the terms of section 4. \" Replacing Invariant Sections with translations requires special \" permission from their copyright holders, but you may include \" translations of some or all Invariant Sections in addition to the \" original versions of these Invariant Sections. You may include a \" translation of this License provided that you also include the \" original English version of this License. In case of a disagreement \" between the translation and the original English version of this \" License, the original English version will prevail. \" .PP \" 9. TERMINATION \" .PP \" You may not copy, modify, sublicense, or distribute the Document except \" as expressly provided for under this License. Any other attempt to \" copy, modify, sublicense or distribute the Document is void, and will \" automatically terminate your rights under this License. However, \" parties who have received copies, or rights, from you under this \" License will not have their licenses terminated so long as such \" parties remain in full compliance. \" .PP \" 10. FUTURE REVISIONS OF THIS LICENSE \" .PP \" The Free Software Foundation may publish new, revised versions \" of the GNU Free Documentation License from time to time. Such new \" versions will be similar in spirit to the present version, but may \" differ in detail to address new problems or concerns. See \" http://www.gnu.org/copyleft/. \" .PP \" Each version of the License is given a distinguishing version number. \" If the Document specifies that a particular numbered version of this \" License "or any later version" applies to it, you have the option of \" following the terms and conditions either of that specified version or \" of any later version that has been published (not as a draft) by the \" Free Software Foundation. If the Document does not specify a version \" number of this License, you may choose any version ever published (not \" as a draft) by the Free Software Foundation. \" .PP \" ADDENDUM: How to use this License for your documents \" .PP \" To use this License in a document you have written, include a copy of \" the License in the document and put the following copyright and \" license notices just after the title page: \" .PP \" Copyright (c) YEAR YOUR NAME. \" Permission is granted to copy, distribute and/or \" modify this document under the terms of the GNU \" Free Documentation License, Version 1.1 or any later \" version published by the Free Software Foundation; \" with the Invariant Sections being LIST THEIR TITLES, \" with the Front-Cover Texts being LIST, and with the \" Back-Cover Texts being LIST. A copy of the license \" is included in the section entitled "GNU Free \" Documentation License". \" .PP \" If you have no Invariant Sections, write "with no Invariant Sections" \" instead of saying which ones are invariant. If you have no \" Front-Cover Texts, write "no Front-Cover Texts" instead of \" "Front-Cover Texts being LIST"; likewise for Back-Cover Texts. \" .PP \" If your document contains nontrivial examples of program code, we \" recommend releasing these examples in parallel under your choice of \" free software license, such as the GNU General Public License, \" to permit their use in free software. binutils/binutils-RUN/opt/binutils/bin/addr2line010075500000000000003000002700000732753201000205320ustar000300000000000000@%p@ pXPP(G1q(MdD@P%  92453-07B11.17;^ 92453-07B11.046g0@ X"LX $tX!%X p"$p"X 87hpGhpX HK[X IM`]`X XM`]`(>(P@`>(P@<>( P@P>(P @ h>(]d@dt>(&^(@( >('`@@ @>((``@ `>(P@ \@>(R@ dY Md? PD@ $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$yL/`# K |@E<p(OThů;A8v˚v)[8g'VL /v'6!xy!xD!xry 4'PנuR `aDg6mTLL''̃!xT/}(24!x݌/!xg6OXkkX\T W!x/P )'6Y//]! '/!x/Bj+ 4gyh!xng@M5]AZAaxqVɘ 0,>>a9 ƿt?A˚v8vhů;An bRY;tltD8rP.Y;2Y;Y;'j>a%/Rb  "  r@" x@"@"@"@"@!@U@U@U@U@U@U@ U@"DU@U@U]`U]`U [U GhU%@U+UfUp@UvUpUhU:dUUU@UU@U%U!@ (U "(.@8?FLRZbipu| *09@GOX_flty $/9P*<2 : :/tmp/libtool-17787/addr2line/opt/binutils/lib/opt/binutils/lib/libbfd-2.11.2.sl/usr/lib/libm.2/usr/lib/libc.2_tepv_ktepverrno__ismt__dld_loc_hex_valueoptopt_SYSTEM_ID_CPU_REVISIONopterroptindoptarg_FPU_MODEL_end_environ$RECOVER_END$RECOVER_START$UNWIND_END$UNWIND_START$ARGV__text_startmemcmpmallocfopenctimestrrchrsprintfstrcpystrcmpreadstrchr_startcalloctolower_isdigitfgetsfclosebsearchfprintfexitopenrealloc_isalphastrcatstrncpyqsortstrtolstrncmpstrdupvfprintfstrcasecmpgetcwdgetenvsetlocalefstat_isspacefflushstrlenstrncat__flsbufprintfmktempfputcstrpbrkatoisscanf_isalnumfreestrstrstrcspnclosesbrkabortmemcpystrerrorstrspnmemsetbfd_initbfd_get_errorbfd_scan_vmabfd_check_format_matchesbfd_check_formatbfd_openrbfd_errmsgbfd_closebfd_set_default_targetbfd_map_over_sectionsxstrerrorxexitobjalloc_create_objalloc_allocobjalloc_freemainhex_initobjalloc_free_blockfnmatchdcgettextconcat__d_trapfind_address_in_sectionalias_compareerrno__ismt_ktepv_tepv__iobbfd_target_vector__SB_masks7!?9" : B*= @ Z ]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]` =@ :7]@ k? k?k?@@K?@ @Ku;Ks; k?#a7{7 kc!kxQ'y 4yEe'y7D7%767+4>#-744445 bנZRkeAkeI (4Ц @Ц D(43 H? (ਃ 43 ` 7+4>7D7%7744z#%74444@H@7D7%7# '7444KxQ7D7%77Kv 24u74444#+7@@@@ 7K?@ @@@@k?7k?#Ik? 7Y k?4@4 @@K?K?7@4K? *@K? K? 7@4K? rKa?H:@7?!# 7 4@(4@x7?!7?!7@4#)79 4@4Ka?@ H:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 860.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?ok)4`@44` G>- ""46 _4K>9K>Qk<+H<@K>i *K>y4ߟ444K>IKa_k? k?54@h44? 7+ I4Y 04:_4h4k?4K>a5k?4@44?"p74@4K+k>44 k>Khk>v k>+H3@k>+4'0k>y 4 c?+K?4=Hk>Ka?43k? Ka?44k?֠ k?Ka?45k?7vxk?1+~4< !0k?!(k?)# 7 04_47=)"6 `4_4G=-+"6 4:_M4_+"i6y 4:_4 )49 0+4:_4] k?)Kpk?9k?A k?Ik?Q@k?QKqK>Akf@ k?q( k?4? k?( 0k?47 k?k>  k>7uk?y7>7>444? m7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4!4! <4?@@k?7k?#Ik? 7Y `k?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?!# 7 p4_-4@x7?!7?!7_4#)79 4_4Ka?_H:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 86 @0.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?7Kvh+~ H4? 44477K?Y@7?K?Yk?4?k?474_4$4?7 k|_M@eK?Y# 7 7z!!_U4-K?YKuKs> k?k?ok? KP7D 7#Hw @Hz0k?K|p@@a(!@HwHK?Kp zK?H7xXk?7th7}`Jv k? ?Kx 4k?4y7k|PK>K? @O?_u@-K?Ku<1Ks<9 k?Ku>Ks> k?Ku?aKs?i k?Ku=Ks= k?Ku>1Ks>9 k?Ku;Ks; k?Ku=Ks= k?k?ok> k>k>k>!4#K|0k>9Kv!k>A7u!Ka?k>1044% R44_7>"47>_4 `k|pKw0BR6?kw0K(7kx(K4_4 k|pk`PK>94_K>AKyP 8KH @_4 _4 j @Ky` C= _=4 Ks8Kz@@ _ 4 xKs87:@h47 4 _Ky`(Ks8_4_4Ks8` 8@Kzh@ "_4^ 7kthKyh 4 K>1_ KxX_4 =@K=K>!K>K>K> @O>Ku?!Ks?) k?Ku?Ks? k?Ku?Ks?  k?Ku>Ks> k?Ku?AKs?I k?k?o_k?!(74_4z!"7?4_4z `@@8Hz_@ @@ @K?_%K?C4_]4z_4zKz @ @_@k` _4zK>@O?@(K?4#47 F 4 K?@77?@@K?@ @Ku=QKs=Y k?Ku>Ks> k?k?ok? k?k?k?!k?)k?1k?9k?Ak?I 7Ck?7&4 P_4 4 `4 F 4F x4HkzC 4_4@@4 k?a7w!k?i4zC4!@4(4)4 4 4 ́\!b"Z4ʃ!:4Ă 4":4"J4\ 2! Ka?4:@_4k?kk@Kz:р @@ 07@07k?xKe:k?Q44 F h4 K?QKy:7@0k?QuK?QKd:@kk8k?K?a4z4CK?i>M@Kt:ɐ04@ k}( ks04_544K>K?IK?AK?9K?1K?)K?!K?K?K? @O?kkH@04 k?Ka?4_4: k?Ku?1Ks?9 k?k?o_7C_7Ka?7 @4:@k?#Kx7P_4w(K>#)Kx_}79pK>@O?k?7_@C 4K?Y@7?Ku=Ks= k?Ku=Ks= k?k?7Kxk?#IKa?k?7Y4:@_ ek?K?K?_-K?Ka?H9@78?`Hh8@Ka?H?H7h7H4K?Y@7?K?_4K?Yk?77_k?17?9k?)k?!_k?9C 4K?Y@7?Ku?QKs?Y k?k?7# 7_k? @K?Y@7?"46F4 k?_%7K?k?_7K?K?_7eK?YKu=Ks= k?k?ok?7C 44 F4 KxKa?4:@k?_ }7Hw 8@ `K?_ E4P h?4cK?_4K?YK?@O?k?ok? k?7D i Hk?!44y`F4 K?!_ }7HKa?44yF4 K?!7_ -4Ka?H?K4 P4% K84yP4_K?!H ?@K?!_4yK>K?K? @O?k?oKx:7Y i_ 4z44yFx4 _ 744y0FH4 _ 7_4K?Y@O?@P@K?@ @Ku=Ks= k?k?ok?k?7?1k?1k?)k?!!0k?944C@ K?9 7B *7?6`Hw bB *7`?64c?`Hw?@K?YK?K?@O?_E4eԠH>7_4?ԠH@? u4Ku;Ks; k?KuKs> k?k?ok>7#4k>4_7>k>#7>  Kw:  #Zk>K>^?*EK> p7K>?@Z"K>@4yȜ84K>@7>7@ 7>4K>YK>@O>k?oK?7Cr Z:7? 87='Hz'8G'FC |K?Y@O?Ku>AKs>I k?Ku;Ks; k?Ku;Ks; k?k?ok? k?k?k?!k?) 7Ck?44 _mk? 44c 4@4#4x#4_4z! @_4z0 _ w 67B7 @ R4@4 Z@_ 8"@?7044K>K?)K?!K?K?K? @O?C48"Z|4_77?7?_e45? b K?76q VǶ5?@J w  TǴ26?` @ w  Yǹ_6?@2 w  "6? x ' (4 w 0H64`4@| S4 y X@ w 6  <]m7 w  Z Y? w }? 5?4\ 7\ w  w < w 6 u < w 4_4z77?7?_ 4@y4x: (K?4_4y44 4_4x4k?ok? k?k?k?!44k>k>KEXk@XKFPKD`KCpK>kPK>k@pK>k xK>!C`!B7?QK>K_^7>A7?Q7 (@K>7>A7?Q7 @@K>C "K>7>@ X7?Q7K>KP 2# 70BT7?QK>jPKX 2"6pB 7?QK>@jXKxB *#7B7?QK>jxK>7?Q@4K>hPK>k%XK>kD`K>kpK>K?!K?K?K? @O?k?oB7CHz@ @_@Hz@ @_Y@K?Y@O?Ku>Ks> k?k?ok?k?k?7C@7$44z_u4HH @H@@4H0!jH Ax4H8" H(B4H"H B4H@#RK?YK?K?K?@O?Ch  |H_  7C(4Ha% \4HsHe  _4H@e_m@H0C u |H_U % 7C`4H 4HtH  _%4H _wHH8C  |H E _@7C4Hx  <4HuH % _U4H(_e@EHC -h|H_ 7C4Hz E 4HvH  _4H_wHHC@4h|BX7HzBHHeK?Yk?ok?B 7CHz@ @_@ `h`HHw H`X4HHw  _@HwH4_@_aHzh`Hz@ (@B@_!Hzh`K?YK?@O?k?7_k?_K?K?Y@7?k?ok?k?7#_-7 4B4z84#74B4zHd4K?YK?K?@O?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK27D7%B_744444)4 7l#k>7k#k>7j#k>7n#k>!57j6q!4 4?47W?u4? w ǚ6\ C(b _ AǡRH6V B((@ _ VǶ_@k?444A04x (7H Y4BP6YH^4 rk?444A4xH7^4 6S  06Qh`_m@Hp Thp 0HH7 Hy@ 82H6 @? ?@HC0 7  bhh44@4x 06Q (7H ?4A469H@ ^_HC (4 244A7?Y P7Hǡ K>@K>B7?Y4zBP7?Y 46B H4^ޟ4^_ B444BP4x$7H^_HC#7 7?A4A47B7?Ak?B(7?)k?B7?A 0H447?A@@7?) (7H "4A69Hǹ@K>@K>B7?A4zB87?AHXB5B7?)4zB7?)HX7?hXHP HX*4zB7?)HP6?hPB(7?)B7?A 4H@ @9 @B07?qH52 44AP7?qK?qK?y] 75B7?q4zB7?qB07?q P@H^rk?44k?4@4xHPH4ZҠ_4 H7H^r44A<4x47 ! bHƿ@4^_ A$444A4x74 !*HB_@67W? :H^"44A<4x7 H H` # 7B4zHp@ ZHoHp "6BX4z_Hp7B04z5<K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O> %@k?ok? k?k?k?!k?)k?1k?97& k?A74B77?iA44 !x4K?i A`44x4 7 7 K?A4_4x!7K?i@ 4B04zHC?m@7 4 B 4z`K?iK?A4A7? 74zB`7?B 7?K?i4_4 HsBz?4| 4B (4z40B 4z4K>K?9K?1K?)K?!K?K?K? @O?B 7??GHsK?iKu;QKs;Y k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Y77#k?i 4@k?a47B 0k?qHz7_ 4C4(0x47h%!7i%)4 4K?aK?i4y@K?q 7HwB( H}Cf!44K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O??4_Hz474 L_a (7 Hy_=5x :5? L@>H}UK?a4K?i4B 4 , B 8K?iK?i4B 4Hx  yK?i4PB h4Ht6 uk?ok>k>k>k>K747#k>B!j4!4!r444!4#K>7 B x4Hy7: z_I4z7 "6`7?Q_A4K>Bp7?Q@ * "HC7 0 g44K>YK>K>K>K>@O>4y_}4ܟ44k?K>4A4yܟe44? jB J K>4 B4Hx7 } 4̂5@>%@_4z@k?ok?K!7#4k?@?? "4y_4 K?Y4ڋ_ :#K?7 B4Hu6 vHtB7d6q YǹX@HyK?BP4Ha45 uB Sdz_HyH|C4\ "iK?6ypB4Hv6 yC? XǸX@HyK?Bx4H|7 tB ]ǽ_HyHuB4ʊ #K?7B4Ht6 xC WǷRHyK?B4Hv6 sBb ZǺ_Hy4K?YK?@O?Ku@K?14_4|(4|\ @ g?aK?17?aB4K?14Bh44| _ 4>@#I7YK?1B4 `4|#)K?179B4(4| *K?14_=4|4| !4? B4k?K?144@4|4|_ i477R 2#K?17A4HB4k?9H7_=4K?9 F _ H (k?A"K?16A$4K?A 0K?1AlK?A^EK?A@AK?!K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>K>77)K87 97CK>6444 $4 Ad4z7I?C40#7 ,_5:$7Hy @HzLD_5:$H$ A4 $Hx A5z"4z@597A 7?1'r'44z595_5'7 II B 6Hx <6Hw _IHu 4A5A5K? 5kxd4J>7?17 ?4z59_ 4&7_5:_m7_iI:WK? 5A4I94AD5 p@B ,5Ha+ \5Hv _I9Hu I4 u /_5:Ak? ^UI:K? aHpǰ8 !I:5_Q404  @I9K? A4 @I9K? A5zI5K?  ? "6 A47? @5:!"5A7?1YK>K>K>K>K>K>K>K>K>K>K>K>K>@O> zK? B  h|K? 4haK? `2Hs  7K? @K? a4 4 4 ! 5A4I?C;@7 74z59@7?1=74A 7?1=@K?9K?1 YB5Hs k 5H} _iK?1H} o 7?1 @A@K? 7?qA,7O4z @A54 *"6A4`@HBz?4|] "6A4"6 pA4 0]@HH ? 8484zA4 5k?ok? k?k?k?!K_7G7$K>76^"i6y^}4  b7 }^E4z""H   C4X!@H^_ 4^4 P 4^4 ( 4^}4 H4" b^=4z!BH   @C4 7ς z4 ^4 ` 7 f^4z H   C4 4K>K?!K?K?K? @O?ˀK>7ς }ˀK>ˀK>7ςm yk?ok? k?k?k?!k?)k?1k?9KH7#7EK976h 8 & 4#7?Ik?7?A4_4%@A 7?YHyK?A *AD4Hh_ HH hh! 5 A d4K?I4 4 7?YA @K?IC7#R!47?I@ 7?Y$*4 t44y@7?Y 4A \7?YHsB 8 40A L4A $7?YHCR" 777! *44yA h7?Y?/44 pA 4A 7?YHC70 w0K>7k?I7?IA 7?Y"z847:^4x @Hy <@ @A d4(HyHy4A 44Hy4  hA <7?YHh HH hh 4 A $4444 4 44yA7?Y>4 p%47k?I47?I@ 7?y 5@A l7?Y7?YA $7?y5PA <7?YK?IC j7k?I7?IA x7?Y :4A 7?Y50A4K?Iu7?YA@K?IH4"?h5 pAT4Hj@ Hz4@^4 zHwB4V ZBB B7z:^M "4`A4@HjHh7hh4HyA4Hj F  K>K?9K?1K?)K?!K?K?K? @O?k?ok? k?7#4k?!7:^k?)77ȠJ^ Hz@0@K?!K?)4y_u444K>K?K? @O?k?ok? 7C7?k?4Ak?A84zk?!K?4z_7?!@HxPK?HsXrHh K? 'k?K?A7?H}X0@HyP76?hvPk?K? $848A 4zK?K? ? 848K?!A4zHb@߿7y#@_7y$ALK?K?A7?4AD7?4K>K? @O?#K?A7HzX7U?huXk?ok>k>k>k>k>B67#k>K%7D4"H^޿^_"6^ 5"h@AT7>K>AD7>44^e7>7>^4A!z44K>4yAP5K>4_4y! 7 eAK>K>Al7>4^]7>5C @C :7C b?7C?7 ("7C ?77?A@>4_7>A7>4K>YK>K>K>K>K>@O>4K>44yA`5Ÿ}4Ku>Ks> k?k?ok? k?k?k?!7#7DK:^k?14Z"Hz6^4  2#Hz7^4  @Hy7: z4hx#@7s6q VǶH"4(ȠhHPHƟ@ ^_b IHz4Y^4"2H}7 |4hP^eHzZ Hz4@^4!*HtB7z:Y^@!HCC!bC4 R7 v4K?1hX4@4y!@44 7 u4K?1hP4@4y 4H^ _@ Hz4^4=HHs6a a4hXHf44^e47 7C?7 4? 2# 7_u4@ 7? <H`ȠHPHz!J@7u6q WǷ@:4 *4_ 4? 4 Hƿ@ ^jǷb4 f^e4zHyA`K?1^HzHt x wƿ@:^"^_HP7^_hP4 bHƟr@4v Z@4< B^@K?174_ 4y4_@4 @4ڂ *4 b@4 }( B^E@K?174_ 4y4!@7t6q VǶ@4 ^޿ ^_K?1@4z!@ 4@?4#I7Y^4 7B0ȠzK?14_ 4yȼ4@ 2K?144y_4ȼx44HP HX BHyK?1A4^AHzHa  b4K>K?!K?K?K? @O??4EHPKu=Ks= k?Ku>QKs>Y k?k?ok>k>k>k>k>k>k>k>k>k>k>K?47#k>C7D4 P4C7z:Y^@ HC#@HC C :C4 + "C4 C"4 7 :C4 "C7z:^ҙ"HC `@C! ә^5 *7i:Hz_}59$x7 Hz4 ^Y4'HHz4^14 *HC4҃'4̂'44K>YK>K>K>K>K>K>K>K>K>K>K>@O>_7y:7HyK>A5Hw  }7_7y:""Ƞ4Ha49 y^ %4&7Ƞ47 sHX6hXHC: 7 jJ A_7 iA?5:!7h$!7i$7j6q4+4 4 J ( k?K>44@ `4yȼ}Hzk?K>44k?_4yȼ5Hz _ XǸ@^Q4zHz^7}HyHz_7y:4 ZH=@H`߿95AK>Hy7: zHzC_>m@ iAX4y%4Hy78 x4 C R4 4 k?K>44@ @4yȼ:k?K>44k?_4y7!rȠE4^A4z@7^Hz@ Ƞ4@@Hz5@^4 HC46 CC r^)5: P@K>A p5`HbF  z_59@HHyK>A4Hh   H>u@7 yH߿7y$1K>_7y$AA @^HzHyK>7A 7H}  b7W w^ 4z97Ƞ44@^7?!K>A 7?!K>A 4]4^HzHz \ E a7 nA 87g$Q4 (7g$q R4 4 zk?K>44@P4yȼjk?K>44k?_ 4yȼ(@K>4@ 4y7 "HtB Ƞ 4K>ᐠ A 44k?ok? k?k?7F6k?!7#AD6Hy77^-4 H^4 87K?!A 04] 4 @HyK?!A 4]4Hw  xK>K?K?K? @O?k?ok? k?k?k?! 7CKZk?14^4" 4H}7k?C 47?^@!K? k?C C 7k?K?Bv?7?Hx7 wB@ 44z^ @!7^qHz`HyK?1A 4Hw  C H@CF 0@K?1A4Ht6 gHuB ?4zK?1A(4(4Ƞ4Ԡ44K>K?!K?K?K? @O?Ku>Ks>  k?k?ok>k>k>k>k>k>k>k>k>k>67D7&@7k>4 4 4 0@HPӀ_HXӇӀ_'AP7?9A@7?QHB4H#z6 ^4 H |@r44K>YK>K>K>K>K>K>K>K>K>K>@O>H A7?9 c5I?7m$k>7z$k>4 4 5,A7?QHCW 4 7 HCw"k?44k?47?9_7?Q#7K?9< Ap7?9"4 @ZJ^ !4"744_ 7?9PK?944@7?Q"877?9A7?QK?9K?A ? 848@ 4 `2Hǵ K>@K>A07?9}5)?K?9 ^ 4 7Ƞ4B4?67?0 Ƞ4 ` g?1_7?1HC74 7 H7 <@4=H7 ^ Q4 H }'HȠ-@4K?9K?A ? 848K>@ 4 zH߿7y$_7y$@ 7?9HX!)59@7?97?9@7?QK> "4z@l7?9h@HbHfF 2HЀ߿7y$Ѐ_7y$@<7?94zA7?9@t7?Q@d7?94KA@776q S`_ˀ7?5KT6WB ]ǽK=46B S \6? dz_60V0=4@k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7D7&k>@7?1@7? @K>7b%k>7m%k>!I44447i6q5J!i4 4 44T4LHB?7? 4? Q 4*?HHC6?QB4 w)4 )4)K>4@ 47`04@? @|K>K? K? R#I7Y@DK>K>@7? @|7? @@\7? )`04 4|6 HǴ@5y p@7? `04?6 5y@7? `046 K? K? H@C ( *5y@@7? 5yP@7? 5y@7? HCM *444^7? 7HC 7 5y@,7? 6 7>_ 4 K>H@@"4=WK? hK>H 7?!Mk?!6 K? K?_ H@C ( *5y@@d7? 5yP@7? 44@ \7?  (@HC (0 Ƞ@&J;U@7E 6 045yP@D7? HCS 84HǼ K>@K>@$7? HC? ? ]ǽ@^4 k>]HK>@ Ƞ@H@l7? HK> X 4 4! 7?Y4_47?Y@7? 5y@@7? @HC4 4 4? *^H6 7H7 4CS!Ƞ5@ k?@7?qk?444^7?q8e7K?qK?y 8@7? @T7?q5y@ Bk?444_ 7? >=7Ƞ-@"44@<7?  HC Ƞ@7 HӠߒ 0/K? K?_ 5y@D7? ^y6:7@7? 6 HbK? K?Q 5y@7? HB^!:7@7? H6% k?K>44_ 4ȼU@7 7>_ 4 K>H(vGHȠxK>7 ]-4 87H H`]4 4K>@@@7? 44|K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>H " @dK>@K>@D4̢K? Ku>Ks> k?k?ok>k>k>k>k>k>k>k>k>k>k>k>7G7&k?977?A44@ 44 !I4 4 4 44HC ( 8""#B#Hh@HHz_ 5Y@4zHB]Ӛ7@|4zH6 4^ U4c?%]eH4H   47?9_}4K?94 ^94HhHo 4@ T4z4z@ <44K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>4k?4k?44^7?A74z@ ,7?A?47 HyHt 5Y@ 4z5Y@ 4z7 HxHsx 5Y@ 4z5Y@ 4zb7 HwH} 5Y@ D4z5Y @ ,4z@4< HC:@4? )4<h @47 HuHi5 "6@ t4z"i6y@@ T4z47 HtHh #7@4z#I7YP@4z47 H|Hk| #)79@4z# 7p@d4z%47 HaHl, "6@ 4z#7@4z47 HvHjV !5@4z!5@t4z547 HuHf !i5y@4z!I5Y@4z̨47 HtHe !)59@4z! 5@4z̪E47 HyHv  4@,4z 4@ 4z̪47 HzH|\  4@4z I4Y@4z̬U47 HsHbS  )49@<4z#7@4z̬47 H}Ha= "6@4z"6@4z̬e47 Bt76q X_ȀH4 4C.77?!7" @X 8p47?!HB  6yH6` C9 ?HHA 4Ƞ47?!  H6M ] uHH@ p47@7?q44^7?q @K?qK?y ? 8484@ 5H}Hb] !5@4z4z@7?q@4@D7?qȀu@k?ok? k?k?K747#k?!B 4 6 a@7404 *4 K?!@4 Hb4_ C7e6q _ǿ@׀4K>K?K?K? @O?4 ˀK>"K?!@D60Hf4ςu ǿp@4&HzC_7y:c:@K?!Hy78 xC Sdz_@ # K?!@x7PςK>k?ok? k?K?7#4k?!C7D *4K>K?K? @O?7 s] 4z`7ˀK>#I7Y@K?!A4k?)Hy7]4K?) E ]eH 8k?1K?!@7]K?1(H}HyK?!@H4H}  t]yK?)ςK>k?ok? k?KW4Z7Ck?!B jc:K?!@7y:Hv6 aHuB7d6q _ǿ@:ˀK>4V?Hu6 |ǿp@4%HzC_7y:c:@HK?!Hy78 xC Sdz_@4K>K?K? @O?k?ok? k?k?k?!k?)44HC!7 ]E4A8h|@"HC!Z7 444z7CK(7%7@7H_-@Hy7? ph}ˀK>A 4h|@(7Hx4z_a4 ˀ(K>@44K>K?)K?!K?K?K? @O?ˀK>Hz@?@@x@-HxHy@84H 4z@5ς5K>k?ok? k?7CKZ7@ k?!Hx@HH`b *4htHA @40 | WhwHHzA  |A4K?!77]4 `H@7hy@H} K>K?K? @O?k?ok? k?K_077Ck?!KX @b *4 hs0A4(0 | Whw0HzAh |A4K?!77]4 H 7hy Hz _ K>K?K? @O?k?o7CKZ(H8@b *4 h}8A4(0 | Yhy8HzA0 |H|(7h(Hx  K?Y@O?k?ok? k?k?7D7k?!6A7K?!77]4f H K>K?K?K? @O?k?ok?KW 7C@jH6?hd   *]9@Hw HHw _6?Hw(@jH6?hd(  *]@H  HHw(_6?K?YK?@O?k?ok?KW@7C@jH6?hd@  *]@H HHw@_6?K?YK?@O?k?ok? k?k?k?!k?)k?1k?9k?AKG7C7$k?Q4X4!i5y@@7HA !IK?Q@5Y@HC4(0 4ʊ HvcZ4!)4 4 ("B7 C *7?_14 ˀK>k?H@ ^_Hy@4c]4k?CH^ޟ ^_K?7?k?K?cHs@czHx`K?4A?Ak?HyK?:  0k?Hs@K?Q@597?4z_7?a"H}@K?Q@87?a@7?aHt_-4K?7? k?H "HuK?Q@594z4_7?a" HtK?Q@`7?a@ 7?a4HC(0 <@Hx\@HC4ʈ" b7 HwB #)K?Q@ 790# K?Q@ 7`Hz#K?Q@ p7P4K>K?AK?9K?1K?)K?!K?K?K? @O?ˀK>7?_4<7HˀmK>ˀ]K>ˀMK>ˀ=K>k?ok? k?KD7Ck@H7hwHe_}h`k?!Hz@ @@ `@hdHy78?hxK?!heK>K?K? @O?k?ok? k?k?k?!k?)k?17%K977D6 7@ 4z4@ 84zHz@4 Hs:@4 "444^4wH^ޟ ^_J Hz]4p&0@Hz]i4&zHeH `ZC4ދ BC49 *C7z:]A!@HbHz B *`R 4]4 *HhA 7z:]9#HC4%@C%C4ފ C4$8$C7x6q UǕĪC ZǚĐ@C"J447g%! D] 0@Hb 4Y]}4%Z4?@K>HsH ` 74]4 +447h%!HxHz X E  ]6?< *H  7]u58#4?}@K>447g%!H|Hh D  ] 6? *Hy 79]5#B4?}@8K>4‹"C " 447g%! D] 9 0@Ha 49] 4#J4?@K>Hg4 k?7?4_I7?i!0@@4z4@4z4z@7?i@(7?iK>7k?7?4_7?i @@P4z# 7@H4z4z@7?i@7?i0K>HP7hP@4zK>K?1K?)K?!K?K?K? @O?HX4EhX@`4zK>@@4z4@@4z7f%) @ 4z4 @4zK>@4z#7@4z7v%) @4zK>@p4z!)59@h4z7u%) @H4z]K>@4z! 5@4z7t%) @4zK>k?ok?7CKZ `7$`@4@@4 |  | dK?YK?@O?HwH _K?Y _k? $  Y@@7?@ @K?@ @k?ok? k?k?k?!k?)CB77$#7W7x4q444Z44^4\` _#Z J4~V#4T%jc@ V#"ςpK>@%`߿ ($% @?%B60B4 6046B64A`_ (@B6` @%4%Bc6 `$] jB ZB`_ (6B6 $` B6cĂ B6 ( r4~4^4T @!# @#B6 ( E84!4ˀK>قb :@$B@6 86b?@ ZςK>@ @Bc6 c@ "B4@<]6@#Zǃ 4^#R4K>K?)K?!K?K?K? @O?@!R`!R`߿ (7$ "`/B@??BςUK>6?k?1`_ (@B@7y4q`&  @7g4q4 `  *4xK?1__%4 4@?@ςeK>ςUK>ςEK>ς5K>ǣoB@4\ςK>ˀK>ςK>ς}K>ςmK>ς]K>ςMK>7@*c  @7%|@b:/4AςK>ˀK>ˀK>CW 07\ *7C?@4@k?ok?k?4?KwKxKy: h x W W  araX4 P6? D X Ҥ `6 e4c_7`@ V   ֠ 476 m7 ` aH4P6? X ҃7 @67 D_4B`@ X  v 7ր 4\6 m7 7@ } Ku:Ka5kuK| kbK?YK?K?@O?Ku=AKs=I k?k?ok?4$k`Ky:ky77z,_}kyk|@4Z 4bHkz4V b(k`0k`0k}4|K?YK?@O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K>4'k`:K:7Hk?K>7$7k? 6 4%Kt: J4 0kj:45_474k|:K 4#C!0@K:Km hkKn hkKo%KbKwW%% @_4K: 8kkhkh:K:Ƀ& B4ZU&B&6 (4 0Z4 kv #*K}: 4 ZB :K?"B _4"KmA4 44 84 ?4z "5A ?5I:4!51Ky\% - BKJ:\ !Z@0 6*61 J:@?}6*ku: 6 kp:kjAW 24z "5JAW ?5JI:* 4 Ky\ * BKwI:\ )`05+5) I:@?}5 6 46* #:@#K?@&Kq: B &rKrB__4&BKa49ky4@+j_}5YKC@0Ka:4,@0kl:Ƀ&4 t&C4= C4vS'"C,C+C+k:Ku:6 kj: (kK:ɉ@z C4Z C J7`8k: C?7C ?7k:K:" \6 :WK:Ks:6k:KwKx ( 8_4khKKw (k:̟4Km0̟7kr: 4hkq:Kh: BK|:Ka? I H4:@4Y \@\ uKzKd k}k`:Kd:44~kp:Kv:6k:A! IW 50kf:Km: !7? CKa?l 84:@# HIW\7 @@IWk? ) 49 PCH\\ KzKb ksICkc:h4~ "@7kb: kh:\ KzKeK? k}K? I_ID  44Kz: :7?Ka? H" 4:@\I6 \ KzKx kxIZkz:@0tt4~4Kq: Kl: Ka?4:@C 2" HKw\y6@+Krk?" 6@CH\)k`:K:7kz:7e,ke4~Kg: zKqKa? 84:@! H5\5W(+! H5\Y5Wkj:X4~C4 44 04 k:K|:7kj:_=kjK:ɋ57Kp: 8@Ka?" H4:@6\y5Wkj:@ 8t4~`4545+ +Kf: :Kv:Ka?"i H4:@\ 6yP\5KzKa ku4~Kr:6Yky:ɀ "AS I 5Iki:Ke: 8@Ka?#) HIw4:@\ 79\UKzKx ki4~ 0@K:ɉA*7ka: kj:\KzKd ksK? K? @ -IId  44K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ko: :7?Ka? H# 4:@\ 7 \}KzKn kl@0tt4~4k`4k`:k` "k:Kt:6ki:K:ɉ Ky: 8@Ka?! H4:@5\ 5Wkj:@ 8 t4 ~k`d7kn: km:k?7K?k?_ Ek?K?Y@7?@ @K?@ @7F44_774666x77Y7!4=74 44477w4474 b6b:b8b<b>b@@6 @P@K?@ @Ku;aKs;i k?k?o_4 (744|K?Y@O?_m4 | 274  w\ !4z`u4|@ @K?@ @k?ok?k?k?4@4744z  | f7C 04Hw7$Ԁ2_4?gHy@7HsHz d  thu7K?YK?K?K?@O?_e4 7Hv7H}m |@ @K?@ @k?ok?7CKZ@ \KD?4\4zK?YK?@O?@ @K?@ @k?ok? k?k?k?!k?)KE7C7$ 4H 44H?H H!2Hz 4KH r F84\9@54?}@]H\@]HK_\@507G5?/KH d04 g4 sHHz \!KE?4 dH @HH@?@ g4 vK>K?)K?!K?K?K? @O?@ @K?@ @k?7Kv k?7\)K?K?Y@7?Ku>qKs>y k?k?7K: kz:_4k|:K?Y@7?k?oKs: (7C_E4Kz:( \_4+4=P k?Kx:Ka?k?C4:@ 7w,#)02@7w,[}79_-4K>@O?k?ok?7C@04_4z 7_4z4K?YK?@O?KuKs> k?k?o_k? 077cK?#07\4zK?Y4|@O?k?/,/-/.ok?97C4@"(k?@"K?BP4Z":cr@x4"06.`7?a \ &00N8E&E_7?aa"#I07T. . 7?aK? ''001n0N 1A 'I9 @B7`!7?a$'('(08G'0G0N9E'8E0 8_7?a4K>K?9O?1/0./0-@/0,7:B04` K|:ˀK>}K|:mK|:k?ok?_4(70`"K?B4z04K?Y4|@O?k?o@ [uKC `?4zK?Y@O?k?ok?7DKZ7#K]KS } `@K_77? ҕu B 4@ P4HK_4xKVB `  H4ˀ K?YK|:?HK?YK?@O?K|:?@k?o7C_4 7 K|:Hwk 4 K?Y@O?K\K @_K_@KK_@K_K @kK_KK  P4@ K6? \0@4@KWJJ@  k?ok? k?7DH7k?!4Bk?)!@7HK4KK?) B pK?!!@H H? J@@ _h H(7_ h( HH(6 h4H( @Dԃ DK>K?K? @O?K|:A4K|:H(4h 7A4eK|: `BKW7`2KZ( Y CӳK@ˀ@k?7_ 4 0K?Y@7?k?o7CKZ@ _@[]4zK?Y@O?K_ KW0Y j Y@k 0K\K ??@@4@K_0?@kY0k?ok?7CKZ0Y 07$K__h0Hz0D?@K?YK?@O?@K\0k?ok?7D_ 4@ 0744|K?YK?@O? d44h d ` `Ah`0 h|8`}4|Hw _ ڋ?Mh|(A,Hz8`54|k?ok?7CKZ0@ _KD?4Hx7?`2H( A4?@[%Hz(_}HzALHz8[4zK?YK?@O?Ku=Ks=  k?k?oK_7#C 7ˀHk]Ks: "0_]6k|:Ky:#K|:K?Y@O?k?74_-k? BK?_ 4 @@(K?04K?Y@7?k?o_E7Ck?Hw4HzC_JJ 8  k?i4 r@4z "@K>AX4z 4z_K?4K>@O?7?a@4z?@H|C?4z4?w4zK?a??47?iA4z?M@%4zk?ok? k?7D_7#k?!H44@_ Pk?I4 b4"4@4y"K>A 4"x `HC@0C4!(@H76hK_KW"060A "47?I@4!4H@94  0@K?!4_=4!X@A4!:K?I04 }4A4y?GHK> `7?I@4 @HC<4 p@K?!4_54 P@A4 2K?Iz04 z@ `4K>K?K? @O?K|:?@7?Ik?ok? k?7Ck?!_%4!7Hd@4䃟 4? 4_!:AD40!74z@4HzKW4@KTA  z4HzK_4KSA  !*H_m4zA4P4Ke:?HzH_4zA4 jK?!@4z H74z_U47044Ke:4K>K?K? @O?Ke:k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>7C_=7$k?aHt4k?B4&44`4 4 4 4 !0444p4r@4z"B HsBu "HK?_}4z!HtB@!:_(k?a HQ@* ?H@R @ (K!" HzK_5KYA ?  ˀJG!A 4z!"K?a04 4K>7?a4zA`4 ‚K>HtuHs )04<@K|:?@pK>YO?@AT4z?u@0K>Y@0#0@ 7K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>k?7KB4`@_ @4r`@`@ bhK>4 4! 8?@@04K>@7?4Š44_g44Ƌ :K_C0C4074@7??E@54# 07k?o7C47?@4 @K? #)0p7<pHx8@4z H@HzK_KWHx8A  44K>@O?K|:?@4KuK? @O?K?K?4@HK?!HK?_ 4 |A4ˀ}K>k?ok? k?k?k?!k?)k?177D k?A4H! JHC4܋: *7hK?AAd4Z!4`4H444 rHCH @" @H h 7hCAK?A?HK|:"06K>K?1K?)K?!K?K?K? @O?K|:ˀK>k?ok? k?7D77%A74zA4!r@ZHC!b7hC9Ad4z!BHKv )04: k?![HdK?!74[7 r C4\ 4 4Hw 2C4 #07@A4z4K>K?K? @O?K|: I04\K|:k?ok? k?KW67kVB6kBB47D7w,и"H64`xB24rb"HKA#07 @KSA a "4_40 `K>ق#@#"ӽc4 7?A \$A00N8E$IE IR\7Ӆ ] HB3Bց ?-֝ ӵ?@ Hg?HKA"06 `K_At !4HKVKYHA4 6 !p4Hˀ a4 8 B"06].K|:=@K>HK\"06 @K]At  `44@\@0 `K>K?K? @O?K|:?@4K|:?@]HK|:?u@uHg? I0E4\ k?ok?k?7DAX44 87Ke:4K?YK?K?@O?444_4yKa!@HK_"06 KYA\ ? 0Ke: HKW4xKTA  4HKS4K\A  (@AP4z4Ƞ4Ke:4zA@?@e4Ke:?4z=Hk?ok? k?7CA044 x7Ke:4K>K?K? @O?Ke:! A(4?4(4444z_=4K?@HzKW )048 KTA 0Ke:?=@HzK]4K\A >+4HzK_4XKSA  A44_4z ȼM4A@4 k?!Ke:444z_7Kx @HzKVKDK?!A  4HzKC4KWAt  (@AK?!4Ƞ54Ke:K?!A@?@4Ke:?K?!=Hzk?oK_4C h7C4Ћ7 7hz_4z z4z_4 RXK?Y7h}_4z "4z_q404K?Y@O?"i06| k?ok> k>K_47CC"7hz4_4z%7HzKY# 070K]A %r47>i_=4z%74K},7hsHz#0KTKE A 7Ѐ,44z_I@$x7@4z$X7_4zk>!A4#(7444z_e44_ 4z 7@@4z7"@Hz"i0K_6xKSA  "4HzKYK]K>!A *Ƞ`K>!47*7hCҕ6?{4?#I07U Ke:"RA4"z4Ke:"b4zKe:"B4zKe:""4zKe:"4zKe:!4zKe:!x4zKe:!4zKe:!h4zKe:!b4zKe:!BX4zKe:!"4zKe:!@4zAK>!Ke:Ke:=oHzK>!A@Kt=@HzKV4@KUA =+4HzKU4KTA A444K=K>K> @O>Ke:?4u7>i7hbHz )0KUK_ A48`<@44z@@?%747hdHz I0KVKW 4XA0@<_+44z@@>7u4Hz7hw#0KBK] A7;+44z@x@=747hxHz"0KDKS d A6;o+44z@@=U7E4Hz7he 0K\KX  Ah4:+44z@H@<747hHz 0KAKY ! A4 :}@44z@@<%74Hz7h| 0KAKX  A84@:@44z_@;74_4z;e7HzKT4pK_A 9+44z_i@:747hvHz 0K\KW A49+44z_@:]74_i4z:57HzKS4pKEAp 8+44z_9@9747haHz 0KBKY " A48'+44z_@9-7_4z9 7HzK]4pKDAH 7+44z_@874Ke:844zKe:#0=7 "i0%6e`k?ok?K_47CC!7hvB?4bcz4fCh@HzK\KAHx8A H< #@4H7hyKxCЗ"6?HzKW# 07@K]AP "4HzK]7a1KT $ A "4HzKU4KVA "ˀ44#7huBӟ4`b4dBrHzKU4KBU A`@"H4HzKVK\Hx8A X "04Hd4hxKw@_ 7?HzK_"06KYA ` ? !4HzKY7b1aKS D A  y !4HzKT4KUA !44K?YK?@O? 04K|:?@HK|:?@HzK|:?e@%HzK|:?=@-4 I04\PK|:>@HzK|:>@HdK|:>@HzK|:>@5HzK|:>]@M4 i054|`k?ok? k?k?k?!KW47Ck?1B7%"44?!4_#:4%4! @@4z 87HyK34K=  44K>K?!K?K?K? @O?Kg:?4HKg:?4 HKg:?g44z4z@H4?%7?44Kg:#@HH4X   A84?@46h|4z_e4>]7HzHA X4T>o+4H4 4K?1_4z=746ha4z_4=7HzHA 4L=+4H45 6hv^U4z= 7@4z<7^4zHzC_4 (7K?14z_44 "4z@x4@@84z h7^U4z H@HzK_4@KUA  Kg:HaH4H?  <@#0HzHAP7<_+4HzHA4 H@HH4X   @t44Kg:HvJ# 07J  HzK]KWAP :+44z@ 4:-7H4_ k?ok> k>k>^m7Ck>!Hx4z4C_k>k>)4``з4r@4 4"j7>@4z"(74@$407^4z"k>14z@ P4HzK_4KU@ $H9^u4z@44HzKY4@KBY A8@$44?^4z_4z#7K>1^4zK>K>!^]4z#P7(4zHzKT"06K_A( $4H|7h_4z"7??K>4z4‚@J4`:4䀶 *@4z"P7Ȁ(4z6?4? 04 +Kf:#I07F4@4z>74@04z!7Hb@Z4U>@K>K>!^54z!(7@4z>M74He@@0@` 4r@ 4!7>@4z x7Ha@94 *@4z=}70444z^K>)44K=K>K>K> @O>Kf:?4HvKf:?4X4zKf:H9^4z@4??4HzKf:?454?@ 4z>7H|4;@Ȁ4zK>!7>_4z>}7ȀU4zKf:>_4UH|HzKS#070KF@, >7+4Hv6hf_4z=7@He4hw_ Y4z=u7HzK]4@KE@ =+44z_E@=77#)07&Pk?oKW7CB4X x4‚@ 4@ I04\K?Y@O?K|: @K?Y@O?6h|_ 4z04K?Y@O?7}.  " )0K?Y4<@O?HzK_KY@ ? ?+4HsK?Y6tˀhtk?ok? k?k?k?!k?)k?1KT7C7$B4 04@4H4 44P@4!Hs6aha@?! b HaH6? !4@@<4!hK|:Ha"H7? !4@@4 K|:@4K>K?1K?)K?!K?K?K? @O?H^4H7? >_44@@4>?4PEK|:5K|:44p@4>HsK|:44@4=HsK|:k?o7Ck?^4!HtB4: rK} H@HzK_# 07KW@  p4Hs6uhuK?@p4z J4z^404 K?YK|:?HsK?Y@O?k?ok? k?k?k?!k?)k?1k?9k?Ak?I7DKZ(4?KAKF7% @4P!z4 HC"4" 4'4!)04 @!^ 54 4 _4!@^ u4Ka7I7? U!4@@l50Kk:75|K>K?IK?AK?9K?1K?)K?!K?K?K? @O?Kk:`?5|mH|m5|IH 5@   H!"7hHC 4c>@HKB4RKH  @ @!J4 !b!I0u5K4 8@HH@5>@Kk:@ 5`?H5|`:HK_58K]@  :4 4_ @>}7}5|Kk:`?4U5|Kk:`>@-5|` !)0`05+5|k?7^@04K?Y@7?k?ok?k?k?7%7D^E44!4HC]Ӻ4 pӿ4`A4ra @ L4!7444_4y7! !j!"`# 044K?YK?K?K?@O?Kf:?@@Kf:?u@(H^U4 @@4 p@^474^]4ܞ@ܞ4Kf:ܞ4ܞ4_ U4>}7 P@HK_"06PKS@   Kf:HH=H? 6?= HKY4KE@ =+4`>@HKW4xKBW @ |@=+4HK\4KS@ |  @`K? @O?HzK_KY@d ?  4ˀK>K|:?@}K>k?ok? k?k?k?!k?)k?1^7C4 7K|:K>K?1K?)K?!K?K?K? @O? @HzKW4KT@ "ˀ4zH|8k?A@4 h|8%K|:4^4z>@4x^)4z>@4& 0444z^%@>@@H4z>m@^e4zHzK_77K]@  44^M59HuB>%@4|^ 4z=@Hb4AhaK?A@\Hz8he84z^M4ˀ]K>K|:>4z5K>K|:?4 K>k?ok? k?Kt7CK_ C4€@b4`RKe;6?? 4!z4ăD!4҃"4؂"HzKU4PK]@| #44z_-@"7HzKT4RKY@ 4 #Z44@@#Xk?)Ke:Ke: 4Ke: h4Ke:@K?!!:Ƞ84 04P7hb@_4` p@HzKS#)078pKW@ ?+4Hu6Ƞxhv4b? RHzK]# 07K_@$ >+ȠHu i04e4K>K?K? @O?7h|@4k?!444z^m7 H7HzK_KVK?!@  ȠKe:4 d8 HzKWИKU@ =o+@HK?!m4Ke:>4M4zKe:>w44444z^7 x7HzKAKBK?)A @H@ (@@XK?)4Ƞ4Ke:@(K?)?@4k?oK_4C!7C4 Z7hC4 j7h}^4z b(K?Y_4z04K?Y@O?_E4z?@4z^ 4?@47hs@H4z?e@4z^4?=@-4k?ok? K_47CC 4"@4z!744^q4z"7?94^4z"h@^4zk?K?9BP@HzK_4PKV@ 0Kd:"@_4z7!@HzK]4RKY@H = !4HzKYKWK?@@ #@@PK?h44>_4@4z2D44K>K? @O?Kd:?404zKd:?4xK?9Kd:?44z4=4?C4Ȝ%4Ȝ4Kd:>]@@K?>4HzKT4PKU@@ >+44z_@>e7HzKS4RKT@ >w+4K?9&>4HzKU 04K]@0 >7+44z_=@=7HzK_4RKC@  ȀE4EKd:Kd:='4 4k?o7C^4拀 4^4z @_4z p@HzK_# 07KW@  @44z^@04K?Y@O?K|:?@4zk?oK_4C 7C_ 4z BHK?Y_4z "4z^q404K?Y@O?47 Z7hsBz4?m@^4z?@]4z"0e6`k?ok>k>7$7C^4!He@4 Z4?k?K?4Y4z^Y4'(7#)07<4`` 4r@4b"4B47?4H^4z?5@K>YK>K>@O>K|:?@4K|:?@4K|:?u@ 4K|:?M@04`K|:?%@4`K|:>@4K|:>@04 K|:>@@4K|:>@4K|:>]@4pK|:>5@Hd7??4?#I07_8 `4HzKU#07KA@`5 ?U@ˀHHdHzKT 04KU@ =o+44 4HzKS 040KT@ ='+44 `4`HzK 0KVKW 8 @4<+44*@4<+44` HzKx 0KAKY @ ! @h4@YHzK\KW@ p  844z^404 K>YK|:?4zK>Yk?o7C^!4!@^A4z!b4^4z!@@HzKY"06K]@ !4HC4V HzK_"06 KS@ x   44H|7ha@4z JPK>7?^4z "4z@x404K>@O?K|:?@HK|:?@4k?oK_4C!7C7haKt BHzKW#07@KV@ "4HuB4`?@4r_`47?i4^4z!K} "K?iHy]6!ZK|!@@HzK]4KC@ (}  jˀ4Ks`?@HzK_4bKU@  ˀE+`K|: K>و jKv ZHzKS# 07PKBS @ @ ˀ K|:04K>@O?K|:?@HuK|:?@=+`k?ok?7CZ!k?A2@4!@w4!^a4z 7Kd:^4z 7^14z4^ 4z X7^94zk?K?@@7 hKd:@K?^4z@4K?@4y Kd:@44K?YK?@O?k?7"0k?6`Z4 P4K?Y@7?H? @@K?ˀK?Y@04k?K?_m7?+@K?]K?YKa?# 04:@Y7pYm@K?Yk?ok?7$ 047C]%4 d74  `K?YK?@O?k?7k?]4k?K?_%7K?YK?@7?k?o7CYKZY4zK?Y@O?k?7K_k?Y=@K?YK?@7?k?oK_777C`7 Y7@  y]Hz |K?Y4|@O?K_@@k?ok?7CY H7$H_4z B4K?YK?@O?Y}@HHzZQHHς k?ok?7C7:Z k?74z_-7 "4K?YK?@O?HzZK?ς dk?ok?k?7C7X @7%HH  _m4z *ˀK?YY@HHwA`@ "_P4_?HvH 7   _6?` H|H w <  6?7?HtH    U7?77?HzH  z X HsH S y  4HwH Z HHHt 4hsK?YK?K?@O?k?ok? k?7C7%k?!Z7Hu7 _4z0ˀHwA2 }P7?Hb W   B  9_6?` Hsw   VHt6?   !7?H}   Hs6? D z   \=7W?HvK?! Z4H| ha4K>K?K? @O?k?ok?k?KU7$7C7_60ˀzHwA2 }P7?Hb W 6 B  9_6?` Hsw 6 VHt6?7  !7?H} 6 Hs6?7Tz   \=7W?Hv  4Ha4"hbK?YK?K?@O?k?ok?7C7:Zik?Hx7  _4z "4K?YK?@O?HHw ZK?Hy $ ςhzk?ok?KT7$7C_60ˀbHwHy 4Hs6Hz _ H}7huK?YK?@O?k?ok?k?k?77C7&` H x` Y @4z_40ˀ4?AZY?P7??HHz  W  Y \_6?` HH}  t 6? HHv 7?  " E 7X?HHa:   } 7?HH|  Hs d 4 dK?YK?K?K?@O?k?7@@K?Y@7?@ @K?@ @k?7@@K?Y@7?k?7@0@K?Y@7?k?ok? k?k?k?!7D@"7%@"Kc @4&HyZ4 bHc`?Hy" ZHyZ4#j( 4$ 4Zy4 āHz]4"@7Ye47]4 |"74ZQ4( 4' 4Z4 gY47]4!`744Z4Hz @Y@ fY=47]4 | 74Z)4K (@KZ4@@K 0kcˀ0K>`u@ ( 4< H|ˀK>ˀK>ˀK>ˀK>KeH jKZ4`H@HH (@KZY4_@H x H|K>K?!K?K?K? @O? _ : W ]  SV@ \CT x4@ӿ< 77Z<  @?@@Ku=1Ks=9 k?k?o7hd>he>hf>hg>hh>hi>hj>hk>hl>hm>hn>Ka?H&7$7H7 %4%0Kh;Kj %IYZ5 eIJ@?IY@%zIG@4^"!@Y475s4 K?K?g~4` k?k?77h_5 @H4 D 4`5@ K?K?~  k?k?77h_]5 H?w5@$4Ym4!j5y @ 07IY@ 7@ 5:75:@ 77Y5z7Y5 5 K?K?~4`  k?k?5y7@ @7!j5y @ 77@ 55y @ 7Y5:7K?K?~4`  k?k?A774 tp4 `55775)76 7,?5y 0Y5!5y @Y5!45@ H5X 75@4!I  @5 @x4!X@ ?5!2A7 ("5)A7 ?5)>E@  ˀ84~4 !M5 h44~Hb>YHn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>˄}hmhk?ok? k?k?k?!k?)KG7C k?1@4zHc`#Hh( H0"jHf$4HsHw d Hg$XH: GY}K?1DRĄX@H}7G? ܋ #D!HHt( Hu0 刀 6# @#*Hx7G? Ջ#D?Ht(Hh  Hh#Jz HYeK?1?-HHa Hy' Hc "Hx C HwH Hh!J HYK?1>HHb H}G Hc!H C YK?1K?1_7Hs(76yHt76y?Hb07 E 7@=Hyˀ8K>Hx Hc!H CK>K?)K?!K?K?K? @O?ˀK>_M@\E@_-@\@_ @\ H _@\E@_@\Hˀ K>_@\H_}@\ H _]@\@_=@\ G @4ś7 Ş'H| ˀMK>_@\% C L҇L HzH ZD:D  "@6 P# @7 p#*@7< #J@7\ #@7 "j@6| #@7"@6k?o jk?\4z  C @\4z C `@\K? C 0@\m4z@ C04| 0K?Y@O?C8X7? (7W6 ?7@6?k?ok? k?k?@ 7E@ 8Kc;( 4$ 4Y4 @( 4$ `kd;Y47] 1k?! 7K?!4Y4kf; Y4zK|;K>K?K?K? @O?k?ok>k>k>7#7Yk>k?K>4k?7z7k>k?k?k?yk?qk?ik?ak?Y@k?Q!7@ @4z X7Y=47]4"`74z4Y-4k?Y7?7? k?7?7?!k?7?7>k?7>7>k?y4z@k?K>Y]7K>k?47k?QK>4k?K?k?K? k?K>k?yK?k?qK?k?iK?!k?aK>@K>! 7Ƞ4H @@4H H 4 `4 KX @@ J 4c ? ``4@44K>YK>K>K>@O>H @@4H jH  X4 K_ @x@ K:@  ?4?4Y!4z4 _ : W ]  SV@ \KuaKs>i k?k?ok> k>k>k>!7D4@KZ@" _4"p77>_4 K>48bb@]K>7" K>4g44_4!@ _ _4H B4% # 7 *!]Y48 !H7 H(4 !hHz"H!hHz H!hHzH C   !`Hz H C h !XHz(h(H!XHz0 Ch0Kg;!40kw;!_4K=_4K=K>!K>K>K> @O>Y 4zK=_@\}@_u@\ _U@\H_5@\H_@\h(_@\ C Y 4zY 4 Kuk?q4K>K?!K?K?K? @O?k?Ky7?q_4>K;AKKu;qKs;y k?Ku=qKs=y k?Ku k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=64 k>4K=ak>K=iY k>K>K=q K=yK=K=CCK=4xk>cC 4yk>ǃC 4 `_#ªY 57J (@Y5!e6 J?@R4K=Y Y y56O \ 7#7K>K>5Y]4^K>K>4t_%566? 6@ 4CC*cCZǃCq> #ǣCr@$"K>7@ P5J>M@$jK=Q`$ZK>_K>7_4z@7>p֟t&a&i8G&qFq \ 4:(#7P64ǣ@ 4@ `4 @47`4 4eK=YY 5zM7Y 5ZU7Y 5:]7Y 4%7Y a457Y A45746K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>47@X5ycܥ@4\7@ 5Yǃq>4\7@59Eq>z?@ V47@5ǣr4V7@`4r4X77@4`47@4eK=QX=56K>_K> 4 @K> @K> (K>J I K>K>_]4 0o4oAj6 o!:4  40 ! Ǐ@K>K>_=4 7k?Y6Zk?K>76Yk?5k?k?yk?qk?ik?ak?Y_k?Q - K>6X_uK>5?575?~@6 M Ku<Ks< k?Ku>!Ks>) k?KuK?1K?)K?!K?K?K? @O?_@H_@H!*59@H4ܞ=@_u@m@_@C8X7? (7W6 ?7@6?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK>76K>7I4K>4 K> K>y ` @ :C_ 4 4 r4V_ b4X R5)A? 8 (@ ( _8 ?5)K:: Y!4K?IK?AK?9K?1K?)K?!K?K?K? @O?? crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)? crt0: errno: tsdbasenamesdemangleexefunctionstargethelpversionUsage: %s [-CfsHV] [-b bfdname] [--target=bfdname] [-e executable] [--exe=executable] [--demangle[=style]] [--basenames] [--functions] [addr addr ...] Report bugs to %s ?? ??:0 %s %s:%u %s: can not get addresses from archivebinutils/opt/binutils/share/localeb:Ce:sfHVunknown demangling style `%s'addr2linea.out%s: %s: %s %s: %s %s: hppa2.0n-hp-hpux11.00can't set BFD default target to `%s': %s%s: Matching formats: %sSupported targets:%s: supported targets: %.12s %.4s%s %ld/%ld %6ld %s %s /%s: bad number: %s2.11.2GNU %s %s Copyright 1997, 98, 99, 2000, 2001 Free Software Foundation, Inc. This program is free software; you may redistribute it under the terms of the GNU General Public License. This program has absolutely no warranty. ? SQQQQQQQQQQSSSSSSSSQxPSSQSSSSPXPSSSSPSPSSPSSSSSSSSS0SSSSSSSSSSSSSSSSSSSSRHP`d```@```````D```````````````````````````````  TD((dnw newdl deletenewdeletevn new []vd delete []as=ne!=eq==ge>=gt>le<=lt<plus+plapl+=minus-miami-=mult*mlamu*=amlconvertnegatetrunc_mod%mdamd%=trunc_div/dvadv/=truth_andif&&aatruth_orif||ootruth_not!ntpostincrement++pppostdecrement--mmbit_ior|oraor|=bit_xor^eraer^=bit_and&adaad&=bit_not~cocall()clalshift<<lsals<<=arshift>>rsars>>=component->ptrfindirectmethod_call->()addrarray[]vccompound, cmcond?:cnmax>?mxmin*szsizeof autoAutomatic selection based on executablegnuGNU (g++) style demanglinglucidLucid (lcc) style demanglingarmARM style demanglinghpHP (aCC) style demanglingedgEDG style demanglinggnu-v3GNU (g++) V3 ABI-style demanglingjavaJava style demanglinggnatGNAT style demanglingconstvolatile__restrictconst volatileconst __restrictvolatile __restrictconst volatile __restrictoperator operatorassign_type_ada____<%s>global constructors keyed to global destructors keyed to import stub for statictemplate <class> class()%d.e'falsetrue0JArray1Z__pt____tm____ps____S,_GLOBAL_{anonymous}___imp____imp___std____sti___ virtual table0123456789Qt__thunk_virtual function thunk (delta:%d) for __t__vtbl__::[]unsignedsigned__complexvoidlong longlongintshortboolcharwchar_tlong doubledoublefloat%xint%u_t-2147483648U...__ct__dtT%d--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument %s%sCannot allocate %lu bytes after allocating %lu bytes undocumented error #%d???UUUUU\lllѨll\@llllllll lllllllllllllӼllllҌlllllllllllll$@@@@ޜ@@@P@h@@h@h@P@@@@@@@@@@@@@@@@@@@@@@@@@@@P$,d$$$$$$$$$$t$$$Allocation failed.Expected ?std::Unexpected end of name in .::Unexpected character in .Unexpected character in .Zero length in .Internal error.Unexpected end of name in ._GLOBAL_(anonymous namespace)aN&=aS=aa&&ad&ancl()cm,co~dV/=da delete[]de*dl deletedv/eO^=eo^eq==ge>=gt>ix[]lS<<=le<=ls<<lt<mI-=mL*=mi-mlmm--na new[]ne!=ngnt!nw newoR|=oo||or|pL+=pl+pm->*pp++pspt->qu?rM%=rS>>=rm%rs>>sz sizeofoperator operatorUnknown code in . [nv: [v:Unrecognized .guard variable for vtable for VTT for typeinfo for typeinfo fn for typeinfo name for java Class for non-virtual thunk to virtual thunkcovariant return thunkconstruction vtable for -in-Unrecognized .Error.in-chargenot-in-chargeallocatingin-charge deletingUnrecognized constructor.[Unrecognized destructor. [::*Non-pointer or -reference function type.complex imaginary Unexpected character in .signed charboolchardoublelong doublefloat__float128unsigned charintunsignedlongunsigned long__int128unsigned __int128shortunsigned shortvoidwchar_tlong longunsigned long long...Unrecognized code.Non-alphabetic code.restrictvolatileconst [extern "C"] , Missing function return type.Missing function parameter. () Template parameter outside of template.Template parameter number out of bounds.ibi iii ll ii i Unimplemented.falsetrueUnrecognized bool constant.:(stdstd::allocatorallocatorstd::basic_stringbasic_stringstd::stringstringstd::basic_string, std::allocator >std::istreamistreamstd::basic_istream >basic_istreamstd::ostreamostreamstd::basic_ostream >basic_ostreamstd::iostreamiostreamstd::basic_iostream >basic_iostreamUnrecognized .Substitution number out of range.string literal [# [#0]_ZMemory allocation failed. /opt/binutils/share/localemessages/.moCPOSIXLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_ALLLC_XXXLANGUAGELANG/locale.alias/opt/binutils/share/locale:.riso$%D@%H%TP%X%XX%\%x%|%%%%'`'d'd'h'h'l'l'p'p't''''''(d(h(t(x((**.8./,/0/4/8/T/X/t/x////////0004080T0X0t0x001d1h1t1x1133444t45 5$55556667@9 9:(:,:`:< << <=D=H=h=> >> >$>X>t>>>??|?@@@D@@AAAABtBxBBCCCDCHCCCCDDD$D(DdDhDDDDEEE E<EEEEFPFTFFGGIIKKKTKpLLMMNxN|NNOOU4 U8U< U@VVVVW WX XYYZZ[[^^b8b<ccelepeeiijjk$k(kDkHllmm qqqrs sx xxxz$z@{, {0~ ~ ~~< @l $ (  LP@D hl 8<DHx | ,004`dhl \`<X<@lpTp04l48d<XLP8txbb(,PT04@DLPX\lp$(TX|48 (|@D`dtx<@ĤĨ $4PŌŐƸƼǸǼ `d04tx̀̈́͌͐Ш ЬԀ Ԅx|PT H Lߌߐߤߨ  LPd h  PThldhDHhl(,@Dhl(,lp04TX,DH`d <                 ( , 4 8 @ D      |    8 <LPdhp t  \ `    $l % % 4x 5 5 6 *9 :d :| < =l >\ > @ @ A E$ E F KX V [ m q z( p @ X    p h  @      8  $       @ *$Revision: 92453-07 linker linker crt0.o B.11.06 981204 $/usr/lib/dld.slERROR: mmap failed for dldERROR: mmap failed for TSDbug-binutils@gnu.org??@ 2%Ps%`C%pe%xf%b%H%VstXXXXXX1p1x1111112228 2@2X@2`2222.::.::.::.::.:: type_info node type_info function.::.::.::.::-- -(-0-8- -@-0-H-P-X-`-p-x-----------------...... .(.0.8.@.8.H.P.X.P.`-.h..p................///// /(/ /0/@/H/@/P/`/h/`/p/x//x//////////////////000000 0(0 00080@0H0P0H0X0`0h0x00x00x0.8000/000000000111111 11(1018101@1H1P1X1`1hPOSIXLY_CORRECT: ;;;;;;;;;;<<<<< <(<0<8<@>>>> >(>>0>8>@>H>P>X>`>h>p>x>>>>@h@8@H@8@H@XAHAXA`AhApAAAAAAAAABBBB B(B8BP  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000@ :@ :(8$.$?8:pCFxG8V7E$LA%64x4[8A=l$X:|47(=6>qz(p6Fqd5KX mE:9P6989 9<9h>\6%5@"@"@"@" 5\=binutils/binutils-RUN/opt/binutils/bin/ar010075500000000000003000001700000732753200200172700ustar000300000000000000@!@XPP(G(L 4@!  92453-07B11.17;^ 92453-07B11.046g0@ X"LX tX!!!X 8#8#X 8X X X HxxX IHHX XHH(>(@`>(@<>( @P>(x@xh>(@t>(& @  >('@>((@>(P@$>(R@ Y L? 4@ $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$yl\/!  L  U<p(Ohů;A8v˚v)[8XDk'HVL "f/v'6!xy!xD!xry 4'Pנu R`aDg6mTL,שL''̃ !xT H(24/g6OXk )k\TX\T W!x )'6Y^]&hŒ'/\T+ 4gyhM5]YN?SMªAZAaxqV]ɘɘ 0U,Ҹ>>MȘM ƿ R[칽jEX9 Wmm ~?A˚v8vhů;An bRltD8rP.j>MȖM(K[   k@q@x@~@@@@U@U@ U@4U@U@UHUHUxUXU@UUUUU(U UK,U~UxUzU U!yU(!U(@U ZWUZ@U !(.4:AIQX_dkry #)39BIPY`gmty&;EOZhr(1?KZgy8<@DHL`x|/tmp/libtool-17615/ar/opt/binutils/lib/opt/binutils/lib/libbfd-2.11.2.sl/usr/lib/libm.2/usr/lib/libc.2_tepv_ktepverrno__ismt__dld_loc_hex_value_SYSTEM_ID_CPU_REVISION_FPU_MODEL_end_environ$RECOVER_END$RECOVER_START$UNWIND_END$UNWIND_START$ARGV__text_startfreadutimemallocwritefopenctimerenamestrrchrsprintfstrcpystrcmpreadstrchr_startcallocchowntolower_isdigitfclosefgetsbsearchfprintfexitopenunlinkrealloc_isalphafilenochmodstrcatfwriteqsortstrncmpvfprintfstrcasecmpgetcwd__filbufgetenvlstatsetlocalefstat_isspacefflushstrlen__flsbufprintfmktempfputcisattyatoiperror_isalnumfreestatclosesbrkabortmemcpystrerrorbfd_initbfd_set_formatbfd_fdopenrbfd_seekbfd_get_errorbfd_scan_vmabfd_check_format_matchesbfd_check_formatbfd_set_archive_headbfd_openwbfd_openrbfd_errmsgbfd_set_errorbfd_closebfd_openr_next_archived_filebfd_set_default_targetbfd_readxstrerrorxexitobjalloc_create_objalloc_allocobjalloc_freemainhex_initobjalloc_free_blockfnmatchdcgettextconcat__d_trapremove_outputprint_descrprint_contentsextract_filear_directory_doerar_addlib_doerxatexit_cleanupalias_compareerrno__ismt_ktepv_tepv__iobbfd_target_vector__SB_masks7!?9" : B*= @ Z ]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]` =@ :7]@ k? k?k?@@K?@ @Ku;!Ks;) k?#`87{7 kc.kx.A'y 4yEe'y7D7%767+4>#%P744445 bנZRke.1ke.9 (4Ц @Ц D(43 H?(ਃ 43 ` 7+4>7D7%7744z#-p74444@H@7D7%7#/07444Kx.A7D7%77Kv 24u74444##@7@@@@ 7K?@ @@@@k?7k?#Ek? 7Yk?4@4 @@K?K?7@4K? *@K? K? 7@@4K? rKa?H:@7?!#74@4@x7?!7?!7@4#%794@4Ka?@ xH:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 86p0.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?ok)4`@44` G>- ""46`_4K>9K>Qki *K>y4ߟ444K>IKa_k? k?54@844? 7 E4Y7z/_4h4k?4K>a5k?4@44?"H74@4Kk>7t.k>Kk>v k>Ks.1k>7g.!k>y 4 c?K?7}.9k>Ka?43k? Ka?44k?֠ k?Ka?45k?7vk?1+4<! k?!k?)#74_47=)"64_4 G=-"67z/_4+"e6y7z/_U4 %497z/_%4 k?)Kk?9k?A k?Ik?Q@k?QKqK>Akf k?q( k?4?k?(0k?47k?k>  k>7uxk?y7>7>444? 7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4!4! <4?@@k?7k?#Ek? 7Yk?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?!#74_-4@x7?!7?!7_4#%794_4Ka?_H:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 860.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?7Kv+ H4?4447-7K?Y@7?K?Yk?4?k?474_4$4?7 k|_M@eK?Y#7 7z0_U4-K?Y@7?P6?7=7St797Z6?7_6s`j 777X67@Ku:qKs:y k?k?o 7hd5 he5hf5hg5!hh5)hi51hj59hk5Ahl5Ihm5Qhn5Yho5ahp5ihq5qhr5y4o9k`(4?k}4$4j5ho5#E7G#7hy5"##7hb5"6 hr5"6hl5"6phm5"e6nhn5#7 Pha5#A7P hp54445K?607՟ 4 Hj)5k?Ew5? R_?@7p h  U?@ ? _C ?]@"4j(2Kz4?Kx @ ky5  4?7 E ]5k q@7?Ht5 KRX7Hk55YBX6Hz5 E@@He5 JK?K?Z~@4`  ^k?k?7 X_7 K?K?S~`4`  ~k?k? 5yh}5_=7H}5 O Y E R7+?6U? 06o? TҒ H@K @h@k|K`k`Hr5Q V!R%B Kv%4?kbƜ RHr5 7 Uҿ|@>@H5 \ӑ! P Ha56B?@4? " A|@Hs5A\@Hs5At@ˀ4~"@H6 8Hs5AIHs5A ,IHs5A@Hs5AIHs5AIHs5A$@xHs5A @XHs5IA40Hs5IA4Hs5I?A4IHs5I?I?APIHs5IHs5xI?pHs5_e4I?I܀0(Hs5Ku9q04k9qHs5r A4 4O Hw516?? t K BEyX7 p h*  St  8 \ӑHx5 Am1Kv(hv56hb5"e6z kb(@@g׀44~Hb4Hr5yHq5qHp5iHo5aHn5YHm5QHl5IHk5AHj59Hi51Hh5)Hg5!Hf5He5Hd5 @O5Ku=!Ks=) k?k?7"46 0B4 K7_}7K?Y4@7?Ku<1Ks<9 k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?yKm9)4# k`9)Kk9Ka?4)Kn9!Kl99`0ki9Kj9Ka?4( 40kq9!@0kh9 @Kz9@8"k|99@@K914$4%4& E 4G k? %0# "" 6PCu # 7 k?#E 7Tpk?#%04'7 6 7+`4 b 4 Kb0Ct Q7?4K99KH *K kzKw9Ka99h-HK|99KKvKa91 @@P7&ҁ%R@k`%Kv9!Kx06?R_7kx917T4?  @Kp0 @kq917@p7k?Kp0$8K91 Z7kp0_Kq@Ks@ U k}8B3@ҿcs  kq91Cy 9KrKqU Z44 4444444p4`4 P4$@4 04 4"4 4K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?e4U4E454%4444 4$4 44"Kv60k|4Pu4Re4XB8Kz0k| =4K91K91K91Ko5kp4Ky8Kz0Kw9_4PK91ˀK>7\xkq91Kw"@@ PKz9K91Kr0 @ k91K91Kp077B3 X kqK? kr 7  ZX  4 UҶV j R \K?Ӓ H  B H7X  9 Z]? R \K? B TҒ  W4>61 ZKa99H=Kt kb91@ @Kq91Kp0 Z#0@h7K91Cu Kr9!7%7KuK?!K?K?K? @O?_Kz9% Ks99Jt   <4@h@Kt9J6? dxK|9K47k@<$b?gKs99$H@Ka99H"D  4PkeKw9 D 4_4 k|Kt9FUD K99Kvk Ks$*$@Ks994̤jxH4?`H(K}91H P }H WBhH6@ `6|  4`"jHKe99 k}91H7F?_7H(H0 h>?H4]4TKb9HZ7_? _\4'Ku9J6jB#07 06@ P747?`ҐP4?67@677Z?_7`j 6767Ke99HHD=/Hk`h   hʼ]H#0@7 uH_Kz9;@;@K|9G_۽@#E0@h7Z +` %0@@4: K99@Kz94@4KgK}99 ktK4 KuKw99J6 Kb99HYuky0k?ok?K0Kw91K|9!#E07X#%  e E " 6p" 79 4 4}P4S 6 4bC @ @4 DC< B k k|Dd B BB\ h@ DМ Hc < D HCЄd B BB?@d  C7>|K?YK?@O?#07: VKw91 kw kz % 47  \ә"6 7< A= 4" "e 6P6s 4b Y: H  A Hҿ9  V?@" 6p  _1`4@k?7K99 k?Kz9@"k|99Kz99@K?@@K?Y@7?K99K kxKkw0kw91Kky9B@cz k?ok?7$k?@`4P x7 d@84 x |4hw(K?@4z4|K?YK?@O?#0@X7 m d#0@07 m4Ku<Ks<  k?Ku=QKs=Y k?k?ok?7C@7$ d4 0h@4h0K?YK?@O?_4_57P4h0k?7@ jk@ K_4KXKWWk]8k@HKy99Y _@K?Y@7?Ku;Ks; k?Ku;Ks; k?k?7Ka?7X#04:@_e7 _4K?Y@7?k?7_!@K?Y@7?Ku;Ks; k?k?7_@K?Y@7?@4k?7Ka?_4:_7_yk|9AK?Y@7?Ku:Ks: k?k?ok> k>k>k>!k>)k>1k>9k>A67Dk>Q 7HȀ` 2K>Q4z7HcȈ`?@K=K>AK>9K>1K>)K>!K>K>K> @O>K=4&Ka?4'!0H4 4 Iy *IzKV7>5z7Ix @H@4Iy_7 JK9 5JKw9W "K>Q5z74 Ikȉ`? @ :45BH4 H4@_U7~4K=k?ok?k?k?Ka?@ 4$ @04$@K97C% 044@A|4 Kx@4&7_}444A44 Kx@7_=444@A4 7_444`A4 7_444A4 7_4440AL4 7_]444A4 7_%444A4 7_444A4 7_444Al4 7_}444A44 7_E444A4 7_ 4440A4 7_444A4 7_444 AT4 7_e444A4 7_-444A4 7_444PA4 7_444At4 7_4440A<4 7_M444A4 7_444 A4 7_444A4 7_444A\4 7_m444 A$4 7_54PKz@44`A4 Kx@4&7_4Kz@Ka?A49@` :44Al4 7x0Q7_u4z04A$@K?YK?K?K?@O?Ku:Ks: k?Ku=Ks=  k?Ku=Ks= k?k?ok?Kx97C 7$4^_%4zKy9 7 0_4zHF4h@A7k?H4y7_G4HF}4K? @4|K?YK?@O?@@K?@ @Ku;qKs;y k?Ku;Ks; k?k?7K9 h@K9 K _M@Kz9 @_%@_EKz9K?Y@7?@@K?@ @KuKs>  k?Ku=aKs=i k?KuK?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?`%6X?94? @A4_%4A @A lKz04H_ u59"4?B4H_ =59?4?Kn9ш)RUk`9)Z=k`9k`9ьB HC\4Z!_ 4P!@H_ 4`!Ko9с>@AX4@_4A 8@AKz04` b'R _5\mk|944A4 A 7557_4k`9_4 6?_ E4@>Wk`94=kq9_4_m4A @AKz0E4_-4A @AtKz0]4Kn9с9@`(4H_ M4P @_ %4H_ 4 P@H_ 4 (@H4_4 A4@H_ 4Ј 4 4 4%x@  8 @@@@H_ 48@_@A4eH_ 4EH4)4*4+"0"e04,6 6n `444?6_?g4? 44A 4 A76X?9bko9lko9hxAn`ko9dPko9fHA4 0Ako9yko9iAko9Ykq9Yko9ako9qkp9Iko9Iko9IxkoHhko9Xko9Hko944PA d4 7A6Y_ 54Aӿ=55@A 4u+`_4+`_]@4`5@@@HAd4`5+44A<4 A07e+d5m@44A4 A7-+Hkh9Q%+44A4 A7u 4  @Ky04_]4u4Ky04_-4E4Ky04_44@44@44 Kr9Y`*x04@44uk`9Ku>Ks> k?Ku=Ks= k?Ku>Ks> k?Ku>qKs>y k?Ku>Ks> k?Ku>Ks> k?Ku>Ks> k?Ku>aKs>i k?Ku>AKs>I k?Ku=Ks= k?Ku>Ks> k?Ku=qKs=y k?k?ok>k>7C7%_47>_4z!(4Ka?H?"h@Kw9"r j4_m4 H74_u4 @HKD_u44z_4 @74_4 @_4 @4zkc94z_}4 74z@d@7?4_%4 `@@\4z_%@ @@K?_%K?Ax44_-44Ȁ 07 7%_4?7_u >4zx4@44z}+Kx@Ka?#%04:@_79 _4z@44K>YK>K>@O>@@K?@ @Ku>1Ks>9 k?Ku?Ks?  k?k?ok> k>k>k>!k>)7CԢAH4k>AHu7>4zJ7!p4Kt9q :#047pA4 Hy^744_4zK>و@Ka?4'h4K>A45_e4w 7K>A4 7^4  __K>AK=K>)K>!K>K>K> @O>"e046y0A4 Hy@|7E+k>1"046A04 Hxk>I7K>1K@k>1K>1@@K?@ @Ku:Ks: k?Ku<Ks< k?k?ok> k>k>k>!k>)k>1k>97CABk>AHv4z7>J17"4K>bKt9q #E0Hy^u7Z 44_54z!4Hsks9#0Hz_]70"7kf9 _4k`9G>k`9_5HzKa9i @Hz@7>_ K>AK=K>9K>1K>)K>!K>K>K> @O>%@4'!0 K>A h"458_4w!h7 @@Hyky950_Hz!x7kf9K>A5X4^4 $ _' "0460A4 Hy@7%K>#047A4 Hy@7+_]HzAP4M+45A(4 Hk>I7@ KE@_HzA4ekf9Ku:Ks: k?Ku>Ks> k?k?ok? k?k?7CH}k?!_IKZA7k?)Hy_%7@|K?)k|9Hx7K4%_m7!7kf94_m4Ky9Y7p4hKz9@ @K?!_4 @_4 k`94z_uk`9K?)4@ $4 @K>K?K?K? @O?@K?)kf9Hp_hp@tK?) @@TK?) k`9A4=K>k?ok?k?Ke9I7C h7ȹb HxK_a4 zHwJȋ?6p4|Kd9Q?H BHzKYȋ ?7C 4| H}74|K?YK?K?@O?k?ok? k?k?k?!k?)k?1k?9k?Ak?I7DK:7#@ 44k?Q4%4&4(!%04 ?59@_@ hkj9Y4cHz@?59@!k`9K>K?IK?AK?9K?1K?)K?!K?K?K? @O?HK?Q 4 Hz_y4IwJ_7 "Kx9 5Kz9L IyK?ȋ?}7+Kv9q>4c@459pA04 Hy^7m4cKs9q 4Hy^5:`ItJ u_M4-K>k?ok? k?k?k?!k?)K57#7D 4k?14% 0Hȃ@ hK?1HzH_4I_ 7 @HK7Ȋ?7'44A4 HyH@ l74cHs`?%@_4K>K?)K?!K?K?K? @O?I 44_K?1KiK}9q??4cHy^}44ck?ok= k=k=k=!k=)k=1k=9k=Ak=Ik=Q7#7D7 !4 H!4k=a4&4'Ka?4(!%0 HȂ` K=aHzIL_4I7_45_ !7 @I "RIȋ?u5K=a4_4HzK7_4" |Kt9q Hy^ m5:IbhJ4 h H|>@`"rk`9K57!H@K>9K? _@IK=a_u4HzK7_]4! IjIAH+ KKl9q Hy^ 5:b]@Kz9a@??IHz_7=>II>@@Hz4590A 4 I@ 7}K>9@4HzI@Hz-Kt9q_E4}K!Ks>) k?k?o4k?!_u4`7K?!4_u7 77?4_E4z Hw؂!2HxK4zE7_e4z!@@K>@O?k?_e4K?k?@K?!K?@K?! 7?@K?!_u@ @@K?_uK?A4Hw#047A4 K?!@7Hx@K?!K>@ @K?@ @k?7Kx9qKa?7Y@4: K?Y@7?k?ok? k?k?k?!k?)k?177D k?AHȃ@ 8@KCK?A47`?4zK>K?1K?)K?!K?K?K? @O?Ka?4% 4HȀ x4I B_Hz *K?A559745 Iȉ?@ :44PA4 Hx4@^ 7Hc`?4K>@ @K?@ @k?77YKz`@4Kx9qK?Y@7?k?ok?7k?_)4 k?#&79_%4zk|`!4$Ka?47 kw`#74A4 Ka?4x4:@^7Ky0K?4_eK?_K?K?YKa?4? K?K?k`4$_Ky0_aK?`K?YKy0K?_K?_!K?` Kz`` _ a@K?YK?@O?KuK?K? @O?44@D4 Kx@Ka?K?!4:@^=7_e@uK>44@@4 Kx@Ka?4:@7^4w_@K>44@d4 Kx@Ka?4:@7^]4w_@K>@ @K?@ @ KWȓ k7KPKkXKyP@k:k?7KP Pk?_y4 7Ky0_eK?K?Y@7?"46@4 Kx@Ka?4:@^7_@K?Yk?o7CKzP@ z` Z4_Hz KPKkKxPkHc`?4K?Y@O?#47 @4 Kx@Ka?4:@^7_@K?Y#&479`@l4 Kx@Ka?Hw4:@^e7_@HcKP k@k?ok?k?k?KxP 7C` @KP4KЀ h7H^mHy0Hȓ0 HȈ?HKP Hc`?g4K?YK?K?K?@O?#&479 @4 Kx@Ka?4:@^7_@mK?Y"46@44 Kx@Ka?Hw4:@^-7_U@KPKu:Ks: k?k?7KP j@Kk?_ KzPKyX_uK?k`P_K?K?Y@7?#47 @4 Kx@Ka?4:@^7_%@K?Yk?ok? k?k?k?!k?)k?1KxP!7C`!@Ka?4$4% 4KwPJЀ 6I:^Hy P@Hz_4! I?4kI)5(I)ȉ ?wI: @Hz_4744@4 4@k?AKx@7^Hw!: Hc`>4K>K?1K?)K?!K?K?K? @O?#&479 @T4 Kx@Ka?4:@^U7_}@UK>44`@4 Kx@Hw4@^7_@-I)44`@4 Kx@Hw7^K?A_@mHck?oKsP` @Ka?47 kw`4k9q#&479@4 KxPK^7KtPJЀ` *4_4zHcȈ`?4K?Y@O?#47 @4 Kx@Ka?4:@^ 7_E@K?Yk?7KP "^KKP^KK?Y@7?k?ok? k?k?k?!k?)KwP!x7C`!(@Ka?4$4% 4KPKЀ ZI^ Hy @_A54Iȁ ?I `@Hz_ 444@,4 Kx@Hw4@^ -7Hc`?4K>K?)K?!K?K?K? @O?#74@4 Kx@Ka?4:@^ 7_@]K>Ku;Ks;  k?Ku:Ks: k?Ku=Ks= k?k?o7?(a4>hdhehfhg 7%_M4a744_4`7+4'?44_@X744_4 44_M_7Ka?H'_}4_m4`ˀHb?ϟHb?Ka?H%_%4Ka?ϟHh%Ka?H&_4_4Ka?h&4?Hb?Hg HfHeHd4~@O?Ka?ϟh'Ku:aKs:i k?Ku=Ks= k?k?7K70k?K8@7?k?_]k? @K>@7?#&479@@ L4 k?Ka?H:_7K?K?@x7uK>Kuk>7k>7:k>_U7>ɋ 7G>> J G>݆b @K>_5K>!7 @K>_7>^K>4K>YK>K>@O>K>_mK> 7?4G>K>_ K?qK?y_-K>_W4G>K>_ 1ҹ%4"46p@4 k>Ka?_UH:K>K>@7^mK>4#47@4 Ka?H:7_7K>4@(7Ku>Ks> k?k?o_7C_7Ka?7 @4:@k?#Kx@7^%4w(K>#&Kx@^79K>@O?k?7_@@|4K?Y@7?KuKs> k?k?7#7_k? @K?Y@7?"460@|4 k?^7K?k?_7K?K?_-7eK?YKu=AKs=I k?k?ok?7C 44@4 Kx@Ka?4:@k?^7Hw 8@ `K?^Y4 h?4cK?_4K?YK?@O?k?ok? k?7D f Hk?!44y@4 K?!^7HKa?44y@<4 K?!7^A4Ka?H?K4 P4% K84y4^K?!H ?@K?!^4y0K>K?K? @O?Ku:Ks: k?k?o7#!k>HsJv7>14zA7 K>qk?q_U7?q#&77(79@_17?!G>A@(7?c?K>7?!#Fk?K>Y7Y`7?k?K>k?^!K>"HxK>^6K=@O>KuK?QK?IK?AK?9K?1K?)K?!K?K?K? @O? W 84Z@ƚ2C? =03ƺ2C8 4 05 @@ @K?@ @k?ok?k?7?1k?1k?)k?!!0k?944@P@ K?9 7B *7?6`Hw bB *7`?64c?`Hw?@K?YK?K?@O?^4eԠH>7^Y4?ԠH@? u4@ @K?@ @k?ok? k?k?k?!k?)CB77$#7W7x3444Z44^4\` _#Z J4~V#4T%jc@ V#"ςpK>@%`߿ ($% @?%B60B4 6046B64A`_ (@B6` @%4%Bc6 `$] jB ZB`_ (6B6 $` B6cĂ B6 ( r4~4^4T @!# @#B6 ( E84!4ˀK>قb :@$B@6 86b?@ ZςK>@ @Bc6 c@ "B4@<]6@#Zǃ 4^#R4K>K?)K?!K?K?K? @O?@!R`!R`߿ (7$ "`/B@??BςUK>6?k?1`_ (@B@7y3`&  @7g34 `  *4xK?1__%4 4@?@ςeK>ςUK>ςEK>ς5K>ǣoB@4\ςK>ˀK>ςK>ς}K>ςmK>ς]K>ςMK>7@*c  @7%|@b:/4AςK>ˀK>ˀK>@ @K?@ @744_77(4666x77Y7!4=74 44477wL4474 b6b:b8b<b>b@@6 @ @K?@ @k?o]4 (744|K?Y@O?]4 | 274  w^4z`u4|@ @K?@ @k?ok?k?k?4@4744z  | f7C 04Hw7$Ԁ2]-4?gHy@7HsHz d  thu7K?YK?K?K?@O?]4 7Hv7H}m |@ @K?@ @k?ok?7CKZ@ ^-KD?4^ 4zK?YK?@O?@P@K?@ @Ku=Ks= k?k?ok? k?k?k?!k?)KE7C7$ 4H 44H?H H!2Hz 4KH r F84^@54?}@]H_@]HK_^ @507G5?/KH d04 g4 sHHz ^mKE?4 dH @HH@?@ g4 vK>K?)K?!K?K?K? @O?k?oKvh0Kt0ђ0kthK|97CK4@z@2]4 rK}9k|9K6k7  4K?Y7@O?K?Y@ @K?@ @k?ok?k?Kc9` bHx7?@2d 7 7_4?Hc`?@K?YK?K?@O?@ @K?@ @k?7Kvh k?E7]K?K?Y@7?Ku=Ks= k?k?7K: kz: _4k|:K?Y@7?k?oKs: (7C_E4Kz: \_47}.A k?Kx: Ka?k?C4:@ 7w0#&2@7w0]u79_54K>@O?k?ok?7C@04]4z 7_4z4K?YK?@O?k?7^k?7_Ek?k?K?7^K?K?YK?@7?@ @K?@ @k?o_k? 077c`K?#7`_A4zK?Y4|@O?k?7@@K?Y@7?@ @K?@ @k?7@0@K?Y@7?k?7@@K?Y@7?k?ok? k?k?k?!7D@"7%@"Kcp @4&Hy] 4 bHc`?Hy" ZHy]4#j(4$4]4 āHz]4"@7^y47]Y4 |"74^a4(4'4]4 g^47]4!`744^4Hz @^@ f^Q47]14 | 74^94Kp (@K]4@@Kp 0kcpˀ0K>`u@ (4<H|ˀK>ˀK>ˀK>ˀK>KepH jK]4`H@HH (@K]m4_@H x H|K>K?!K?K?K? @O? _ : W ]  SV@ \CT x4@ӿ< 77Z<  @?@@Kuhe>hf>hg>hh>hi>hj>hk>hl>hm>hn>Ka?H&7$7H7 %4%0Kh:Kjp %IY]5 eIJ@?IY@%zIG@4^"!@]475s4 K?K?g~4` k?k?77h_5 @H4 D 4`5@ K?K?~  k?k?77h_-5 H?w5@$4_4!f5y@ `7IY@ H7@ 5:75:@ 77]5z7]5 5 K?K?~4`  k?k?5y7@ p7!f5y@ P77@ 855y@ 7]5:7K?K?~4`  k?k?A774 tp4 `55775)76 7,?5y]5!5y ]e5!45@ x5X 75@4!I  @5 @x4!X@ ?5!2A7 ("5)A7 ?5)>E@  ˀ84~4 !M5h44~Hb>YHn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>˄}hmhk?ok? k?k?k?!k?)KG7C k?1@h4zHc`#Hh( H0"jHf$4HsHw d Hg$XH: G]]K?1DRĄX@H}7G? ܋ #D!HHt( Hu0 刀 6# @#*Hx7G? Ջ#D?Ht(Hh  Hh#Jz H] EK?1?-HHa Hy' Hc "Hx C HwH Hh!J H] K?1>HHb H}G Hc!H C ]K?1K?1_7Hs(76yHt76y?Hb07 E 7@=Hyˀ8K>Hx Hc!H CK>K?)K?!K?K?K? @O?ˀK>_@\E@_@\@_@\ H _@\E@_@\Hˀ K>_m@\H_M@\ H _-@\@_ @\ G @4ś7 Ş'H| ˀMK>_@\% C L҇L HzH ZD:D  "@60#@7P#&@7<p#F@7\#@7"f@6|#@7"@6KuK?K?K? @O?k?ok>k>k>7#7]k>k?K>4k?7z07k>k?k?k?yk?qk?ik?ak?Y@k?Q!7@4z X7]47\4"`74z4]4k?Y7?7? k?7?7?!k?7?7>k?7>7>k?y4z@k?K>]7K>k?47k?QK>4k?K?k?K? k?K>k?yK?k?qK?k?iK?!k?aK>@8K>! 7Ƞ4H @@H4H H 4 `4 KX @@ J 4c ? ``4@44K>YK>K>K>@O>H @@84H jH  X4 K_ @@ K:@  ?4?4]4z4 _ : W ]  SV@ \Ku k>k>k>!7D4@KZ@" ^!4"p77>_=4 K>48bb@\K>7" K>4g44^M4!@ _ ^u4H B4% # 7 *!\548 !H7 H(4 !hHz"H!hHz H!hHzH C   !`Hz H C h !XHz(h(H!XHz0 Ch0Kg:!40kw:!^4K=^4K=K>!K>K>K> @O>]4zK=_%@\}@_@\ _@\H_@\H_@\h(_@\ C ] 4z]4 Ku;Ks; k?k?ok? k?k?k?!Kd94%7C4&4tk?qKx:9!:4K:AC 4 "7k:AC?7 8077k:AC ?7_ @X _?'k?qK:AC?=@>k?q4K>K?!K?K?K? @O?k?Ky@7?q_4>K:AKKu;Ks; k?Ku k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=64 k>4K=ak>K=i]Ik>K>K=q K=yK=K=CCK=4xk>cC 4yk>ǃC 4 `_#ª]57J (@] 5!e6 J?@R4K=Y ]56O \7#7K>K>5]4^K>K>4t_%566? 6@ 4CC*cCZǃCq> #ǣCr@$"K>7@ P5J>M@$jK=Q`$ZK>_K>7_4z@7>p֟t&a&i8G&qFq \4:(#7P64ǣ@ 4@ `4 @47`4 4eK=Y]Y5zM7]95ZU7]5:]7]4%7]457]45746K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>47@X5ycܥ@4\7@ 5Yǃq>4\7@59Eq>z?@ V47@5ǣr4V7@`4r4X77@4`47@4eK=Q]56K>_K> 4 @K> @K> (K>J I K>K>_]4 0o4oAj6 o!:4  40 ! Ǐ@K>K>_=4 7k?] 6Zk?K>76Yk?5k?k?yk?qk?ik?ak?Y_k?Q - K>6X_uK>5?575?~@6 M Ku;QKs;Y k?Ku=Ks= k?Ku;Ks; k?Ku;aKs;i k?k?ok? k?k?k?!k?)k?17$7C4 4Ka?H?4'4h " <߀ : 4! \ 4"?5 4 \5!7!4 Ka?4'H `Ӻ! \ 0@ `_uӚ `@H `!2 < `  4?%4c 4K>K?1K?)K?!K?K?K? @O?_@H_@H!&59@H4ܞ=@_u@m@_@C8X7? (7W6 ?7@6?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK>76K>7I4K>4 K> K>y ` @ :C_ 4 4 r4V_ b4X R5)A? 8 (@ ( _8 ?5)K:: _a4K?IK?AK?9K?1K?)K?!K?K?K? @O?? crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)? crt0: errno: tsd  )$# %&" +2+$'()./045-!"31*!,)&&&&    $$&'"(%! # !"#$%&'(())**++, 54\5554l5555555555554|545444444555$585L5d5l5t5|55555parser stack overflowfooparse errorSyntax error in archive script, line %d DDRR}|{yutsrqponmkgfedcba`_^]\[ZYXVUTSQPONMLKJHGFECBA@?>=<;:9876543210/.-,+*)(#"!    !"#)+-7,*9;8:.`ano<%$%''~}|{zyxwvutsrqpmlkjihgfedcb_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=6543210/(& % }|wqzmsrktkeh+w{vrvwz|hgbaW[VRVWZ\ida^]ijfh\KFC@?KLHJ>[XVUIUOSF>;98,826)?:;CB&!"*)3+ABE    !"#$%&'()*+,-./012)('&# !$("%#######################$%############################################################## ######################################### ###<(9D9\9d9l9t9|9999999999999:,:4:<:D:L:T:\:d:l:t:|:::::::::::8,;fatal flex scanner internal error--no action foundfatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedflex scanner push-back overflowout of dynamic memory in yy_create_buffer()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()%s QdQDQLQdQ\QdQdQQdQdQQdQdQdQdQdQdQdQdQdQdQ,Q4PMQdQTQdQdQ<QdQdPMQdPMMMQ MQQ$QdMPPPPPPPPPPPPPPPPPPPPPPno entry %s in archive Usage: %s [-X32_64] [-]{dmpqrstx}[abcfilNoPsSuvV] [member-name] [count] archive-file file... %s -M [ %s is not a valid archivestat returns negative size for %sx - %s w__.SYMDEFd - %s No member named `%s' m - %s no entry %s in archive %s!r - %s a - %s %s: no archive map to updateNo entry %s in archive. wCan't open file %s AR >tmp-%s%s: Can't open output archive %s %s: Can't open input archive %s %s: file %s is not an archive %s: no output archive specified yet %s: no open output archive %s: can't open file %s %s: can't find module file %s Current open archive is %s %s: no open archive %s: cannot set time: %s%s: rename: %s%s: simple_copy: %s%s: %s: %s %s: %s %s: hppa2.0n-hp-hpux11.00can't set BFD default target to `%s': %s%s: Matching formats: %sSupported targets:%s: supported targets: %.12s %.4s%s %ld/%ld %6ld %s %s /%s: bad number: %s2.11.2GNU %s %s Copyright 1997, 98, 99, 2000, 2001 Free Software Foundation, Inc. This program is free software; you may redistribute it under the terms of the GNU General Public License. This program has absolutely no warranty. %s%sCannot allocate %lu bytes after allocating %lu bytes undocumented error #%d/opt/binutils/share/localemessages/.moCPOSIXLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_ALLLC_XXXLANGUAGELANG/locale.alias/opt/binutils/share/locale:.riso!$@!(!4P!8!8X!<!X!\!p!t!!#@#D#D#H#H#L#L#P#P#T#l#p#p#t#t#x$D$H$T$X$t$x&&*8*****+++4+8+T+X+t+x++++++++,,,4,8,P,X-$-(-4-8-T-X////0408006667:(:,?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000@@@ h(TR>TX h,h,X 8FQFQX HHHX IX X(>(@`>(@<>( @P>(s@sh>(,@,t>(&x@x >('0,@0,>((`@`>(P@$@>(R@Y ? @>@ $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$y  0 {0t <p(O8hů;A8v˚v)@b 8bR b . rDAXD(K'i0VL'6!xy,!xD!xry 4X'APנu R`aDg6RmTLh ,ש'6JL''̃!xT/}(24/g6OXk )Q0[k/X\T6u- W!x )'6Y8VYi]3'/!x\T+ 4gyhg@)}M5]E Ytfbuq85}2 S)rZAZA-ᱎAtlGɘ*' 0&hज़B%*[DT'U,W[\ipa9 ƿxfZxG0F/C$x (!9⦓W&186Ê̞ӧd&r{ ٣@2xmH̕ɕ‰L©*0x1эb|mGzJMx3:)t!xۛ2'y8'hBȚtF7a\B˛ty\^|za^ZŮ1~CEu",/'>^91 9H˛h1@̚Ê0>fJfݡ>UmH +©+T2U =WTQbQ1Gşz@ UjWMJk)ȗ˨m ~?A,˚v8vhů;An bRY;tltD8rP.Y;2Y;Y;'>xfBxf2xG(xGXFFx 0x @99⦐W⦞W&&#1ͣ166#ÊÊӭӧdd &r}&ra  #٣٠@@22xmPxm ŕ#‰L‰O#©© *0*0x1x1bb暄LmGmGzLzP#MNx+x[:):)Ŵ4!x؛!x֛2'2'y8y8'hB'hB#ȚtȚwFF77aa#\B\A#˛t˛wy\Fy\6XD(;'i0VL'6xzxDxq 7Xˀ'APuR`aDxg6RmTLḭש'8JL''ƒΡxW/ (24/g8O9Xk )_0[k/X\T6t W x )6Y8VYi̧]3'/šx\T+ 4gzhg@)g?}M;]E ;Yazfbuq85z2w MS)rYwAZA-NAulɫGX*&| 0&Pज़^%)DT'Us,K[\ipa%,Sv-Yy9+_}] Us u3mIA5qWKo)1{EOMQw%; c$iS/Ga=ge7[ @@@@@@@hU@U@U@lU@tU@xU@ U@U@U@UUUHU+FU9@U?UjUh$U_U` UaUU^UapU"LU*mU4JU;RU!;@U _i U#_@U g@U {0U&{@U ̘U(@U hU*@U PU,@U @U.@ U U0@(U <U2@0U U4@8U U6@@U xU8@HU LU:@PU U<@hU \U>@pU DU@@xU (UB@U UD@U UF@U 'UH'@U .ߘUJ.@U ?9DUL9@U GXpUNG@U UdUPU@U ^\UR^@U elUTe@U kUVk@U CqUXq@U yHUZy@U U\@U 8U^@U U`@U Ub@U Ud@U Uf@U XUh@U  Uj@ U 'Y Ul@(U YUn@0U ,Up@8U 0Ur@@U Ut@HU ZhUv@PU  ҌUx @XU ǨUz@`U ,U|@hU k$xU~$@pU -\U-@xU 4dU4@U :ZU:@U HUH@U QUQ@U "XUX@U _U_@U           LRZajpx &/6>DLU`gpy  '07Oj&>KZhu !7Nft~;DT_l{'.9GU^ekqy $-4:HQX_g|   % - 5 A N V d k t }    $ / < Q a ow(w,w(wE,0wwExx xxx"x*x2x:xBxJxRxZxbxbxbxjxrxzxz x x x (x 4x @x Lx Xx dx px |x x x x x x  x  x x  x x  x x  x  $x  0x  <x  Hx  Tx  `x  lxJ xx x x2 x2 x xR x: x x: x x x x xJ x ,x 8x Dx Px \x hxJ tx xB xB x x x" x x x* x x x x x" x (x 4x* @x Ly Xx dy  py  |y  y  y y y" y* y2 x y: yB x yJ yJ xJ $xJ 0y* <yR Hx TyZ `yb lxr xxr xr x y2 yj y2 yr x yz yz y yxx x,x 8x DyPxJ\yhytyxzyZyxJxJyyyxxBxJyxx wEwEy`ydyhylypytyxyyyzz z zzz"z*z2z:zBzJ zR,z8zZDyPz\zbhzjtzrzzzzzRzzzzzzzzzz(z4z@zLzXzdzpz|zrzzRzzzzzz*{zo4{ oH{t{*oh{s{"s{"/tmp/libtool-18240/as-new/opt/binutils/lib/opt/binutils/lib/libopcodes-2.11.2.sl/opt/binutils/lib/libbfd-2.11.2.sl/usr/lib/libc.2_tepv_ktepverrno__ismt__dld_loc_hex_valueoptopt_SYSTEM_ID_CPU_REVISIONopterroptindoptarg_FPU_MODEL_end_environ$RECOVER_END$RECOVER_START$UNWIND_END$UNWIND_START$ARGV__text_startfreadisasciimalloc_isupperfopensprintfstrcpyungetcstrcmpffsreadstrchr_startfseekcallocstrncasecmptolower_isdigitfclosefgetsbsearchfprintffgetcexitopengetrusageunlinkvsprintfrealloc_isalpha_iscntrlstrcatstrncpyqsortstrncmpvfprintfstrcasecmpgetcwd__filbuf_islowerftellgetenvsetlocalestrtoulfstat_isxdigit_isspacefflushstrlen__flsbufprintffputs_isprintfputctoupperatoiabs_isalnumfreestrstrstatclosesbrkabortmemcpystrerrormemsetbfd_get_reloc_code_namebfd_set_error_program_namebfd_som_set_section_attributesbfd_initbfd_is_local_labelbfd_set_section_sizebfd_set_formatbfd_set_section_contentsbfd_install_relocationbfd_make_section_old_waybfd_octets_per_bytebfd_som_set_symbol_typebfd_get_machbfd_set_symtabbfd_get_errorbfd_scan_vmabfd_set_relocbfd_som_set_subsection_attributesbfd_arch_bits_per_addressbfd_get_section_by_namebfd_openwbfd_som_attach_compilation_unitbfd_allocbfd_errmsgbfd_perrorbfd_reloc_type_lookupbfd_som_attach_aux_hdrhppa_som_gen_reloc_typebfd_set_errorbfd_closebfd_set_section_flagsbfd_make_section_anywaybfd_map_over_sectionsxstrerrorxexitobjalloc_create_objalloc_allocobjalloc_freemainhex_initobjalloc_free_blockfnmatchdcgettextconcat__d_trapdump_statisticsmacro_exprxmallocfreeinput_file_getconss_spaces_ifs_ifdefs_ifcs_ifeqss_elses_endifs_globls_ignores_endscrub_from_stringget_line_sbs_aborts_align_ptwostringers_align_bytess_comms_mri_commons_datafloat_conss_float_spacelisting_ejects_elseifs_funcs_sets_errs_mexits_app_files_app_lines_fails_fills_includes_irps_lcommlisting_flagss_linkoncelisting_listlisting_psizes_lsyms_macros_mrilisting_nopages_structs_orgs_prints_purgems_repts_rvalisting_titles_leb128s_stabs_texts_xstabresolve_local_symbolrenumber_sectionschain_frchains_togetherrelax_segsize_segadjust_reloc_symswrite_relocswrite_contentspa_alignpa_brtabpa_trypa_blockpa_conspa_callpa_callinfopa_textpa_commpa_compilerpa_copyrightpa_datapa_float_conspa_endpa_enterpa_entrypa_equpa_exitpa_exportpa_fillpa_importpa_labelpa_lcommpa_leavepa_levelpa_lsympa_subspacepa_originpa_parampa_procpa_procendpa_spacepa_spnumpa_stringerpa_versionobj_som_weakadjust_stab_sectionsxatexit_cleanupalias_compareprint_and_aborterrno__ismt_ktepv_tepv__iob_bfd_chunksizebfd_abs_section__SB_masksbfd_und_sectionbfd_com_sectionbfd_abs_symbol7!?9" 7]!9ӽ9Y4!:ӽ9Y4T ;|ӽd Y"ӽ9"ӽ@>B! @ Z A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  a@@@ @7]]@]2@@ @] @@ @@ @ @*@ :7!?9" : B*= @ Z ]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]` =@ :7]@ k? k?k?XZ]XZ]XZ]XZ]d@"Z]> ZZ]> ZZ]9 Z8 =@Y :Z @Z@ ZZZ] ZZ @"ZY :ZZ@= ZZZ@= Z ZY :Z]ya: =]: =]  : =@4ZBu ZZZZ ZZ]ya: =]: =]  : = @4ZB ZZZM ZZY :}@4Be]yZZ5@*Z@ya AZ@ya AZ]ya A @Z@] Z]: =] y a: =4Y(ZYY8Z@] Z]: =] y a: =4Y(Z YY8Z]Y Z @*Z@YA AZ@YA AZ]YA A @ ZZmZ@@K?@ @Ku3QKs3Y k?#d7{7 +|h# +|h8 P'y 4yEe'y 7D7%767+4>#0'744445 rנjb+|h% @+|h% H (4Ц @Ц D(43 H?(ਃ 43 ` 7+4>7D7%7744z# /74444@H@7D7%7#!7444+|H8 P7D7%77+dH6 24]74444# %@7@@@@ 7K?@ @@@@k?7k?#\ k? 7Yk?4@ 4 @@K?K?7@4K? *@K? K? 7@4K? rKa?H:@7?!# 74@X4@x7?!7?!7@(4#< 794@4Ka?@ H:K>@7? 44@B7?@B?7?B?@k?ok?7?" 'E' 860.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?ok)4`@44` G>- "" 46_4K>9K>Qk<+|H< @K>i *K>y4ߟ444K>IKa_k? k?54@44? 7+| \ 4Y 4: _4h4k?4K>a5k?4@44?"74@H4K+|k>44 k>+dH?k>v k>+|H3 @k>+|4' 0k>y 4 c?+|K?4= Hk>Ka?43k? Ka?44k?֠ k?Ka?45+dk?46k?1+{4< !0k?!(k?)# 7 4_47=)" 6P4_}4G=-+|" 64: _=4O+|"| 6y4: _4w < 49 +|4: _4M k?)+dH?k?9k?A k?Ik?Q@k?Q+dKqK>Ah& k?q( k?4?k?(pk?47 k?+dk>  k>45k?y7>7>444?-7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4!4! <4?@@k?7k?#\ k? 7YPk?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?!# 7`4_-4@x7?!7?!7_4#< 79p4_4Ka?_H:K>@7? 44@B7?@B?7?B?@k?ok?7?" 'E' 8600.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?7+dH6+{ H4? 44477K?Y@7?K?Yk?4?k?474_4$4?+d7 h<_=@]K?Y# +|74: _=4K?Y7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"| 6} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y# 47 I4K?Y4|@O?=7?4?# 7 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?# 7 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"| 46z I4K?Y4|@O?4cycy4? < cy4480Ccu44cv @c|47zp7 ?77xv447wpQ_77y1C:@ 2479 W x @?797y1C:@ 24 79 W  @?797y1C:@ 2479 W X @?79Cw4 0cx@Ku6Ks6 k?k?ok?XP4hKyX4#KxP+d7KH49p7_E4(Kz@h@Kt8 ZhHKs(hXCw 4``k`Xk`8K?YK?@O?XXKz0hHKy87_Kx0K}0hP]Ks(Ku61Ks69 k?k?ok?KW7DkwXK]4#4k}PH+d4:pkxH_4(H@ks@HH k`8HP"?`"#\ 47Z @IP4:7zpk?HH_%HPK?ka8HPku0_HHHXkv(4@`_]c| K?YK?@O?4_ 7\4 4܃ b4̃< B4ă\ "4N b0D4D@@4@4@4@4@4@4NKu5Ks5 k?Ku2Ks2 k?Ku3AKs3I k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>Kk84k?!4# 8 k? 07%Kb0HK B61* * 45544 T2ˑ"Ax5lC7'N 9:KX&N @$Nk`X45 5u4~ :4 4@ 4F4ktX 4554@B6!B7wp 0!4*KqPkqX45 u5|@5kzHCA AKvPkvX4kqP 4554@7kpK?4*"5z75w> 4? < 449 X4 I7KuPkuX44Dai?5k?5 54 B44 k}X 55@ 45u5~4ab?Ky@70kp@44 5k?554 @ 4554" 46 X4 H<74D 455M4V4koX4an?4@5k? 55444kpX 55乥4an?4@5k?"5e5j4kqX4an?4@5k? 554@KX Zan?44@kxX5k? 4˔Anbx40kP0kyP4 kaX4 554 @KtX3an?44k}X4@5k? 55䷥4@B64N 'a?'5k?_K? J+d@=p 4554@KX0kP4?ktXK? 6bkbH0krPBz4455U4Z 4krX 4554@K@7? kb@ an? 5k?k`X45 5}444?K?kaP7<4k|H45k?knXC5554@B6 7np 64* 2" 46W4 H$7k`X45 5548@KX Zan?44krX4@5k? 55䳽4“0kX44Kx(75oˀH5x4*7ypC' @ B 7?@ 7? 49?  0h70wJ77U:55_ 6  `  Az5k_/_ @! K? 5_ӘˏAb4N7kpK?4*"5z%7 KX+d49pk? +|4: k?48 k?"| 6u k?1# 7k?)4^-4 ˀxK>Y7kpK?4*"5z=75w. @!\ 45Y PW4 H47K?!k`87lpK?4*"57 0 A5 B4 T̀A@A5?@ !2a?5?fwk`8Ab @E%D! 1KnH?@ˆAnb2k`87lpK?4*"557> @!< 459 PW4 H47K?!KrPkrX4@5?=a?ˀAbe@k`87kpK?4*"5z=75w- @7np D X4*7opˀAb@A5  ?@4D_ a?44?K?kvP74kaH45k?kbXC55䬥4k`8K?"575> @'0BˀzAb@B6 ?@k`X45 5䫭4k`87kpK?4*"5z75w?E E@ˀ`5C4 B4D 24N (0 7?C  h6`0445y_5  fk`8Ab u@4 ˀkXAbxK?)k`87kpK?4*"5z575w 0 B6K?)7 4? } ˀAb 4 k`87kpK?4*"5ze75w) 4 k`87kpK?4*"5z75w) @k`87kpK?4*"5z75-0 ߍ2ˀAnb@k`87kpK?"5z75&- ߆-@kiX" 46 W 4 +|KyX47 7H4%KXˀAgbm4 Tk`87kpK?"5z%75&  4 TK?"5Z75K 0JAG5K 2G  0Kw@6 0kx@ j :ˀAgb@AG5K?@' 8 ag?5k?fk`8Agb-@k`8K?"5Z 75K?M M@ 2#< 479 W \4 H74@7rpN K?1Ҷ6?@4?z 4*k`87kpK?"5z 75 0߀ C74 kwPˀ A|bZk`87kpK?"5z 7 0ϟA|5k : \ 44Y PW 4 H7440! ˀAzb@k`87kpK?"5z -70U 4?! 45 W 4 H47-4k`87kpK?"5z 75w* 4NKX +@4 kzX ʈˀAgbp4 Tk`87kpK?"5z 75 0 C74 T "4kzP4? k|Xag?5k?KX "҈ˀ@Ab@B6 7wp ?4* # 47W4 H7 4554k`87kpK?4*"5z-75w> @4`@24r?`"KoX 4F.)a?7np  X4*7opˀAb@A5  T?@ 2 < 449pW,4 H\7k`X45 5i4rk`8K?"575?  @7z1_5"jˀAb@k`87kpK?4*"5z75w( @J B Z r  ҆ @A 55As 5k4At 5k4Au 5k4Av 5k4A| 5k4Aa 5k4Ab 5k4ˀAnbxKXk`87kpK?4*"5z 75 0߀ C7KX 41kwX 4kxX<@7bp N <4*4ksXC76+`KgX Z# 47 W 4 H87k`X4 4jK?! 4kpX44}44@455 f fk`8 fkh0 fkk8K?! eK>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"| 6} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#047H4K?Y4|@O?=7?4?# 70 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#07 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"|046zH4K?Y4|@O?Ku3Ks3 k?k?7Kxp 4kwp#<0479@W4 +|4? 0k?48 47 Ka?4:@k?_-7#\07Y_ K?K?Y@7?Ku5Ks5 k?k?o |0k?44yW4 +dH8K?_]744y W`4 K?_%744y `W(4 K?_744y W4 K?_744y`W4 K?_}744yW4 K?_E744ypWH4 K?_ 744yW4 K?_744ypW4 K?_744yW4 K?_e744yWh4 K?_-744yW04 K?_744yW4 K?_744y0W4 K?_744yW4 K?_M744yPWP4 K?_744yW4 K?_744y@W4 K?_744yW4 K?_m744y`Wp4 K?_5744yW84 K?_744ypW4 K?_744yW4 K?_744y`W4 K?_U744yWX4 K?_744y@W 4 K?_744ypW4 K?_744yW4 K?_u744yWx4 K?_=744yW@4 K?_744yW4 K?_744y0W4 K?_744y W4 K?_]7R@K?K?_E444y PW84 +|K?48 @_7K?Y@O?Ku6Ks6 k?Ku4Ks4  k?Ku7Ks7 k?Ku6Ks6  k?Ku3Ks3 k?Ku5Ks5 k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y |0k>Ky144 zk>V@4zk>Km1Wx5 k>+|4K>749 ^K>K>Kx1+|4490^]4zKb1b 4_]4 Ik>5 I k>4W4k>K>+|4 IE4%4 pk4&k>Ka?4'+d4(4)#07hk>!\04 444`445Y%W 4 4@4 7_6Z45Y%W 4 4 7_6Z45Y&W 4 4 7_M6Z45Y& W P4 4 @7_ 6Z_]4K2C$:w "7C$?7$44_77V4KthKs2k|hKy2 #45Y&W(4 HX787?Q_Kz2k|0K}0 Xk|07?Qk?K>K>K>VK>7(K>6Z?@4? : `Ky2R 6Z?o7?Q4T @_@57?Q_-4Kz2_5Y#  K>kt2K>K2 4c R@4 _4_m4 _}4e7?Q+dE`$+d-h$@+dh$H45Y#0W4 4 _745Y#`W4 _}745Y#W`4 _M745Y$W04 4 _7_E445Y%`W4 H077?Q45Y&P4 W76_H7V4K`k>Kv2Kz2k>Vk|`Kb`k>4 \5Y'W4 Kb`k>4@HX_ 7_47?QA DKz27?Q4k|0I4 uku0I+d]`$+dEh$h_Kz2Kz0 \hk|07?Q_mKz2k|0_MKz2k|0+dh$+d`$+dh$p+dh p+d]h X+dh p+d5h$X+d`$Ky2!JR6Z97?QKw2B! I!2!j١R!:!"! 8 !Xi45Y'PW(4 Ii7K2CIH8iIiKx27kw2B ?@iI4@0i7?Q}m]M=-_?V6k|0QI7^iKx2I kx2+d`$+d`$VKz2K7e7?QVKz2+dh<57?Q^mK>K>^UK> K>K> K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>@@K?@ @Ku51Ks59 k?Ku6Ks6 k?Ku6Ks6 k?Ku41Ks49 k?k?ok? k?k?k?! |04e'k>V k>k|x4$4y'_4 4y'V<4V4Kt01 @Ka?4h7kw09K>Jz+dV,h:+|48 P+dVPh8_5@+d_MH:M@D @K,@7>_7>H@E @C@+d@9ȋ "@+dH9+|H7 x4F4+dH H:+dH:@"Kgh @Ka?4%+d4&HH4L4@L 7Kzh^ KG?kghK>@K>A4?B@E@ j+d@6Έ @G@ 0@N4N@+N4F Kz0Q+dH H:+dH=X!@G@A!@E 0@G@A@A@V L4K>K?!K?K?K? @O?+|V H: p+d44z'G$4UKghG@~@G@>@44y(V4 Gk?1K?1G7e@+d@5Έ>]@4+d_H:=@V 4O@P@K?@ @Ku6qKs6y k?k?/,ok?k?!_4V7Kux"0 7?Q 46(aV<4 $ "06.`&p+dH8Ka?4:@k?I7110N0N 1 1A $ 9$G$V   _Ik? ]044Y(VL4 +dH8+|K?I4! P#_7L8K?INK?IM K?IKK?IK>K?!K?O?@/0,Ku8Ks8 k?k?ok? k?k?k?!+d7$h 7E 04K4(+dh<(4K4(+dh<x4K4)+dH9(+dH:+dh< K]4nK(_+dH:+dH9x4_+dH:+dH9 _U+dKH: C_c4K4)4K4)!4Kl4)1+dh<84KD4)a+dH:(+dh<`Kd4O (4 84  @H4c?4` +|H4: `K>K?!K?K?K? @O?@ @K?@ @k?ok? k?k?77&k?!6K7H+dH% h=4C7?y+dH8H 8h%C? k?)"0K?!G6)K? tK?)K>K?K?K? @O?7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"}6}  : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#47 pG,4K?Y4|@O?=7?4?#7  `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#7  7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"}46z pG T4K?Y4|@O?Ku3Ks3 k?Ku3Ks3 k?k?o7hd= he=hf=hg=!hh=)hi=1hj=9hk=Ahl=Ihm=Qhn=Yho=ahp=ihq=qhr=yC&4 \7Hhx= 6C) " 44 G ,4I@4ZE 4V%84V@4܃?*4҃_+4*4*@4 4 4 444+ "+Hz=^+Ka?404`J*@ <+j 9j5)4 V zKa?H?4/+@ < :@ BB M 6j??40ZJ  i (4 H5K? HH NRA4!/55?ן< z S 4x="}6w @.'F0@00N0'  574w="6 `'@"6 P/  i &8G0@01N 9!E&E62_d7 XK?K?~ 4` ^>k?k?74_7`%z5_? N0@*77? \ D7hl>4V Xh`? 7?5*hp? `Ihp> W6`f?K?K?~֠4`  k?k?7K?K?~@4` ^k?k? h M47_Q5z4 }@hk> TKh05?hk>6?hz>`f>hl?Ih`>@gphk?Q+|4& H4 4 ( HGJ44 )5J ?5k(4z>4y>C4` 44~Hbk?k?74_Q7Ka? ]H?4-7?#`  \#b68?H5F P  8 @6I""46V`4 G7I#7 4_45_@` H4    4 4_E44@ H0V4` 4 44 _404 _u545@4 H"R 2@4JHz=^Y4oJ5_ ;e@5@4 4 ;-Ka?H?:e4/ ]_M5I_-5=I_ 5C`4x?I4y>C04z?I)7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"}6}8 : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y# 47G84K?Y4|@O?=7?4?#7 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?# 7H 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"} 46zG`4K?Y4|@O?7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"} 6} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y# 47G4K?Y4|@O?=7?4?# 7p `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?# 7 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"} 46zG 4K?Y4|@O?@ @K?@ @k?ok? k?+dH?+dC70@h=+dH$@+|4%0 €7CB@7K4+dH77@7?QK? 4 " 4 C04k?+d4HH5h9H:6H`4#HzHx]]7?QH|He 4shtH 8Bv 8vHhHaH}=  hvHw Hs @@Hyhyk0a+dH5HdU@hdK? *K?q K0 E4I@K>K?K? @O?# 47@V4 G7+d4#H!Hb482Hu6hwIXEK>4zU4HuU4zHz@ @K?@ @k?ok? +dH!7D 4G$7?7+dH74?B6Kw0a0@k"J0"k?1K+|480B "6kB `?64?K?1P4@h7?AK?y 40k?q+d4Hh9H?H:7H@4$HH]7?AHH 4hH !8C !8HhHH 4  hH H ` Hhk0a+dH"HB@hK?q *K?a K0 E04+dH5 C?G4zI h@K>K? @O?4BD7?!C?9 2" 46U4 FL74?׶4? ] 4\ K?1D04@K?1$ 4@K?1K?1@4@K?1p4w# 47G4"mK>U d4H+dH7B4@ 486kKB4N 6u b+|4=0  B6kBtT @  ?6X@B?8 (!26? @B? (0 6kBt+|4:0T  66ukBa6B?} (KBt 26vkKBtT ?6u 8k @8@P@K?@ @Ku4Ks4 k?k?ok>k>+dH?7D 4G<7?)77?A_4Xk>+dH?4XC"7h57?I_u4vK?AK?I X84 7_K>04@7?YK? 4 04k?+d4$H!4HhH4?HHH] 7?YHH 4hH=8CS=8SHhHH  whH H @@Hhk0a+dH9HY@hK? *K?y K0@ EX4+dH= C?)yG4zI@K>YK>K>@O> 44Ud4 F77?IU4H@ @K?@ @k?ok? K0a7D H4#" 460U4 F7K0aK(#R = 449U<4 Fl7 ] 44YU4 Ks0aJz7FJy# 47 U4 Kt0aJ7FTJK0aH?C70@h64B(7?qC? 2# 47`U4 F474?׷4?#] 7Y8 K?04Kw0aK? 4Kw0aK?hҿK?@4HKw0aK?p4 Kw0aK?P4Kw0aJ8 40j0+dH!AZK0aK  @J0 *K0@04E @H @K>K? @O?7D7K}0aK004K8 Uk8Ky0aK48k40K0a K0=+dH8C47+|490:  *7jC5 ?7>K>M+d#= 7:4Fd4lK>@ @K?@ @k?7K0a B# 74UD4 Ft7+d+dH"B:K0 *K  K0 E(4K}0a+dH7K 4? kȀ`@kz0aK @ @  kk  Ul7+dH:@ p@+dH7B4?+|480  *6kB ?6Hl@K?Y@7?@ @K?@ @k?ok?K0a H4##= 479U4 F7+dK( 44 @U4 F744Ud4 Kw0aJ7FJ44 U4 K}0aK7FK+d7D 7K0aK0Z04K8 U\k0+dH7WXK0aK  J0 *K004E@K0a4k(+dH= p@+dH7B4?+|480  *6kB ?6HL@K?YK?@O?@ @K?@ @k?ok? 7CI7?Ak?+dH?4@C| 7h$H?C4X"7h"I,7?IK?AK?I X84 7_K?04@7?YK? 4 04k?+d4HH8h9H47H4#HzHx]I7?YHaH? 4uhvHx 8Bן 8HhHzHu U  hyHw Hv `@Hyhyk0a+dH5HwU@hwK? *K?y K0 D4H@K>K? @O?# 47 U4 F 7H@K>U4zHzk?ok?+dH#4\@?!@@4҃ 4? z 4 4_4z!4 4 _Y4z!r4 4 _14z!J@4ʃ_ 4 z 4 4^4z 4 4 ^4z 4 4z^4 K0a(4 K0| 4K?YK?@O?K0a(4?K?YK0 4K?YˀK?Yk?o7C4^ 4H4yD4zK0ah Kw0a(4 J0 4h8+dH7hw@K?Y@O?k?7K0a!JK@XA:@`B#= 479 U 4 F<7@"} " 46 PU4 F7"} 46y U4 K0aK7F,KKu0aJ( J# 47 U$4 Kw0aJ7FJK?Y@7?k?ok?k?Kw0a7C 4$J@`@+d4%HJ kx0a`8hH ` hh U84Kw0a J@gHK?YK?K?@O?7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"} 6} x : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y# 47F4K?Y4|@O?=7?4?# 7  `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?# 7  7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"} 46zF4K?Y4|@O?@kz0k?oKw0 k?Kc0y` :Hy^ K? `@Hc`?@U84K?U`7 |K0y kc0yK?Y@O?Ku5Ks5 k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?a7#4k>7%7F7G4H4 @7J7Kɺ4  :H7?a IY7<i\.4 :H6?@a H7AhN@?M4 (0 ?u@4?o@? r :H6?`` I7i5?4A??@  :H7??`X Ix7iv }@4_4U5?4_45_4 45_4544K>K?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?k?ok? k?k?7C7k?!_4!7K0q P4$ 4:@2 ] 4Y@]4zk`0q0@44@ rHv6? xк`"H7hw_4yKu0q6k|0qK?!_4zKt0q4t E xkx0qHy7=? }к`"Hs6ahaz_%4yK}0q7ks0qK>K?K?K? @O?Ku2Ks2 k?Ku3Ks3 k?k?ok?Kz0@!" _e6Pk? P7"} 46y`UX4 Ky0F7PK?Yk`0q+dH94t_4zKd0y 8@H4@_]4zH?@H}7?@`8 zK?J74j4_4y_-4z :" 46U4 Ky0F(7K?YK?@O?7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"} 6} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#047F4K?Y4|@O?=7?4?#07@ `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#07 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"}046zF 4K?Y4|@O?+dH7 P4J] " K J 8h6J?@ @K@4+dH7 P4J] " K J 8X6J?@ @K@4k?7B@K?Y@7?k?7_@K?Y@7?k?7k?B4K?7O4K?Y@7?k?7k?B44K?7Ot4K?Y@7?k?74H |k?B7K?4H7K?Y@7?k?7_uk?_eK?K?Y@7?k?7B@+dH9+dH7#07pJ7K?Y@7?k?7+dH9Kpk?B@K?K(7+dH9KK?K?Y@7?k?7KY +dH? *KW h@K?@#047FP4&K?Y@7?K\KP7Zh Xk?o777_#=07:pJ877_4Ks_6z_4k?q4Kyc?7?qHk?K>@O?k?ok??7#A 47_ H 474 4"C`7 ]  4W4s? X  4H D4z7d 7K?YK?@O?4" 474H4z74u4k?ok? k?k?k?!ן77$4\!(  4" 4747H X  47!K>K?!K?K?K? @O?4744H4 7W r477Y4H44 474 44"DP6 ]  4_4?74744HT4 4%77> @"}046zF4K>k?7k?_k?k?Bx7K?K?7_eK?K?Y@7?k?ok? 77Ck?#07pk?67Jk?k?K>7K>K?JK?k?Q4(4?c?i4zk?Y_k?ak?!A7?Qk?K?!44BX7K>K? @O?k?o7CKZ J4Hz(_7h|PK?Y@O?k?o_}KCPK?Y|@O?k?o7CKZ J44k?HxPHzX`H4whHz( HwP_K? `4HyPhuHH} htK?Yh`(@O?"}046zE<4\EHk?ok>k>k>k>k>k>7$4k>4444  !4H 7_4_}4H( 7_]4 _E4H0 7_4 H0@_4H  H 9 HH_MK>4_5:xHH *Hz_5:8Hk?H5:k?_K>HH4H \ mH>7H_K>7_u77 __w0K>Yk?K>4_k?K>YK>K>K>K>K>K>@O>k?ok? k?k?k?!_4K}4# 4 0Kw  B44Tl4 7E4Kx\ U@7B4K4\7Ky $ _KZ_4_4Kx4Kw_M4K>K?!K?K?K? @O?k?ok? k?Id4_@#07p7J4z7J4zk?i4(4?c?y74k?q7?aH k?a_ 4k?a4(4?c?y7?a4k?iH hk?q_ 4_ 4_ 4?_ 4_ 4_ 4_ }4_ m4_ ]4_ M4_ =4_ -4_ 4_ 4_%@_M4Kd 8@HKY_HH?@_ 4zK>K?K? @O?Ku3!Ks3) k?k?ok>k>k>k>k>k>k>k>Kc D4?4 Kw 847& 4J? 4I _ 4?_ 44c?yI4k?q47?aHhk?a_ 4z_ 4 0@_M444B7?Kf!: 04(H_%4pH47Jh5Z H_u77_ 7H5Z7J5wh 77?ac?y4yk?aHk?qc?y7?a4yk?ak?iHk?qH>@B P4747O4x4 Ol4xK>YK>K>K>K>K>K>K>K>@O>k?7I4_4_}4"_=44 _4 KK *4"_44$_}446_e44J_M44&_54 4_4_m4K?Y@7?k?ok> k>k>7&7I4_4#=07J7:pk?a4(4?c?q74k?i7?YHk?Y_4c?qI4k?i47?YHk?Y_-Kz_M4c?qIt4k?i47?YHXk?YKK rc?qK7?Yk?YKyHk?ic?qK}7?YK k?Yk?iHKyT 0@7\}77B0447\4"07x06\M7>Q\ 7>Q7B477>Q\4"_6_4zK=K>K>K> @O>Ku7Ks7 k?k?7Kb@"@+d_H:ӝk}"04I6k?+dH:4 ]7K h@KKW 0KXJJJ?@K?@_K?Ka0I*!b"}04I6z k?"04I6@k?"04It6`k?+dH:4 ]K?+dH:K?]4 +dH:K?]e4 K|_M ZK?KD7?K?_MK?_K?K?K?_K?K?Y@7?7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"}06} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#047 E4K?Y4|@O?=7?4?#07 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#07 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"}046z E4K?Y4|@O?@7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"}06} X : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#047 E04K?Y4|@O?=7?4?#07  `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#07 h 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"}046z EX4K?Y4|@O?k?ok? k?k?+d7CI$H:K+dH:IK+dH6K"0JJ(]6 @0?4$h4H@*H$@ H@$@H c4h Ӗ96#7 F ӳ3#7 ""#r7@*H#` H@#8@H Bc4h b#477?q@JH" H@?@"H@74hX ғ h@H ? H77` 7X s`?@-@!7`2HH! H_@!7?q _ C?q "0]Y6 `  h@HD H BH0 0@H?@H?H0 @C?q4!24h 4 C?q04 s4K>K?K?K? @O?ˀK>ˀK>ˀK>ˀK>@ &  :H`*H  H_@>4hˀ%K>ˀK>k?ok? k?+dH3H7E`"7$+dH="0K]6 p!@+d4#HzB`JHz   `H0҇$z"!H#@ 4(?#rJLH40 x0H0hu (4+dH:"0KZ]6 @!(@+d4#4 bH"@$zHs RH6 a6y *6 96y4@H4C@He(Hx04h  4:4 ˀK>ˀK>7 vH| 2_4z  |4H yHa "h`84 zh`@4 sH 2@d "Hhd84 u @ Ha@H!a@Hs8Hw@ִ uTht84 6hd@_ t44 x4K>K?K? @O?H@4 wHb8  h84 u }o44M H??4@?'4HH?4A44 v+dH4A ht(h|0H(Hy07h 7 ׿ς}~o4Hb(Hw04Eh 44 4(>4H ԟc4@04k?H}044k?Hv(44Ak?ςK>k?/,/-ok?)k?17CKZPD7?a "0Hz 6 /4$ 10n I@ `$07?a 0N08G'1H1  B07?a4 0N0'G@4\@bׂ4HvP AhaPK>K?1K?)O?!/0-@/0,ԂX4HvPk?oK_P_K?Y|@O?k?/,/-ok?)k?1k?9k?A7CKZ 4Hf0IHe(7?qHP7' !҈!r7?q#]07Y / '00n `@17?q 0N08G'H  B17?q4 0N0$YF Yu`" =044: E4 17?q4h  0N 0&Fh 4$@4h% 4gHu4eh $BD@4h 4Ht4bh 4Nl44#047 E44h"046 E4$=4hHv4fh 4N44htHH}PӸh`PHz X hsh`(K>K?AK?9K?1K?)O?!/0-@/0,7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"}06}  : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#47E4K?Y4|@O?=7?4?#07 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#07 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"~46zD44K?Y4|@O?k?ok? C_ 7CHy Z Hv@R"~46yS4 D,7Pk?qHd"46S4 D7k?q4C?{ c?y7?a4z@c?{@w#^ 7ZpKa?49+dH9`+d4I47@77Jx4y@} 4I 4S4 77Bh7Kx xkc4K>K? @O?KЃ *KW (@K?@@4K:4K@k?ok?+d7C4:(`48+|#47]7 7 B#74S4 D,7H4 "460S4 7D44 y4? zK?YK?@O?+dD?dD7` @ \k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Y7$4 7E4:' 4 "& *44B444+dH76h6B4#+d4' ӿ@47?Hu6haB _&&8G&F} H 6}? X4#4 :#hw+d44*T4 &!Hv6hn4B 4 @7? Ht67huB ѷ''8G'Fu 8 @*45S4 D$75`4&P6?+d48`49X7 ]  S}@__6?`z  W WSL]HZDY@6?+d+dd-`Ѣd"d=5 CB4& 2 44PSl4 D7+d4?\ B@0@"5? A _5?B44  Hl5?hmK>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?a+dd `6d d48`7d hhld lB ғ@477p7:G7?  %%8G%F  @7ӓ  YgSHh5 hiA ѳf74<h RG45(=4 4  4-44 4 |@ 44@D 4}@_@U4_@54k?o+dH?Ka?49 @7C4 s+dH= }K?Y@O?A @+d#H7+d7pH9I7 `4K?Y z |@O?Ku2Ks2 k?Ku3Ks3 k?k?ok? k?k?k?!k?)k?1k?9CG+dGH74@7EB4# 46hfHf4hz+|@470 +4?E4?#7H7 7Tht_}4Ka?H?$ $X #@(`4:p[%4#rH7hs_4Ka?H?" " 45:[]5XI5:7[Y5: 4  Hi (HC 7haHC4R!)7hb+dH98* 4  HtHu6?h@b Z7h}!^45Y S4 D7 4 4@ (@HC8hdH J@@))Ka?4%7I?hi4_4=4CG4?W4? >4<@ `_4=_4ܜ 4 7Ghg4 _4]47Hhh4_}4%44_U44_4;o_4ܛM4@44P 7HjAJ4RJ *4 HuB4 r#474 0PR4Sd@7D4H(CH|7hf4@78hf4K>K?9K?1K?)K?!K?K?K? @O?4 Hy7"hbC8 _44+|480 D_4@ 4Z 2H@ 5 4 4D @H  HT04  0@_4 4Z 4H 4 4D 4 4   ^44YS\4 7D44CS+|4'0 _-4}4 4`\e4 HC BHz4\4""HC C04 04 4  hC 7h}HC4PT :44S4 D747hC 7hz@Hj7[I5ZS7745:[95X44S4 D754 Ha4*?hj+|470 W Hv6?@xhg7I 47IT7Ka?485@4 I 4 Ht4 I \4 eHtIHȼm4+dMH%8k?ok?C_4(!7CHzHt!*I@HzI7!`@IHzKa?49!0@IHzKa?4:!@IHz+dH=8 @IdHz+dH3` @I HzHzI 7 h@I |HzHzI d7 `4H  x hv `K?YK?@O?_K?Y@B@2?K?Y@" _K?Y ` `u `+|4`?`?@`?k?7_@K?Y@7?+dH447B+|4X450  4"j4|!4x 4L BJC8"j"~6|@ @44B!z"6@ JB :=:  >4:@_ Ϛ4,404@VJBx4z #7@? 4S@4*JBw *4z ""6@ ל424@UJC< "6@ 4]@4"JB "6@ ? 4Y@484X@46k?/,opk>k>k>k>k>k>k>k>k>k>k>k>k>k?k? 7F7#_ 7:7_7?,7+|4% FL`@Ka?4'Ka?4(+d4)+d"6/ 4*+d">62k?94+4 &4 (!4K?I? i9_%7?QC?i" P745@S4 D(7c?ik?ak?Qk?Y4: bI?C4 D5*7i?C70@i! P@ (8bIV86 RI|` (6$87? I_8 Iw`!6$7?_U@k?1@x jHuP5 @54 SP4D7 o ` ` `C?iL jK?aP5@5@4 S4D7c?ik?ak?Qk?Y4z6O\7?Q( @C?iD HwK?a Xhv(>o7?( 8E@ ( $8'45S4 D77?!C?i&!J@w!:I|K?QHzId7\!@I K?Q @I lK?Q @I LK?QIB8\ @I $K?QIr`\ zHK?a haI`HzK?QIH7 oHa A hbh `C?i (@HrK?a (h| p@ ZC?i }6$K?Q sK?Y tHqK?a 3 hu@$bC?i$RK?a B  245S(4 D X74K?96?4?x 45@DX47?1$p&8G$pF7?1q$pE 8&i01n0N1 P$pI7?1$pD Ht8'01n0N1 9$G'J 4h}Hu7w@uhsHq@p tH UPhuHz V(hvHr Qh|Hp 0haHbQ hbHa !hpH| <84? pHv 6(4?X qHu 5X4?0 rHt 4x4? Hs 3H4? wH} =h4? xH} 4 ? 4x Hz_ 4 ? 48  C?i& ( 8H} K?a pK?Q ( |HrK?a Z hy 8HqK?a 1 8hzhK?1_4z |_7?Q `@  | dxK?1 @ FTOK?Hz@ @I @@yKa? 04$4K>YK? K?K>K>K>K>K>K>K>K>K>K>K>K>K>O>@/0,+d4?H!49k@7+|480 @_ߎ 75kC7 _ :K7kC Ҁ_0 ǹ @K6kBK7?k@c?k?7_7?K?YK?@7?7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"~6} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#47 pDx4K?Y4|@O?=7?4?#7@ `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#7  7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"~46z pD4K?Y4|@O?k?ok? k?7#CY 7D`y KZH R\7_@ӅH|7? aK>K?K? @O?HsHz SR]7ӷ" E U46[4HzH XZ}@H }HH ERW6H B b k?!6 XZ YHx xHK?! u } dk?ok? k?k?k?!k?)C_ 4Z 4V$C7 4V$b 8V4Zc KHKT R_7K6K$KKRT6RU6KWK=Ҕҡ    `4744D47444&P4?eA bxcb4B_@hb` S@A x`zKHK'7?Q  H  E $$8G$F  Ц Ф4BS@A x`zKH  H7?Q K& H $$8G$F  Ѕ Є4BA bx h@zKHK'7?Q  H  G $$8G$F    4BA bx h@zKHK&7?Q  H  E $$8G$F    y}=4B"0c 7\42\apK Hp @4!|4BKGk?qK'k?y7?Qk?K?q  H k?K?y  F k?$$8G$F k? Јk?  Єk?664!~4 `K? Bp ]@K7? YH6G&=@79?4K3@@7?K DK>K?)K?!K?K?K? @O?7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"~ 6} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y# 47`C4K?Y4|@O?=7?4?# 70 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?# 7 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"~ 46z`C4K?Y4|@O?+d4h?+d@h?k?ok?k?KD 7Ck@(KX bBH(Huhu(Hw haHy !8@}P׿Hs0 !8`}PHvH He e  z b ` Hs s+d4=Hd0h`044@ he(H| Hw aJHb(Hvhv(H_ hsHx 8@}P׿Hy0 8`}PHxHw Ha !  : t  @ whd0Hd44 dHc([y4z4|K?YK?K?@O?4R4zH(4zR4Hb(k?ok? k?+dH87CKXKP E@4$+dH:@ 4%@4H+dK847k?!45@  Wk8HK8`KXKP 8vwjH@h@@4HKXKP }a@K8bHK?!k8HJyXJtP "K>K?K? @O?" 46R4 7C 4yK>k?ok?k?k?+dH=4$+dKH&7E&"(4#@ @H}HtJH"HKPKH <8C֟ <8cHJHj`HKPKh V  ]kPHK@KPKX   xhkPHJPjHHH!RHb!x@_ 48h|7XA7`Ha Ha +dH<Hbh\8HKHsS!@Ha K?YK?K?K?@O?"~ 46zC4#> 7:4C4H" 46Ct4}Hb" 46C<4W" 46C 4*Hak?o+dH?Ka?48 X7C"~ 46yR4 C7+dH:(G4+dH4肀 B# 47@R<4 Cl7+dh _4z+dH7JP jPK?Y@O?k?ok? k?k?k?!7E7#76_}7:+dH?KP kP+dH7H9k%HH6jPH3K>jt H=K>k(H:K>k\0H!4:X@49`_4z4K>K?!K?K?K? @O?k@(4k_H@@k?o+dH?Ka?7#49 X7k?44k?4_k?K>@O?+dSH?s@ _    K>}h8k?77_k?4k?7k? k?_k?K?K? Z7K>@7?k?77_k?774k?44_mk?K>@7?+dH?Ka?4:_ @+d@H<+dH7+dH8JP7h@ k?7_]@K?Y@7?k?o+dH4JP7CJX (@+d_H:_-4+dH?KP6KXH78+dH8KP73kPK?Y#@O?R 4+d7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"~ 6} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y# 47 @Ch4K?Y4|@O?=7?4?# 7  `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?# 7  7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"~ 46z @C4K?Y4|@O?k?ok? R 84hKy09+|H7p+|H:xk?7k?7QT4Hx0Hy("a06dhd8 8a"Ha8H} h}8Hb(" hu(H 8@z`_Hy@ 8`z`HxH|( <  7hv(Hw0  @hw(Hz8 z44H}([9h} 4 t4|K>K? @O?K?Ql4Ha8k?oKTk_87C` 7ZHx0Hw `:H}R Z4zK?Y@O? hs hs(k?ok? k?k?k?!7SC:7#44 H79ֺ 1   Ӷ7 @?79ן 1  D JfJy)4 H P4H$ H[y4y b4H?@44K>K?!K?K?K? @O? H  H  m4k?ok? k?77E7$7?_7? # X7 p4 h8H04H( 4ABH8H h8H(W h(H 8@`_H@ 8``H0H( a  yh(H < ?`h(H(h 4H8K?K?JK?K>K?K? @O?Ql@H8k?ok? k?77E7$7?_u7? P4 h8H04H( 4ABH8H h8H(_ h(H 8@`?H@ 8``HH0 ?H( a  xh( <`h(H(h H8K?K?JK?4K>K?K? @O?Qd@H8k?74_40ˀKK?Y@7?k?74_=7?2_ˀ2K?K] 2KK?KK?Y@7?k?#> 7: 4CP4K?k?ok? k?K_7C4 k?!HwH  JHHK?! 7H?@HHw4䟍@K>K?K? @O?@7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"~ 6}  : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#0470C 4K?Y4|@O?=7?4?# 7  `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?# 7 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"~046z0C4K?Y4|@O?@k`@@ׂk?oQ4 Ky4?KwKx07Kz0@ Y@ |_E@K?Y4|@O?k?o_7CHkHxkxHw kw0YHzYm4zK?Y@O?Ku4Ks4 k?Ku3Ks3 k?Ku3Ks3  k?k?ok>k>7E@!ky0@ : 04\ 4k|7aXkeKa?4=k} 044#4Q|4 k|K!@K46?`0KK6kB_%Kz74FZ!@KzK\7?`UKxK74kC<#047`C@4E@44Q,4 KyBT7KyB4K>Y_Kz4 Kx4_7?4Z]7? k`07?Y40F4_Ky0K>Y04F_KyK>YK>K>@O>_]KyK>Yk?7Kz@ \ @k`K?Y@7?@P@K?@ @Ku2Ks2 k?k?7Kw78_4`B#047 Q4 KyB74K?Y@7?k?oKw 7CˀK?Y4z_4@"046 Q4 KyB74\Kz苀 @k`4K?Y@O?K0??+|H:Y4y/"0?_+`K?Y#07P4Q4 KyB7+`7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"~06}x : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#047B4K?Y4|@O?=7?4?#07 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#07 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"~046zB,4K?Y4|@O?k?ok?7DQ4kKv84$Ks077Ku(7y 4Ks+d4?`k K|h|(K}h}0Kaha8Kbhb@Kw0hwHKKhtPKhwXKh}`hvhKt0YhtpK_ hx_ h|k`4?_ kwk|4?ku07\ Q$4:k|8#07@7YM44|K?YK?@O?k?o@X7C_ HzHuHb4?ku8Ht 7z 4yktHw(4kwHt0+d47`ktH}8k}Hs@ksHuHku0HvPk?H}XjHs`jH|hjjHbpkb0Hvkv0H|k|(HaxYkaYE4zK?YK?@O?k?o_ E@_ M@7k|  7:Q4#k|8#07@7Y4k`4?4kwk`Yk`K?Y@O?k?7Kz8@ Y@_ Uk`8K?Y@7?k?o+d@?ʓ04_ 7C@x @@kck`Kw86k`(K?Y@O?#>0479PQ 4 k|k?7k?_ 7:k|_K?K?Y@7?k?ok? +dH77?Ky0A7C7a7+dH:7]h=_]7+d4:`k?!Ek|kd0Hv`*H|C4 K?!E4K?!E4y4?Kx4kt0K@kuK0kbK>K? @O?k?"~046yQ 4 K?k?B 7K?k?7_ @K?Y@7?k?ok?k?Kw0ɂb`7CKx87 }Kx( P4$Kb8Ky04ZY@Kw867y Yq4Kt8K(6_ #BC? 7?6?B4?6?K867@ _@Kv kz UKz8Q6k|87 sK}8_ !C? 7?6?Bt?6?K867Y' ky0 <7z ku(Y4"~0Kz06yY4PK|0+dH9h`+dE4:`Kt0 +d\H:+dH%4?h:k`0Kz _@ |K|0H8`k`(  ky04?   d+dH"hkb08K|0 >0449Qt4 B7k`0Kz @_@ |ˀK?Yk`0K(`2#047 Q4 B 7+dH9 @@4Kz @_5@ |K|0K?YK?K?@O?K(4@Kz0Ƀ@`8@KKw76kxpky@k?o@7C0ky= "KPk (@Kz@ 2Z4y 4K?Y@O?ςkcK  JKw`:K Z_ Kz :@_ Kx 8@@  @7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"~06}x : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#047 Bt4K?Y4|@O?=7?4?#07 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#07 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"~046z B4K?Y4|@O?Ku2Ks2 k?Ku4Ks4 k?k?7+dk?H9 k?YY@k?YAK?K? Q7Zk?K?_7K?_K?+dH?K?k8K?Y@7?k?7#0k?47 @QP4 K?_7K?Y@7?k?7#0k?47 `Q4 K?_M7K?Y@7?k?oKch` @k?HzZ 9K? @Hc`?@Q 4(Kh7k|hY )K?Q 7 |K?_7 ` `h` K?Y4|@O?k?7+d^-H:^ 4K?Y@7?Ku2Ks2 k?Ku4qKs4y k?k?ok? k?k?k?!k?)k?1+dH9 $(7D+dH#Ka?4)##7?Q_]7?Y"@K?YK1  2Ky1 #K?Q@#Z@#Q h4X"0476 pQ4 K?QZa7!+dH?!C?4 7?+|490:  r4D4Cz C? (7C` "?@3 ?C 7Q (4 7+dH&4? 4Ka?4(  _5: H4I h@ Ӝ0 04?@  dK?YpK?Q_5:@ `K?Y0K?QQ4XK?Y7K?Qkg1kb1 _@+dH? k kcP+dh#+dH= }K?Y z_K?Qh` |h`8h`@h`(h`0_h`PK>K?1K?)K?!K?K?K? @O?Ku5Ks5 k?Ku3aKs3i k?Ku3Ks3 k?k?ok? k?k?k?!k?)7$KY 7C74 !4K`4' KzX *_@K`[KzXkc`#0Hz[e7 k|X!h7Hy @_m4_KzX X5?  KzX 4_=4 ?@ :4hu 4\ 4 4Hs6tht 4K>K?)K?!K?K?K? @O?+|4$+|4hv }4$k?oKw 4#Ka0KbpA@Kx0!Ks6tkt44 4K]@ *0KVH0kvxKY@$ *0KUH0ku KZ @?oK]@K}#>0KzHYm79 Kzk?+|#0KzHKw48Y%7 #07 k?KzHYKxKzHKxxYK?k`4kspK>@O?k?ok>k>k>k>k>k>k>k>k>k>k>KE7D H4?H8D 0@H @H8$?@$(4H8$4'Kw04(Kx04)Ky04*!~04 HaZ7?   ''8G'F T 6"`4hKu@`7H  Y)5y H5@4K}0 7?7t0&Kz0 Z &8G&F | 5"_-@Kw0Kx0Ky0HHB"4($k?!7?'58G&F a7?Y  _ 'P'X8G'AFAS 7"aZ4hKa@`7H&  Xe5y 4($' 7?HH5_ 5 HK?!8G'F4  `zK0 7?7y0' Kb0B '8G'F 6"^@Kw0Kx0Ky0H @H8<74 K}@ `4|K>YK>K>K>K>K>K>K>K>K>K>K>@O>k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?YKe@7Dk?a7 6_4#Kw04!0 0KzHK?aY%4  *EKzHY 4 0?@+| 04)KzH4 @Y 58Ksp6tktp_4K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?A$ 0 (KzHK?aY 4 P(@K?a4 pY 5@4 @044  7xKzHY E4 45 (5KzHY 4 045k  5kjg K* K KzHY 4 0B?@+| 04)KzH4 @Y e58Kyp7=k}p_u4H8 @@KzHY 4 _54Kxp7kzpKm04 ==4* =/K>4+4 K}0 KzH7 ?K?aY e4  0   KzHY 4 455 (5KzHY 4 045 @ g KzHY }4 K|p7kap_4Kv05)6@ @>4 K>k?ok>k>k>k>k>k>k>k>k>k>k>4 kl4_4#+dH$#P4Ka?4&Ka?4'+d4(+d4)7?!!~0Gp4 h@GP4 H@G04I8 @G4I8` G4"8@G4"@G04!@G 45y 7Xm5Z 8@KzHY5y @Kvp6k|p4G4 @G4K8 k?G4K8J4GXKK8JmG4Kk?G4k?KzH5y p5Y5`KypG4KG4k?KzH5y 5YU5WKyp7=k}p_e4G4=7 2#0KzHY7 Kwp6kxp 0KzHY4 Kjp5Kkkp_ 4+dH&!H4Ka?4'G@4 @G 4X]7 @Gh4  H@KzHY4 Kbp4Ikip_ 44G4KzH4 Ye7Kap4(khp_ u4G4>7 @@KzHY4 Kmp5knp_ 4K>YK>K>K>K>K>K>K>K>K>K>K>@O>k?ok? k?k?K_ 7C7$k?! k?)H}H04% 04zK?!_UK?)k?KzH4 PHxYHwKxp7kzp_ 4HH0Hy ?g4zK>K?K?K? @O?Ku5qKs5y k?k?ok?K]P 7#4ςHkx_}@ BKa?H?4c @z ߋ?4c@4\? rˀK?YKa?H?k`?U@z M\_@Ka?eH?4zk? 04 Z]40ςK?4 Z-40ςK?4 Z40ςK?4 Z40ςK?4 Z4 0ςRK?4 Zm40ς"K?4 Z=40ςK?4 Z 40ςK?4Z40ςK?4Z40ςbK?4 Z}4 0ς2K?40ZM4 04K?YK?@O?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?a4$Kz0P D4%k?Kh0  7?7j0%@Kb0B 444'8G' F  5 P 5z(kfKaPk|@H( "`@4)+d4*!~0Ky0Kl0 ,h7,I@섰I  :҇#䃲$j IH koxC@I@ 0 54a2I( 7 JI0 :IXǘ(@K?4z5_5I!@IZz_e5 P@_u5IK 7II_ 5XeI I@`0 kfI@ 04?I =Ky0XK?XKz@k`@K>K?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?IKTI@KA >I@K?_5IK37m4?I_5_]5 *IJ55_5IK]'I@K\ ?7K?I@u@e@0479PP $4 7A,4yKa?43 ̢ksH_4z+d_ @>KzX[KzH>@#047P d4 7Al4y}KzX[!@uK?Y@kz@ @K?@ @+dH8+d H?4 k@@@ @K?@ @+dH87h?C RCt B76h?B@ @C4?7@@ @K?@ @k?7+dH7 RD҇D  P+dH?K@ k@ k@K?Y@7?H?K@  k@4k@+dH?4 }k@"~046z A 4 MK?Y@ @K?@ @k?7 D@@k|04Ѓ<`:k`0#047P4 A7+dH?C4X B7h:D@C4k|0K?Y@7?C @K?Y@ @K?@ @@k`0@ @K?@ @k?ok? k?k?k?!k?)k?1+dH?7DC4@] 4#7hvHC4Dy h@HȠxC8  !7hC ZhK>7huB46! 7+|490?U@0D4?E@+dH7  Ph5:747X58 +dH? 4k@H4jH H|7 haC@K>K?1K?)K?!K?K?K? @O? ^044Y P4 A7C@mK>k?o+dH? 07C_ @+dH7_ j0K?Y@O?k?7+dH? "_ 1@+dH7j(K?Y@7?7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"~06}X : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#47A4K?Y4|@O?=7?4?#07 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#7h 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"46zA4K?Y4|@O?k?ok?k?k?7C7$7^)6k|4?kc+dh kdkekfK?YK?K?K?@O?@kzKu6!Ks6) k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?i74k?qk?yXk?K?yX7HhK?74zI7$:4'Ka?4)4 \4 @4 t4 4HKsЈ!5KtȈ!HaZHw Ҹ x( :5A @ 8 x(0`HbI? O #P ߈ "Ha /  ( Hx5@jI?Hv#h  <ߋ?HxHzO Ӱ ( 8wHu`H|  85HaHw Ҙ x( :5A@  x(0abH W K}Ј KsȀ!* W85K?q Y4 `@H|  :HzI?W ! ߓ04HvK?y Y m4 ZHp  :HaI? 7 !` ߓ0!R4D4zHhK?4z7<KsА04K>K?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?_@5@_@@_@%@_@ hKu4aKs4i k?k?ok? k?k?k?!k?)K67$7CVak?1Ka?H?H4%"X  | *HC 4 4H!rH # ҙ4cDlK?1HA2HH !H ߈ 2H# Ө4 4H 44HH y4cDK?1HC@jHH!(  Ӽߋ?HH Ҩ(8O+`H<Ѓ 0@Ha`H 0L4c4|K>K?)K?!K?K?K? @O?_@@_=@-@_@k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Y7#D\k?aHB7Hh  4D b4xW "K|Ј @@KaȈ *4N"x@KgЀ"`@4&4x44 B4 4 N4 |Hw "4 8 ( HH4 8 4 K?aҹDT6Hw 9 "4@ Y. DK?aH4aH  85?K?a85D4Hw  8 H|^@4H@rHt >5@ *K}Ћ>HwKsȊ`>Hw KzЋ@=Hw4K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O? >H4^4 Hw4?  8 M4 KxЀ B = 24 K?aDH=7  Sn= K?aD05=Hk?ok>k>k>k>k>k>k>k>k>k>7D7#K>k>6Dx74D4yHwF7DH4 4 N*$z 4 āx j4 Z4 ⁸ J4 :4Ѓ *4 4Ȃx 4#4@(04X&4D%4v%4 R8%4 PX%K|Ј 4+KaȀ 4xX%4 |%z4 x4 | K>D4H %* 8%@( 8$@ 7( W8$KxЈ Kyȃ ?O $?7 4dz4N?( J4@_(0:4X$* $KvȈ$ 4N4 @4 XH (  K>D4Hw`jH  R K>ѹD4Hw@H L? # @H ҹ4DXK>HsdBHt >@ ( "  8">HKyЋ "bKzȃ@>gHH4Hb D 4J? @KuВ 0 44 P4 Kv47?a74xI7K?a74pW7?qK>DH7?qP44D j4x (+`KvЈ BK|Ȉ 0@KxЃ<]4)4ND4DK>4_4yK>7D4D04K>4_E4y74K>YK>K>K>K>K>K>K>K>K>K>@O>k?ok? k?k?k?!k?)k?17D7%k@ 7] 7C(h0Ha4pOD@77D54(D5:D4H4D474_m5H@!@74DP4H h7H`RH 4z 2k?4458_47D`5H07]4H hh4D4H 6uh 7 g4 H^4pKhȁ OL4p7k?AD7D4(D4HKv  _4G 4K?ADX4H04]E44 ?hh f 4K>K?1K?)K?!K?K?K? @O?k?ok? k?k?k?!k?)7D7%76O487D@7D07?yh` 44D0h`( 7445_e4x" @H 7?yD 4HbH 4P"b44z_4H \ 4R% 44 O4 K>44_ 7?y7Dp474z_%4K?`4Ka?K?y4%H!  \ 8@ \aӚK?y d K?yK?4$_HD7?yKz74x] 7K>+d4 h44K>K?)K?!K?K?K? @O?44O4 K>4z4_e4=K?\ @mK?yk?ok?7$_6H`bH\ ӳc BKȀ Kw "Ky 4 87K?YK?@O?k?ok? k?k?K>7F7%k?)k?1_4Kx x74 bf H4y?  :44L K>D 4Lp4|D K?)K?1] 7?4LKP H7(D K>4|K>K?K?K? @O?K>K> (k?!K?)D64|4D p6K?!DhK?)M4|k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7D7%K=k>7>4Dk>H4mp4K=k>4(Ka?4)4 L4 !4 ?4RH Z#2D7>KbȀ'5HGZH X'Bk?4N4K>k?54k?_7>HH6D 4H ,7'+4pO @77DH6D86Z(6QHD 6:C56jMh_4Ka48kx75W 7?A6:D7?ADX6K>7]6X+6C5D 4H *7>4p HH&  ҜH O _ 7?SK>5*76?Kh&H@K?@ H4\"5 X80@ X0 R5I@@ ?5 H&H 8&rH5FZ ӳ8 0@ X05Hx@ T?5XH$I?$: ߀$I?H$(  Ҽ=oI?HO 7W?4P# 5`b  R Dp4H5@ H ? H ."BHKsЈ Kyȃ =@I?#@ | 2H/ 4 4H=e@ BKb 2]=@H5?Z =@K> zH5 `bH/ 5pY4  0@H 4@ _(0WD7>Ka 04H 7OӹD04 Hk?K>47>k?_k?H#?479PO4 hK=ىx BKx5pW-7?7?D4H5 ;K}4D(44LD4H_@@Y@@\I@UHKP H7(C4`Hk?C<7>k?4N5k?K>4_7>H_I@4Nk?4K>5k?47>_5k?HH 4D @KxȀ B4N 2 9C45w ZKz JH5a w!4C4H!Z4z!JH5WA2 4zy!C47>54_7>7CT7>K>]7 R4zC44zC44C7>HKP "5C4XH4`CD40H C45HR@C7>р 4eHdC4K>4])7CD4C44z(C$4zHW14z?u44K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7F7$K=k>7>Ctk>k>K>k>I#( (k>C4zHHc`?@K>IE( BHh@0@H @Hh@KrȀ 4#H`H 4\ k?O4p7CD7C44(4HC54 ?hh4K>H( 45h(_!474C4HC7H ъK>K#K>5 (k>4X4@4z4 D4 v4 R4 P4 x4|4N6 ! 8h@ =( ]8H@ }( 8*KyЈ KzȀ  ( 8@Kzȓ@ ғ 0 87d:  8 @ =( ]8 `@ }( 8 B (@ ( 8 @ ?O7CK|Ј#r #b4k>C7>64_7>H< H$7K>C7>J:0]7$7k?62HC6Z466X_4K>J3P7`Pk>7KxȈ%J6C47H@*H =K><6KlȀ @C7>Ks+|` 49`049 7>CDK>C7>I0])77HCl4"K>6pW7?a4C7?aK>k?4k?K>KX(K>_KW0"KmȀ RK>J( 86(HK@#K7?HC,7>Kb4DkdH4K>"  KaȀ "O4p7C|7Cl4(C\4H K>4?K( 8K>JJh H6J?@74hhk?4HC$6:6864_4HP`7K>6k>H<7KxHh@@ Kx"?469O4 hK="46O4 0K=!450O`4 K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>!45O4 EK=H 86 (0:@HC 7HC t4:(HC \7HHWaKEʅ k?o7hd? he?hf?hg?!hh?)hi?1hj?9Ka?H?7Hhy?ACZ76"p4&  BA4 *4 H? K|ȃ"24 \""HA"h5 <߈ "A4 4H j4 4 HH4"@ \ߋ?4@ ?( _8  5]K?K?~4p > k?k?757W q5X I  @A: `5(H!: Ҝ  [ z  @?5Kz] )59 7ˀ(4~_@44~Hb>Hj?9Hi?1Hh?)Hg?!Hf?He?Hd? @O?^@@^@H[ E@@C 4z?q@ r 0X@ C <4z?q  0 4?@k?ClHz?AHw?A44y?q_4 Cd4z?qH> ς=4~k?77Y] IKzK?Y@7?k?ok>k>k>k>k>7C7:K>k>74C t ` 47C$7>`04K>45^}7>郀"@C7?C7?1C7?Q44_7?K?"`7\m@k>C 7?K>7]97? #@7k? 4K>Cdk?q4C 4H` 7H X!k?K>7>7? k?_K>"X7x5 B4CT4HBH| !C\7?QH YCD7?Q4k?K>7>7? k?_K>!7!4C 4܁H44O4 @544PO4 5 0D4`  4D`>M@k?444_7?Qܞk?Cl4H7@"H ??e@\K>C7>45K>YK>K>K>K>K>@O>7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"6} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#47 @4K?Y4|@O?=7?4?#7 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#7 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"46z @ 4K?Y4|@O?k?7K k?97 k7?9]7?K?9 "Ka?"4:@W]6 P#7 `4OX4 Ka?4:@W7K?Y@7?@K|@K|k?77?]7?_K?K? *Ka?#K?4:@We7 K?Y@7?Ku7Ks7 k?Ku81Ks89 k?Ku8Ks8 k?k?7k?_k?Ka?4:@k?K?WeK?_ @_-7#K?7 W7Ka?h _4K?Y@7?Ku4Ks4 k?k?7k?1k?)k?!_k?9Ka?4:@k?K?9_m7?9Ka?H9@78?`Hh8@Ka?H?H7h7H4K?Y@7?K?Y 4K?YKu5Ks5 k?k?7Kk?17k?9k?)@ ky7?9]U7?1_-K?9K?9 *Ka?#K?14:@W 7 "46 O4 Ka?4:@k?W 7K?)_K?Ka?H5@6?`Xh4@Ka?H7H6h3H4] K?)K?Y@7?K?Y 4Ku4AKs4I k?k?7+dH?pk/17Yk/)k/! 8k/97/9_m7044_70K/Y@7/k?7+dk/!H7p7?7k/9k/1 8k/)7/)_70K/9K/1_70K/Y@7/k?7Kk?17k?9k?)@ ky7?9]!7?1_K?9K?9 *Ka?#K?14:@W 7 "46 O4 Ka?4:@k?W U7K?)_K?Ka?H5@6?`Xh4@Ka?H7H6h3H4]K?)K?Y@7?K?Ym4k?7k/17Y70k/)7/9k/!_k/944_70K/Y@7/k?77k/!7/)k/970k/17_k/)K/9K/1_M70K/Y@7/k?7k?1k?)k?!_uk?97?9k?"46 N<4 Ka?4:@k?W7K?9K?_K?Ka?H4@6?``h3@Ka?H?H7h7H4+dH:@ @X@N4K?Y@7?K?Y4+dk?ok? k?7$7_k?) 44y N4 Ka?4:@k?!We7 Zk?44y 0N\4 K?!K?)7W 4P444y N4 K?!K?)7W444y N4 K?!W}7N$4K>K?K? @O?k?o7k?_=k? rk?#47 N4 Ka?4#@K?K?7W4zh"#7 p4N4 Ka?4#@K?K?7W54z"46 N44 7W4zN4K>@O?k?778#V7 K?Y@7?7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"6}  : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#47_4K?Y4|@O?=7?4?#7 p `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#7 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"46z_4K?Y4|@O?Ku7!Ks7) k?Ku8Ks8  k?k?oCW4Z!7C@u #?479N4 7_4y+dH:_4+dH:K_4KX4*7+dH<H (@+dH3Jtp֟_jtpK?Y@O?"6_u4z+d? h<#47 NL4 7_U4yW]4+dKu8Ks8 k?Ku8AKs8I k?k?7+dk?_uH: (@+dh K?Y@7?_]K?#47PN4 K?_7W%4u+d7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"6} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#47 P_ 4K?Y4|@O?=7?4?#7 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#7 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"46z P_ 54K?Y4|@O?k?o@@L$@Ky09+|H7 0k?+|H# 8+dk?4N4:k?Ky09+dK?4N4:7y1C? H@+|470479  ?79+dH8+|K>4 `7@O?k?ok? k?k?k?!KY 7C4$4% KzH\4x p7K11 4W!4 :44N44 Ky@7_m44cHy ?M@K>K?!K?K?K? @O?k?o\ k|H4y@ky@+|_e4: 4wPkw@7z'4_5k11+|4: 4x`_ kx@K?Y@O?@ @K?@ @k?oKwP7?KyX 7 h7VY4xKxX  kyXK?Y4|@O?Ku4Ks4 k?Ku6AKs6I k?k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=\7Dk|84#]4] )4Y4B@+d4:k>\4$7k|0+|4%0+|4.0k> +|H/ k>+|H6 @k>+|4 @H4 Hk>!Ҕ+|k>)H= P+|k>1H9 X4+|k>IH7 `+|k>AH? h+|k>QH8 p+|k>aH: x+|Kk>H3 +|lk>H5 +d4&k>qK>Ka?Jk>4'+dk>4(k>Ӣk>ҭ4 k>4 B4 Xk>9k>Yk>ik>yk>]4ѿK>  8@X@H+J7hC 2@K0H26hB ?@hH+d4:4_=5+d` A4 h5H+@  ZmZ@?6A4\]+@@KzH\5Kq%`7$I0 _7 JK>$ K>K>P K @I$ 0 _7 JK>)$ K>!K>!R K I$2@0 _7 JK>9 K>1K>1Z K#0 _7 JK>I K>AK>AS K#B 0 _7 JK>Y K>QK>QU K"@0 _7 JK>i$ K>aK>a\ K"R0 _7 JK>y K>qK>qJ K!`0 _7 JK>D K>K>Q K!b0 _7 JK>D K>K>Y K  0 _ KK>$ K>K>\ J z444@4k`H :+dDH9[@HD7!"46yN4 7_)5HB4 HX -@H+:7hC +(@K0H+ 6hB ?@ HHN .( H6hII7I0 _ KK> K>K>Z J," H[ i4tӎCL5hH .H6XhH6hB  -8  7hCӭ+dH?5ѿ?յ@IU@H@6?47? 86C  7C?@  N 6I74|Wy7I 5IH 6V7?I4W  \5uѿ7?[ hӎ4t p@C5hH4=4th 0HC7'7h4z B. 4w+dHC4z 8 875B84A@hHZ@e@HHC  n bC? R7hC ?7@ C??7B+dH: 7?9k?47?15^7? @K?1 #_7H6h4H\7?BP7?\K>k|0Ky x444@4k`H :+dD H9[@HD7F 5H7h #8=@7z1VY58@\ 4 H#704XQ5#:"56@6:_ E5!7Kz0 :N67697U6h@Ka0Ku8  P 5N69Ky8 7Um6X60\-7z8 k|0Kz85_ 5h?M7Kq8 . P 5N69Ky8 7U6X?M60 5"@h2@h- 5hkqX .5NknP075N869 6/7 +|H: 6V685Ȁ  U%5K}8k}(kn8Hkq Kp0kphko07?A(hHKn0߀@Ka(!U}Kz8\@K !hK|(k|8Kbkb0k`(HKn0ߟKa(C? @5H \E@hHAK> _H+dH/ @\4Xe@4@H6hB @>gHK0H>=@6hB  ?@H\K>>mk|0\@K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=+dH?C+|480  "7C  ?7W7@+dh:4?YH7+|480B ` *6kB @?6@@ @K?@ @k?7#47`N4 _Q7K?Y@7?k?o7C@ k?+dH? ҈ x@+dCH: "K?[4z+dK?4[4zX+d@2C7K?[4z+d[4z+dH:E 4yK?Y@O?k?ok? k?k?k?!k?)k?1+d7(H97E4 4_7?I7+dH)A?4&+|450 !`0@ALh7 "`:4c?y7?y44_m42_c?y4 B47?HL47?44_4@@A\@HC70@h7 0j45 2 44N4 _975B"46N4 47_4HC4X!44 @2#470N@4 ^u7444_-4A @+dH3` C?Iҙ_4zK>K?1K?)K?!K?K?K? @O?7hB 8 JA@HC4@ 77h4 HC"46M4 7^5AX@H!:C?_M4zK>"46@M 4 7D44^7A@H C?_4zpK>4D 5DX4A0@H@ C?_-4zK>K?)K?!K?K?K? @O?@ @K?@ @k?ok? k?k?+dH5$ 4_7?qk?!+dH?4@CT 4#7hzKa?H?He4&#@ < H@Z@7C\47H|`HHy77hw#@B \?HyHxC+dH: D@U 7Hu M<7+dH:Dh7#47 7U 44C 47H| U 4HC4Xd"@D 4 @D H4!@D4+dH:+dh% zk?y47?yc?Dk?+dH:+dD49@+dH9`+dDH:HC 7h}HC78htAx@C?qK?!_K>K?K?K? @O?_4K>W @=@W a@H7Ahy"46y0M4 7D `44z^7AH@C?qK?!_ MәK>@ @K?@ @k?7A@+d@?Ԁ 7+dH:(79+dH:xB@@T@K?Y@7?@ @K?@ @k?ok? k?7CA7? 7` 4?\404 e 4@d@@X)4K>K?K? @O?@ @K?@ @k?oA @7?``:4\4y@@K?Y@O?#47Mt4 4y^7@ @K?@ @k?7+dH6 @+dH?C4@ 7h:H<C+|490?  R4T B4B 2"46MD4 ^ u7K?Y@7?@ @K?@ @k?7#470M4 ^7@t@K?Y@7?@ @K?@ @k?ok? +dH8 4_7?7A @4"7`86`4M4 7^ 4*4Mt4 7^4@,@+dH9 C?Y_4zK>K? @O?@ @K?@ @k?ok? k?A7?!+dH?C4X4W x4+d7Ah=+dH?C4X8 (7+d7Ah37A2 44M 4 7^ 44C?9 RK?1@B@2 ?449M D4 ^ u7ȀҀ +dH< C?9 k?K?144k?44[k?ȼP4_C?9 _44YM l4 ^74@$@K>K?K? @O?Y7?! Zk?!44c?q7?Yc?9YMk?ik?17?!Y-k?)k?44k?44[k?744VA4P444yHX4@ @K?@ @k?ok? k?k?k?!k?)+dH6 4_7?7+d4$4@4XHZq@7C5D7HGHC 7hHB J6hB 6hHC=04?H@$@+dH< @C?9_ 4zK>K?)K?!K?K?K? @O?@ @K?@ @k?ok? 7?9k?\a7?1Al7?A+dH?C4#+|4$0 ` R7h}CҙA|7?AHC @?7k?A7?i+|H? k?4K?7?A^7?i (7#K?1K?9^7Al7?AHy4[7?iA<7?i[4zk|0K>K? @O?@P@K?@ @Ku4Ks4 k?k?ok?k?k?+dH?+dC70@h5+dH$@+|490? !4Z 74P_4 4`_4 2d+d_4 Bhx+d4_4?4f@+d44M4 7^4+dH:E+dH<KH"(b@2"46MD4 ^u7+dH6J h ԟh bdRd :b R"46zp^]4(+dԟԟԟ+dH:+dH9V 4 Z 44yM44 ^7^74z^=7@ @K?YK?K?K?@O?k?ok>k>k>k>k>k>k>k>+dH3+dk>H4+d7Kk>H# +d7$H:k>4)Z14 @I& 47I?C] 7i"I?C4X *7i?CY 7i<I4B!A@b7 bZ悀4z"j`#I?CU 7i'I?C4XS"B7i?C* 7i*I7B"RA@7 0j44 2#47M4 ^744A#47M4 47^44z _44YM(4 ^Y7K>Y"46M4 7^ 5@ @`K>Yp}@44zD4  ?4490M04 ^a7@@K>Y#47pM4 ^ 7pK>Y@:!45yM4 ^744zD4 CK> 7Ct7| 8@C 4! @C4!4B 4z 44Zu4C4| @Ct4k k?+dH94Ck?k?44 4Z=44C4y`K>"46@M4 7Cl44z^7K>BK>@4@K>YK>K>K>K>K>K>K>K>@O>@ @K?@ @k?7_4K?Y@7?@ @K?@ @k?ok? k?+d4%H!Zak?!H 4@7HC 7hHC4XW 7h4Zy7?C?  CK?!k?)C7Ka?43|!H@CK?)!(@C? Ka?49 "460M4 K?!^7@l K> _44YpMH4 ^y7@@K>+dH98CK?)K?CK?):"46M4 K?!^7@l K>K?K? @O?@ @K?@ @k?ok? k?k?k?!+dH$4#k?1@? [@4$HaKb0" @[ E4z k|0HC+|4%0 4!X4D 7Kw0C? [@Kw0Hv6hC ?C?4ˀK>و " 4D847hzCӹAK?1HC8 >@ >@Ku0@4K>K?!K?K?K? @O?@ @K?@ @k?ok? 7?1[57?9A<7?A+dH?C4#+|4$0  R7hzCҙAL7?AHC  ?7A7?a+dH:@ (@C @7AT7?a7?k?+|H7 47?A]I7?a `7"K?1K?9^y6x7?AA@K>K? @O?+dH: `@Ka?C 49+dH:C4+dH:+dC49@K?C4\?/7?AKzH[7?7?A ?449M4 K?^ 77?A@ @K?@ @k?7+dW %H:+d[4:k|0K?Y@7?@ @K?@ @k?7A (@ 0+d4h?\4@h \4YU@@@K?Y@7?k?ok? k?+d7#H97EY p7Ka?4:E R#704MX4 +dH7J7^iH+dH?Ka?4=  2"46M 4 ^ 7@v :"46M 4 ^ 7 `Hs+dh3@wH| 0HY4z4k?44 k?44Z k?K>K?K? @O?@ @K?@ @k?7A7?k?+dH?4XC Z4+dH9 K?_7?@@K>@7?7APh:+d@ @K?@ @k?7A7?#7U7@@K?Y@7?@ @K?@ @k?ok? k?k?k?!A @ @@H@K>+d4#4@4XHC 7htZIHg7] 4HxHC 7hsHw6hB?M@7?@HhuK>K?!K?K?K? @O?@ @K?@ @k?7A@#7 7 @7K?Y@7?k?o7Ck?7?aAk?+|H7 K?7?a\K? Z#47 M4 K?K?^)7K>@O?A7?`"7?AP7?a7?A7?a+dH94[7?A7?+d[4:k|0K>@O?@ @K?@ @k?ok? k?k?k?!+dH&7EY4'H 4@7HC 7hHC4XW!J7h4\ @ @@!p@BL4!7H4!7+dH!h@L4pk?144pUM7K?14jH+dH=j8Ka?4449BK?1h  440M4 7^4@` K>@7?q+dH' 74_=7?q Ka?49+d447@B47B \4 C4 @C4+dH?8 R"46 @M@4 k?9C4K?9^Q7@4@ @K>K?!K?K?K? @O?@ @K?@ @k?ok>k>k>+dH"7F4 4^7?Q74Y 7?+dH?C4@ 47h<H?C4XW!k?146yc?9$ BK?14??@*4_`" 0jC?!"46 M4 ^)7+dH=Ka?48$8@+dH<苀$@+dH! $K?1 +dH6 @4Ѐky@ @+dH< @C?Q9^4zK>YK>K>K>@O>7h44Yu7?!C?9047>7?&K?4&8G&F~7?!@84K?4_7?!m+dC?D=+d @K?7>''8G'F`+dH5 B"46y L4 ]E7+d]@#47! L4 ]7E+d+dH3Ka?4=} (@+dH% h8+dH: :C @+dH:C +d+dH7<_K?1k?44k?44Zk?ȼ K?1"46!LT4 ]7+dH:(Bh4m+d"46!L4 ]7+d5h k?Y17?k?44k?4Z4ȼK?1@ @K?@ @k?ok? k?k?+dH34k?! 4$^U7?7@d@+dH7B4@7 4&6hHB4X8 6hB 6hHC4`!@Ka?H7!C \#47"PL4 ]7@X@H C?й^M4zK>7?YG 7?a!74?@@@ZK?YK?Y7T 7?a_@@@H C?9^}4zK>K?K?K? @O?\5@ @H7hHC64t>K?!@7?a~k?Y@@H?-@C?Й^4zK>"46"pLD4 7]m4@@H>@C?Y^4zmK>@ @K?@ @k?o+dH? 4^7?7@@Ka?4:+dh<B`4@@+dH7 C?^4zK?Y@O?@ @K?@ @k?7@@+dH:(A7@@K?Y@7?k?7+dH?C+d70@h3+dH?C+|4907  0@+d7h=K?Y@7?@@@K?YKu5Ks5 k?k?ok?+dH?4#C+|4$0 `!h@Ka?H?  _5@ Z _44Y"LL4 HuB9]e7P+`#47# L4 HtB]7Kw0HP@C  27 hC  ?77hxK?YK?@O?k?o7?qk?Y4C?""46#L4 ]7C?!C K?qk?!C K?yK?!@O?=4(K?@#47$@L\4 ]7=C??@"46#L4 ]57C?47$L4 ]7C?k?Ka?K?C@49K?B K?C?$>@+dK?C 49@mK>+dH98CK?K?BK?+dK?C X49@K>CK?qKa?49< K? "K?C 7?qK>CK? "#_] e7Z$eK>K?qCHk?K?C7K?BK?K?B\ C K?K?C 7K?BK?K>k?ok? k?k?k?!k?)+dH57E7& 4^u7?7@ @ X@_@+dH! !C?Й^4z`K>+d44$4X7?iE@ @C?F!:4c?7?i@04H6h4B?w7?i+dH4 @4ks7?_5h+dH< @C?Y^4zK>K?)K?!K?K?K? @O?#?479%@L 4 ] 77?i@ @K?@ @k?7_4K?Y@7?@ @K?@ @k?7_u4K?Y@7?k?ok?k?k?+dH!4k?9 'k?1X7?1'@+dK?9H7Ka?497#C$BK$2CKC$K?9CKKcK?9CK:k?9K4``4+d48` A Cw   D @K7ӷ4 #X4?4 4y%L4 ]7K?9 4ZK?1|xK?1ZaK?1#P7%K?9K EK?1J"46&L 4 K?1]57K?17Ks1 €B4z4G4K?17?k?1ş4c+dд49`$ 4 _7? Y4zG44c?4?K?Y+d P4&` Y4zG 4K?16?k?14c?4K?1#4z4G4K?14\?k?1?4cK?Y K 2#7%p4L4 ]-7+dH#K?1f (h?Ȅ<4<4!2K?9Ja _44Y$LT4 ]7K?9 4Y K?17K?1ȁ K?9C@K@`4?+dK449` 7 ZX@?64 K?94 ;@ ?449& L$4 ]Q7YK?1|4;@K?1Z4K?9KK?9 ܗKu@H 6K?9v@$d@K  `   B"46&pL4 74]4K?14zG4K?YK?K?K?@O?K?14UI4z+dH:7]hK?1K?9DT uK?Yk?o7C7:4b?y@4?#?78( h+dp4+dH4B47+d48  64Ɗ 44!X@4  z 7? "6jBʖ a6jB֖ "6jB?6  6j Kb1@ _t@ J7B 6s?Ӗ6>@> @*Kw1 _  U44|K?Y@O?x+d"46y&L(4 7]Q4y4|"46'0L4 ] 7E4|@ @K?@ @k?ok? k?k?k?!k?)k?1k?9k?A@0k?Q!@_@K>K?AK?9K?1K?)K?!K?K?K? @O?\@K?Q7?aG5Y"(7H B4 Y5K?aK?a7T 5Y_@HC 7huHw6hB4 r7?_hwK>+d4#+d4$Ka?4%4@4`4t4 XHC 7h|HC BH>EC \ Ha4*hjHCH>7?q7hv7?qK?Q_}5Y}k?a_=@EK>#47"pL4 7]A5y_@K>47_Z7@0?@7_?@4Z@?7@k?7 _e@K?Y_@K?Y@7?7_79804? 0x@874 7?W_}7Z@ 7_79 WB7W ?7Z@ k?7 _@K?Y_U@K?Y@7?44`P7]7?4 Uu *6@7?4 U?67S`J T|@ _7?$6 @6? `04Bv@?45? \  Ҁ?֟ t7Z_M6s@ 44`H7]7?3 A *6x`@7?3 V?6x7S`J Tu@ה _7?$6 @6?@ ֟ t7Z_6s@ k?7 _%@K?Y_@K?Y@7?k?ok? CD7Ck?  #47%L 4 ]Q7 `44?k?I7?IXA4z!2!`@Hzk?!_=K?Y 7K?!K?_u7K>K? @O? RHw`B#?479$L4 ]A7̄ `>4?#7& 4L4 ]7̄4?#47p] 4">@ z+d49`k?HxK?_=4Y 7HxK?7_K?uK>k?_54?k?)X14zk?K?)44k?Y K?K>@ @K?@ @k?ok? +d4#k?4X4X7?K?_E7?Hw6hB?47?_ahyK>K? @O?@ @K?@ @k?ok? k?k?k?!k?)k?1k?9k?A@7C "+dH$4h%4X4X 4x 4D"+d4%4@4x4|!?4 D4 HC 7hHC !W!"7@h|07YU@@@7 @Y4H7YhY 7HCH *459'L 4 ] !7H7Th7hHC 7hHC?>E@( _8'_!@K>K?AK?9K?1K?)K?!K?K?K? @O?Ku5aKs5i k?k?ok?k?k?+dH"4Wh7@D4#4"6hB4?`#4?"63 Ka?H?# 4  zKa?H?4?Hw6hz B4?" Ҝ _HwHf4?hypФ7hxKa?H7C44$"`Ӧ \ H"R Ӝ  @6?"2 \%&  6?SH}7huC! ?5@Hd4?hxФ4D  44#47'LX4 ]7Z%@4̐x4̘h4̔X4̚H4̒84̖(44U4@U4Ka?H?_}4@U4HXY4H_4H"46'L4 ]7Z44K?YK?K?K?@O?k?o7C4X54y@  Z#47'L4 ])7 `Ka?4 w4<K?Y@O?k?o_7CKa?4?!Hz @B@+dH7` b#7(P4L4 k?BHzK?]7@ `#?479(L4 ]7 `Ka?4 z4<K?Y@O?k?74X 7?C? B 2#47(L4 ]7k?K?YK?@7?k?o_E7C |+dH?7h7CK?Y@O?k?ok?k?k?@7C 7Hf@r @ B `44)`L4 7]444?_@4K?YK?K?K?@O?k?ok? k?k?k?!+dH?4@C7C 47h&H?C4DX"7_h%4p7+d4&HH 7SH7=h4_]'7+dH44%H& 6H7\h@HHv z4PC=׿=XH4K 4 H4K 4UHHh(HH0H  hH  @H h֢6Hh 44)Kd4 \7_ )4 d4K>K?!K?K?K? @O?+dH?C4@7 7h=H3Bx+|4:0X @Ҝk?ok? k?+d7DH:7_h?C4z7% 47h=H?C4@ ( *7h?C (0+dH4 ]7?y7@4\y b@ R_7?+dH6 74^-7?+dA4 k?!B7 @BK?!+dH!8< R _44Y @Kt4 k?)B0K?!K?)\7_ K?!+dH$ 0@_@C?yй]4zK>K?K? @O?@ @K?@ @k?ok? k?k?k?!_7?!`7_ @K}1K? K6 k?+dH:74`4%+d4& H? Z44)Z44Z4y4)V4 7K?H7ek?S }44dV4@4K>K?!K?K?K? @O?V@Ku4QKs4Y k?k?ok?+dH? X7CK4+dh<4$7y1!+d4Hh:+d4$H:+d7h?_ h+dH7H6?  Se4zK}1 hk|1K?YK?@O?k?7K0I @@K?Y@7?k?7K0I@R P: "@*@@K?YWA@K?Y@7?@ @K?@ @k?7@4K?Y@7?k?ok? k?k?k?!7]Kzh7& H4#@!p@Kw0I @ Ky`k``k`h@!@+dH"k?1X =4%K?1K 7Hg4@7HB_ 6hHB4X!j : 4 7?4Kl4++dH8KC?0 pk?"46y)K4 \7_@pK>#47*Kt4 \7_9@K> P4*a7?K D4+6hB 6hHX k?k?9K lK?k?HK?9K0I K?@4kdhK?kz`^@K>K?!K?K?K? @O?@ @K?@ @+dH7B4?+|480 ` *6kB ?66@kk?7KxH#PYe7*qK?Y@7?k?7+dZ1H9+dZq4:k|0K?Y@7?Ku6Ks6 k?k?ok?k?k?4<7$"A 7C+d4% f@Kd6z +df@֟4= K7: K 7 a d | `K?YK?K?K?@O?_]@+dk?7_]4 K?Y@7?KX+d4?KW KYKZ @zk?ok?7$K9@p7CHHw HSHHHy 8 hzK?YK?@O?k?o7?KYKW8x@ ֿ`7C<|@@*79:z@׿79_7?q7?q_4y_%4zK?qK?yhaK?hsK?hthbK>@O?@@k?ok?7$7C_4HwHx6 h$K?YK?@O?k?ok?7C7:Sk?74z_7HHw 4S1K?Hx  hyK?YK?@O?k?o7C_4Hw6?hK?YH|@O?K?@p7\K7 Y4@ (2 :7@(@ 9 ( 0@K?_`p7\K7 Қ4@ (R :7@@ Z (@0`K6 `0X7@jK7 94@ (2 :7@(@ ӹ ( 0@7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"06}  : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#047P\ -4K?Y4|@O?=7?4?#07  `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#07  7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"046zP\U4K?Y4|@O?k?ok? k?k?7$Syk?1+dH:k?!+dH=k?)74@ 47@ 7KP @X4@ |44kP+dH:#7 T 4H 4K4 ` `@K?!K?)4@ T@4K>K?K?K? @O?4zXk?9K?1Z7@ \4KPK?9 3 kPK?!EK?)k?ok> k>k>k>!k>)k>147Ck>a k>i+|4%_7?1+dH7B4?4@+dH& 76kKB4X"6k_7?4X"K?_Y7?#8@K?_k>Ad k>q4܈} R+dH?CH#:7h?C 0@h9+dH3#Z4G#:4Ȁ#*4 #*ZK>q+dX4K>74F744F4K>A4 F4K>q4 F4%4܀v%#0K>IK>y7@,K>Yk?47?c?4^5k?K>I@K>Q^@K=K>1K>)K>!K>K>K> @O>"046KP4 \7^@mK=#?0479K4 7\!4y^@ K=#074K4 7\4y^]@K="046K84 7\a4y^@MK=Z4+dH6k>I+dH<k>Q+dH!Xk>Yk>yKz @4)T 9K>a "Kh4@5ZK>a@$4Kz 7S y@KK>akhk|@5C @b+d"H:6(T5I5@<5C?K>i_4;5k>+dH(;@H? `h7(H" `@ h?4Xh?K>74F 744F 4K>A4 F 4K>q4 F p4@ K84:X4K>74F 744F 4K>A4 F 4K>q4 F 4^ 4+dH36t?Eh4@ @K?@ @k?7+|48_u49K?Y@7?@ @K?@ @k?ok? k?k?!_ 7?+dH?C4@ 77h4H?C4XW!27h3Kz 4$Ty4y @S 4zK 777Y4y#07@Y4Kz @S@SKzkckeKyKx_K?!K>K?K? @O?"046K4 \7^Q@K>k?77?Y=7?K?@4K?Y@7?k?ok>k>k>k>k>k>k>k>k>7#7&k>S7:Kz4$  T4y"+|48Kw+d#?0H%79PSQ7?1K}7ksS4z HS7?1 K064D7Ǡ74 4S4!775:4\5  , *5)柇4"0K>6`5:S7?1+dh(_4@7?1Kz @S@K 4zk|S5+dh%K>YK>K>K>K>K>K>K>K>K>@O>S4745:\]5, k?o7hd? he?hf?4k}1A+dH$4z?9Y -4y?AHy?9_ 44%Kw+| _0484YS4z?QKaxKf4 kSKzp7K?K?~@4p  ^k?k?Ksp77k?4}?Q"0k?6Hw?AS94+dK?K?4ȷT~ր4p k?k?4u?Q#0Hw?Ak?774S7+dh&_-4@T4z?Q+dh$k`1A4~Hb>Hf?He?Hd? @O?k?ok? K+dk?H$ @7#+|47+dh7_U44kyk?7?Y %7?K?7k?"0K?6y7?yK4HK?y+dh8_4RK?y+dh$K@4zk|p4ktxK>K? @O?k?ok? k?7%Kwk?4#+|48 +dH$#?079S7?QKw6kx@ 7?Q#07?I7 7?QK4HK?I+dh?_M4RK?Ik`x+dh$k`pK>K?K? @O?7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"`@6}H : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#@47\ 4K?Y4|@O?=7?4?#@7 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#@7X 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"`@46z\A4K?Y4|@O?k?oKy09+|H70+|H:8k?+d44#J 4: h`+d4 K?Yh +dh?Ka?43hs+d4=@h}p+dh}xh} h h`h`@O?k?ok?k?+d7Ch:Ka?4%+dE h9Hw J4X744XS7 Ka?4?h h@ hHkd@hdK?YK?K?@O?k?ok? k?k?k?!k?)k?1+dH?4#+dh 7D 7%+dH7ؒ j+dH?؀ @+dH7Ka?4< X@Ka?4!7 :KHx "#@47\44_4Ka?44#@+dH?؀ p@+dH)Ka?466 @@KHw7 "#@@47Z\14+dH& x4'HB H `*4H 2H䟽@HD H b+d4h9 H3 H6 Yb4)I7 I8 5" i( I9 (8@_ (8 _I( i( I4 I9  <i= I7 I: 8`@I= i= I5 i5 +|58i H7@+|4 H?Hi(i0Ky09k?AJk?X 9K?Ai44kHI   @  K85+dh&HhsH| j @44:[-4z@K>+d45p+dh5+d46@hvK>K?1K?)K?!K?K?K? @O?J,5: -I7 Ku7QKs7Y k?Ku8Ks8 k?k?ok?+dH?7C 7$K@40@0C JS u4y 2+d 8H:_4y|0@+d H#_4y7@4z HxXx(hcXJ4X744XS 7 Ka?4?h  h@8kdKa?47w @kd@hd h8h0hHh(4|K?YK?@O?k?7k?_4k?K?_m7@xK?K+d0H?ؒ0K?YK?@7?k?7k?_ 4k?K?_7@K?K+d0H?ؒ0K?YK?@7?k?7+dH?_ @+dH77 _ @+dh K?Y@7?Ka?4?_ @@K|Ka?47 @@K|@K\k?ok?k?_e7D h7HeH!j+dH7 pH+d447@@4ȼ4# @7:4[4mHeH@4 @7+dH447@@ 4ȼh4A 4Ka?4? 84A 4+d49@A44A`@heH4K?YK?K?@O?K_ @_k?ok? k?k? `@4y0SQk?!+dH$ 4T4H  HKC: zH @K?4k?K?!S4yPHK?!4y`4SyKH??4K>K?K?K? @O?7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"`@6} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#@47 [4K?Y4|@O?=7?4?#@7 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#@7 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"`@46z [ 4K?Y4|@O?k?7@@k?+dH7 X@+d47 H9 K?+d@48K?YK?@7?#@47 @[ 4}+dKu5Ks5 k?Ku5Ks5  k?k?ok? k?Rk?!+d7h9(H3H8 y 4#HzHx(RK?!HzH}( ] hxHsx *4wPB?Hd@Hdhd(HuHy0  !h}H Hz @ Ht htKt1QH| h|@@ x4Ka?4%H @ ? @_ ` | b@?4c4K>K?K? @O?J4zHz_e@Wk?ok? k?6k?!_Mk?)k?1+d4HH= h9(H5 Ya4$HH( 4PhH "8@%Կ "8 %Hh(HH0 x  hH H ` H hHh44HS4+dH:K_K7 Hj(4A8K?1K?!@4K?)@4@4h84K>K?K? @O?J`4H"`@6z `[6y pHk?ok? k?k?k?!k?)Ks6tkt7$7_m6+d4(h9(H= H4 7Yah4'HH(  4PhH 8C_ 8Hh(HH0 x  hH H @ H hHh4 5  i XKz5K>K?)K?!K?K?K? @O?J 4Hk?ok?KV7C *+dHH=8 BHd"@46 @[4+dKs6tktHzHyHx _HwHz 7@@?`@@@`@@4+dH78 w dKz4XHy4K?YK?@O?k?ok? k?@ k?!%7Hb!+dH48Hw Hc4HKa?4< p@+dH7Hx!X@+dH"!8@W5@Hx !@+dH? +dH%W eh| 4@L4z @@4z#P@@ 4z +dH$WUhd87@ l4z+dH9@l4z+d"@46 Jh4 K?![74|@4z X@@4z @@|4z @@ 4z *@ 4z+dH$ !@@+dH?+dH6x *@4z+dH? @+dH%x b@4zW7(@We@7@ |4z+d+dH6Whv87@ 44z+dH9@44z+d"`@46y J04 7@l4zK@4zk?Kw1a4K?![4+d+dH5Hy8 X@@\4zW7 (@@4z+dH!K?K? @O?-4k?oKU7C 2+dH38Htt p@Hc4@ 4zKz7X4x 7K?Y@O?4@ l4zKz7X4x?7k?#@47 PJ04 K?k?74z@ k?K?K?[97K?Yk?# @479 PJ4 K?k?74z@ Lk?K?K?[7K?Yk?o@k? 7+dH7h @+dH:K_K?K7 h@EpK? p7Ka?49K?+d4_47@|0K?Y@8K?7_7K?Y4|@O?k?7Ek? 2Ka?49K?+d4_ 47@K?Y@7?k?7@4K?Y@7?k?o7hd? he?hf?hg?!hh?)hi?1 7D@`04Ku1Q!"R474K?K?~ 4` ^ >k?k?@77 4Ka?4(4I  ? @_4ӆ & 45)?4 KzX4 j4~Hb>Hi?1Hh?)Hg?!Hf?He?Hd? @O?_54@KzX14u4~k?7K\7_7= 07+dH98K: bK4!:K! @+dH88K K4k?"@4k?6 @40k?[qk?K?K?K?=K?4k?"@4k?6 @44k?[k?K?K?K?K?@4 2k(K?Yk0@7?K( k00K(k(K?Yk(k0@7?k?77_KZ r+dH78K PK4k?# @7: @4[4K?@4k(K?Yk0@7?k?7KS7_7= 07+dH88K rK4K J K( @K0 K?Y@7?k?4#@@k?47Z @k?[A4K?K?=K?K(5K0-K0-j0K(%j(Ku7aKs7i k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>aKS7C7$!+dH?8Hx"*pHc_ 474z@H4@4 @@`4#Ҁ H@@47@d4z g4`o e@ \44.74K=K>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>4@t@4Ar@4z@@4_07 R!@45 JX4 7@4z4[i7ȠX44H H@+dH:_Hc 4z7Ƚm4KHl +d l _]H:47> 7he  `@v HeȠ4Hm8I+d H'`Ka?84&@b@4_47@t@Ǵ @@ l4@b@ GH 2+dH?8H;4H4zH}8+dH9`K H  % Ka?4) @47@ t4@b@4_e4 ( 04@ Hz8+dH8`KY ?  Ka?4( @Ka?4&@4@b@4_475:_e47@47@x5:4& 74( pKa?47 " 8 e e-@t@ 8 (  5hKa?4* N8#24( 8 (@Ka?4:""7?y7?V 4zKa?!H4/ b# @479 J4 k>@HzK?yK?7[IK> b#@7 4JP4 k>@HzK?yK?7[K> ( 8"`@46y J4 K?yK?[y7j r"@46 Jx4 k>@8Hzk>@ 4zK>K>[i7 r#@47 J4 k>@Hzk>@4zK>K>[7 ( 8R#@47 pJh4 k>@(4zK>[y7  @ M807?7?V4z P#@47 I4 K?K?[Y7X4 47Id4 k>@ 4zK>Zu74 @s 6a? 4?!@58 7>''8G'F 7> @@4V.` ''100n 0N 1A 'K7>!@5-` &&010n 0N 1A 9dG&V kk@k@   hH `  H hx h pHk8X h h84?@Hk8 h(4? Hk8 hX4?Hk8 hx4?Hk8 hH4?Hk8 hh4?Hk8 4  4hHk8 4  40Hk8#@47 @[4Hk8+dH"`It F   Ka?47 85F@4 4 @@5: 4@b@@ `b@1o44z@ @44z@H4!R@}@׿ `}@`@@l 5?4$HgHiᕅHe44 0w 0  02Hm824>@b@"`@46y Id4 +|47P75Z4U@b@@`4z+dH7`/4# @479PI4 7@4z4Z7@z@_-`z@@ @K?@ @k?7 7:_ %4K?Y@7?k?7Kz+|W -H9 K?Y@7?k?ok? k?k?k?!k?)C\4<#7FKa?H?@44'"X4 Ҽ jHA BB 5A "7? ?AA +|4$p"+|4$H5@4! Ҝ jH  S s  < 7?!`4 <? "@46I4 k?1Q 7+d7K?)K?!K?K?K? @O?k?oKT7C 2+dH?8Hw!`@Hc4@u@5@"@a $ 4_4z@| @KyH# @kcH@z@:B@s f 2@04z p@@4z R#@74I4 k?@ 4zK?Z7k`HH|K?Y@O?H| 4H|K] B+dH78KX KZ4@kY 4YC_" $? @gY k?ok?KV7C7$ +dH=8Ht Hc4_4z7H +dH:8H 0HH4_y47HH H4X JK  !CkK?YK?@O?HKX :+dH?8KW KZ4ˀ4KYK:\@k?7K] *+dH?8KW RKZ4KSJ@*K?Y@7?ˀ4k?# @7: @4Z4 K?KX :+dH?8KW KZ4ˀ4KYK:\@KX :+dH?8KW KZ4ˀ"4KYK: K] Ӽ@KS b+dH88KY @KZ4K_Ka?4= (4@4KTJ Ka?4: W(4@KX :+dH?8KW KZ4ˀ*4KYK:@ߟ4@Ku7Ks7  k?k?ok?KA 87C+dH48Hv"H@Hc4H|KBHw+dH88J "0@+dH:@@ @Ka?45!@H4z(4 7_4z044Q4 4 "4Qe4 4:+dH9h?04!@+dH:_Hy 4 @+dH3 4 @_0~4@0~4h7X7k?#@47 @Z E4 zK?47K?YK?@O?k?7_m@K?Y@7?KX B+dH?8KW KZ4@K\4KY@K<KX B+dH?8KW KZ4@K\4KY@K< k?o7#KY +dH?8KW 8KZ4+dH88 _Y@7K_KrK } J"`@46z @Z 4 K?YK_CK?Y@O?k k?7K] +dH78KX KZ_Q47K_K@:@Z?kK_4>K :kK?Y@7?K_7?X7?"@46PI4 K?K?Z7uK?YK] :+dH78KX KZ@44K_K@2kK_4>K :k@k?7KS +dH88KY KZ4_A@7K_KkKZK]נk]K?Y@7?K_KX B+dH?8KW KZ4@Y4KZ@Yk?77_KZ r+dH78K PK4k?# @7: @4Z4K?@4K?YK(@7?k?7KX j+dH?8KW KZ4_)@7K?Y7\@7?K?Yk?oKT7# +dH88K] KZ4_@7HyHkYHwk_HskWK?YkS @O?HyKX B+dH?8KW KZ4@Y4@kY8KX B+dH?8KW KZ4@K\4@K\8KY :+dH?8KW KZ@44CX@@cX@KX B+dH?8KW KZ4@44CY@@<k?7KY z+dH?8KW KZ4^@7CX@cX@K?Y@7?CX@KX :+dH?8KW KZ4ˀ4CY@<@KX :+dH?8KW KZ4ˀ4CY@<@KY :+dH?8KW KZ@44CX@@cX@KY B+dH?8KW KZ4@@4CX@@cX@KX R+dH?8KW 0KZ4KY84@4CZ@@\?KX :+dH?8KW KZ4ˀ4KYK:\@KX :+dH?8KW KZ4ˀ4CY <04@k?7KX j+dH?8KW KZ4^@7K?YK\@7?K?Yk?7+dh +dWh Wk|k|+d44:PR 4H+d4`8pK?YKa?H?+dh?P+d47@+dh7@7?Ku5Ks5 k?k?ok?7#k?_7: 7B #@7 @K?4R)4xHz#R+dH98H?"0Hc_K?R4P@t@tC@s@ǓC@_ 54z#@_=4z#@_ =4z#@_ e4z#4z_@KK?Q4_4z @_=4zKa?46$@+dH!`#_u4zK?4Q]7@K1Y+dH=(C_4zKa?4:#h@+dH"(4Wh7(+| K?47Q4Hx"@+dH88Hsx"JHcHx+d45@ (04K?Q4H} K?Q4K?Q4 4z4Hx8+d44@ K?Q4@u@@K?QU40@@?U@K?Q%4U@t@K?Q4p=@s@K?Q4%@K?Q4 @K?Q4@K?Q]4 @K?Q544zHx K?4Q4(K?4K?@4yK?Q40+dH#(4d?h$(_K?K?YK?@O?k?ok? k?+dH4(6h3(4#+|k?!4=7?k?7 @ 4PQ7H_K?!Hu(+|K?! 4`Qu47H_K?!K?!QE40Hv(6?h|(K>K?K? @O?k?ok? k?7% `@k?!4ypQ4@74?"@6  K?!Q]4y@Ka?K?!Q54yKa?HK?!Q4yKa?+dH?(7h4(4$+|K?! 47Q4yH_K?!K?!Qm4y0H :k?H(+|47 K?!Q4yH(7:?h(HK?!Q4yKa?K?!Q4yKa?K?!Q4y+dH"(4Xh8(HK?!_4$K?!Q54y0HK?!Q 4y0Ka?K?!4y@_}4Ka?K?!4y`_M4Ka?K?!4yp_4`Ka?K?!4y_40Ka?K?!4y_4Ka?K?!4y_4Ka?K?!4y_]4Ka?K?!4y_-4pKa?K?!4y_4@Ka?K?!4y_4Ka?K?!4y_4Ka?K?!4y_m4Ka?K?!4y_=4Ka?K?!4y _ 4PKa?K?!4y0_4 Ka?K?!4yP_4Ka?+d4$H!(K?!43h(+| 47Q4ypH_K?!H(+|K?!47 QU4y`H_K?!K?!Q%4y0H+dH<(7h=(4$+|K?! 47 Q4yH_K?!H(+|K?!47  Qm4y`H_K?!K?!Q=4y0HK?!Q4yKa?_4: K>K?K? @O?k?oKxk? `@V4yKxK?V4yKxKw4y0QUK?K?Y@O?7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"`P6} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#P470Z4K?Y4|@O?=7?4?#P7 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#P7 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"`P46z0Z4K?Y4|@O?k?ok? k?k?k?!k?)+d7&H? 4hh9(4(6H77KxP7G 7YbkuPII( ] 5PiI 8B? 8Ii(II03  biI <I 4` I iIiМ g f! d eK>4zP4yX `@f h`8@ XK>hv K>ha( K>he@ _h`H ?h`` Wi`gK}1q!h@+dH36d(Ky1q !`@+dH:7_0h`0K j00 4|K>K?)K?!K?K?K? @O?H5I"P46`4 H4657YU445Z4^ e+d^H:7+d^iH:7 k?7K?k?K?k?K? k?_Ek?K?Y@7?k?ok? k?k?k?!k?)B64(k?1K>44k?9K>4!k?A4&!!" z!⁲ T47k?K?14k?K?9k?K?A_k?K>K?)K?!K?K?K? @O?"`P46yH4 Y7=k?k?T4 4K?14 K?9k?K?A _ K>HH4TH}HHH]HKa?4? KW` kY`@Ka?4? 8ˀK\`@@ @K?@ @K?K6@k?ok> k>k>k>!7$7E7> !7?)H PH xHHyH !H( @^4K *H(k>1^4K>1H(h04^aH0k H0H H?HH|H r `4|K=K>!K>K>K> @O>44Y4bH("P46Y4z] `@ @K?@ @k?o7:^k? (7Hy_eK?Hw4k1qK?Y@O?k?o7#HH@7Y"ڇ!J"7?r R#P7 `4HT4 +|HyH47 07Y}4K?Y@O?HzKZH}Hw  Hy@Ph}("P46 H4 HzXHy`7Y5Hw(45h}H_Hz H4yh ? HxP\7 `Hb\ 4hyhsHh`(h` T 4zK?YSE4zuK?Y+dH:C4xH JKHv Ha4 "#P47Y4fV4zK?Y@ @K?@ @k?ok?k?K% 7#7]=7:и_04 80(@K K@4yK?YK?K?@O?@P@K?@ @Ku7Ks7 k?k?ok? k?k?7%4k?!]4]4!7H!K *4_4H?4HaH?K 6J?6KK !PH @y _??!:_K?!Q4!:4C44K?!74_%7!*ġZ jHvJJK 7K?7K(  k(K>K?K?K? @O?H 4`>_H}>__"P46Y44"P46Y]4&ľ@"`P46zY%4.o@ @K?@ @k?ok? k?k?k?!k?)7#]}7:$K$Ka?4%Ka?4&@ǵDBH$4^M4H  @^%4_4 @^4 @^U4 P@_ 4KH( 7 4_ h(K  @_ 4#@_y4 7 @F4"@_ AHH "@_ @H0!"_4!P@_ H@H0#P47Y4?@ I B_ aHH !@_ 9@H0?@^4>@I z44_ HH !(@_ @H0^-4 @_ aHH0F D4 @_ !HH0^m4H( h(_4]7 _ 7 H0]e4 H0;@K>K?)K?!K?K?K? @O?@@K?@ @Ku7Ks7 k?Ku7AKs7I k?k?ok>k>k>k>k>k>k>k>k>k>7#k>]7:$7H@4yH 4J0?7 Y 9 FH H7 P4+d4(! P7?Y@Ƿb4?H0?@#r+dH:4y4_4hK>YH_ a5z @^]5z @^5z z5z_)@K_ 5z @@^5z?5z^E5z?5z 4zCp4K P7 5m  4šh5 ?5HH@J J( 8`:459 H4 HPHXYm7Il=H0k?H7hk?I `_K  :459 `H4 HPHXYU7 h@?]5kH045:Y4@u 459 0H4 HPHXY-7e hHx K>_Q 4yK>YK>K>K>K>K>K>K>K>K>K>@O>@P@K?@ @Ku71Ks79 k?k?/,opkHHKK?!K?K?K? @O?"P46Y4 +dk?ok?k?k?+dH#`! @+d4$+d4%HzHy ]u4Y @H @KH _H7]H 4U44U]4U%HHHc`?@K?YK?K?K?@O?Ku8Ks8 k?k?ok>k>k>k>k>k>k>k>k>Ya@Ya7+d@%΀ 7`0 @P44Y 0H4 +|`04? `` 4? pk?048 @ 48 P74Y4w+d"h@+dH76"4#k?a+|H9 7?a_Hz+|H9 Hz_4+d@'Ԉ#@+|H$ Hz4_4Hz4_4+|H9 Hz_]4+dH%#4$^A@+|H9 Hz_4H#@_U@@t@F,@+|H9 Hz_4+|H9 Hz_m4K>YK>K>K>K>K>K>K>K>K>@O> P449 H4 7 +|48 @48 `04? ` 4? k?4Y4w+dJ=k?a+d47+dKJ8 H6` h@KHyK:7]? 0k=J8?KH4`?KK 7<7k?aK?-@ k?a_e@e+|<@4^!4^]4?7@Ka?4&Ka?4'+d4(! P^-4 4 ^4 J459 HX4 7^45ZYi745 ^I4P4^4 7^4^7 P7^4 2459 Hp4 7Y5y4^I4^%4 h@^4 @^}4 *45 ^ 44^4 8@^Y4 Ka?49^-4^4 @^%4 8@^e4 @^404 ^u4 h@^-40@ B^4 *45 ^44^=4 Z459 H 4 7^45ZY 17^U4^47^%44^ @;79y@  @ ]k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?a7$7C4] 144#4f+|4'!P4  @@ՠ `@HHH "z"b"*ꂚ"ڇB"4(%@$7?8G%F H :^Y57^ }5K  IUJ @j44 H 4 IZXIY`Y 7iHH 5? Bi@Pi@( ?#b H(_4HP 7 ꨀ4 Hq5Z Z45 H (4 H7Y I5YH5Z  H4C 84Hh(SM4pHS q4PH45 `H@4 HH4 7Y q4|H< +d4$@+|4%4 P44 4 !(4j4AX@I_ LIWH & aX@IO `IM(#B"†=U@"<]@=%@44 `H4 IYH4 7Y4:IJ@>4`>4 K>K?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?IS  _]5I]7 _55I_P  4 4 ;@^!57^E5 8@^5 @^5 :44 H4 IZXIY`Yy7zi@ 44 H4 Y7IJ4]U5IYP[ 7IA(i\(U<S5Zܚ5@SI5Zܚ@k?ok= k=k=k=!k=)k=1k=9k=Ak=Ik=Qk=Yk=ak=ik=qk=y+dH"Ka?4&7C7%4 4 Hc0`?44K@^ y6:K= k=鈧 ^ 15K= k=C4zK= k=F4z 4 `@s` ( s8 J^ 5K= k=F04z Z ` H *^ 5K= k=4 `@C4zK=  0k=] 4 |^!74@yǹ@J7=Bt4zHs "@__`H}8!`@@AJ`P`2 4 K= Ax@ " 8I Y7>K=4Ћ"7?Yq7 k?5YO7?k?45YG4 7>k?HzP7HyXX7?Hc0`8@4k?ok?k?77D7#@""`P46zX4d 4?P7? #c_6?`b  6?txz46?K?YK?K?@O?k?7KxP#PP70K?Y@7?7w@7?@ k?o79?y@WW_!K?Y \@O?4 ] k: @ 7\44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"``6} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#p47X4K?Y4|@O?=7?4?#`7@ `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#`7 7C7:_4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"`p46zX-4K?Y4|@O?k?7Kx 0@Kyx `@K?Y@7?#p47G4 X=7+`"p46G4 X7eK?YK|1 @@KK K K?@4@k?o_}7C PGd4KK1 k|1K?Y@O?k?7Kz1@ H4KwKX KY 27_KZ@?@K?Y@7?KW0+ 0kw1O-@K?Yk?ok? k?+dH4 4$k?!H< k?)4(k?1k?9Ya@h9(HH( 4PhH=8C3=83Hh(HH0  bhH H `@H hK>H phK>k?K>k?K?!K?)^K?1Ȝh`GX4HK>k?K>k?K>k?K?!K?)K?1^K?97h`K>y+d tK>q K>i4f w eH8 hx 4l K>ah(H @ z^@# p79Pa7 8@^QH #p7 P!7 h K>K?K? @O?k?7+dk?C4:k|pK?T4K?Y@7?k?ok? k?B4(6k?!7 Hk?)^)H"p6P7 04@ 0@4Kp 0:"`p46y@G4 X7k`pk?Kp k?K?!44xk?yK?)k?qk?k?k?i_uk?ak`pK>K?K? @O?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?a+dH:k`4*4k`KS44JvX7 2"p46G4 X7+d@6Ԃ B"p46G4 X7+d` EP4Uy!pk|14%+}4'04(84)@4*HKa?4+c] Kz1 U5 X7A B450G4 75X54c Z  .  J45G4 N5z@P 744cÀ(50 P5?U5Þc ] +dH:(\4 p]4:@k|`+dH9(]7^ Kz`K>K?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?#p47G4 X7+dk?ok? @"7CKxx#h@KyK= #J_u@"K"Kah? ^)KK_kKz@"k?Tu4k?Kt+dk?H:7Yh <k?yBӂ?Ԃ k?q4fӟBk?ӂ_b Fk?i ABӂ aAF { BBӜל 9\ T Tֵ ӡ U Ӽ ]ּ Jv[ D׶ ]| }Sցc T֢B VԄ!B Uk?a4_44z"p46PX54 v+` p44G4 XE7@4z#p47G4 X74z@H@T4+dH9 74#4B7H k?+dH:7]hk?Ha 4t 4k?H| 4k?Ha k?yHs k?qk?i_ k?aK>K? @O?Ku7Ks7 k?k?/,ok=k=!k=)k=1k=9k=Ak=Ik=Qk=Yk=ak=ik=qk=yk=k=+}4,pk=D L7Gk>y@4@k=v(@04@ @0Ka?4$H" < 0@K>y@ESMкK>yK>y7k>yB (@ @0 @?WHk>yKa?H?4%@!Қ  rK>yHC3!z <? 2K>yC4`@4f@4`4fHK>y6}k>yC'Қ ?K>yK>yHC,: Ҽ??wK>yK>yC` _5@4X rw r r!p45 0G4 7X4 x+  " 2 2 BC7>yh C@K>yKpk>y4h H  @@]@ !p49+AP i7.\@C K=RB4B@\/7H 5?_ NlL_ MC7>yh CK>yh H K} 8k>y]}"p6+AP Q7-@C K=RO5 / 7H @ 5?l$k>_Rl @_u MCh7>yh CK>y@ Kr*|k>yC K=ѯӁ  *D7RU6֠ *4?j&4J5_!4ܒ MCx7>yh CK>y@ Kw)k>yCK=ѯӖ  )T7RV6 @)&_Ik=ֿIt@_A5ܑ M7>yB4(Kwh6`6n?4> x`)H  24 .N! 4 =Nn  mM7>yB,4'Kwh6נ7?4> x`*FH  24 NO. 4  NN H MM7>yBl4'6Kwh6@7N?4> x`)H  24 N 4  N M7>yB4&~Kwh6 7.?4> x`)H  24 nN 4  N M7>yB4%Kwh67?4> x`)H  24 N 4  N. k -MB7>yh C@K>y@ K$k>yCK=ѯӂ  $74?i4i5_4܍H MB7>yh B|K>y@ Kx$$k>yCHK=7ѯӜ#  ?Jk=֟I_5܌ M#A4J#nA #\@A4䂿 4#.5 k>yB7>yh By@ Ks+k>yCK=?k=郑I7ןI"6_5 P MB 7>yh BK>y@ Ky+k>yCPK=k=郖J7nI`,_5 MBT7>yh BK>yKtk>y4h H  8@]%!p5+AP7+@CHK=7R\7׀  -H @ 5?4?i4NI_a h MB$7>yh BK>yKqk>y4h H  @@]@"p6+AO7*@BK=RA4! <-7H 5?ik>?Rin_( M4BH7>y?Knh4> x`*n׎  M4B7>y>Knh4> x`*f׎ h M4B7>y>RKnh4> x`*^ M4B07>y=Knh4> x`*^  P  MK=Bd7>yKk1 @@ D=j7Kq|x`*lk>y@MMK=B7>yKk1 @@ $<7Kp@g*k>y5_4 ּ ܅x MK=B<7>yKk1 @ y5_I4 ܄ MK=B7>yKk1 @@ ;Knk>y4>7 x`*` MK=B$7>yKk1 @ ;0@Kbk>y4>7 x`*֎  MK=B7>yKk1 @ D:Kak>y47 x`*n H mM4Bh7>y:2Knh@`:  M4B7>y9Knh@`9@_Q5 MB5@ KbD9hk>yBK=7@ `*5N  MMBT5@ D8Kvk>yB$K=7@ `*~54 :. x -MB47>yh BK>y@ Kz+$k>yB|K=Ӕ874?j4j~`տ֮ MBt7>yh BK>y@ Ko+k>yBK=7Ӝ7R4?j~4Jn`տNcMMK>yA( 25k>yA(0AK=s`4?3 5K=B7>yKk1 @ $6*7Kv@`*k>y MK=B7>yKk1 @ 57Ku@`*k>y] MK=B7>yKk1 @ 5*Ktk>y4>7 x`,>8 -MK=B7>yKk1 @@ D4Ksk>y4~7 x`,n~ = -] MK=B7>yKk1 @ $3K}k>y47 x`,.5? C]6c-P>m MK=B,7>yKk1 @ 38@Kzk>y47 x`+5? #:UMQN> MK=Bt7>yKk1 @ 2Kyk>y4>7 x`+- MK=B7>yKk1 @ 1Kxk>y4~7 x`+v  ZN ZMK=BL7>yKk1 @ d1ZKwk>y4~7 x`+>__տ  MK=B 7>yKk1 @ 0Kk>y4>7 x`+֮ m MK=B ,7>yKk1 @@ D02Krk>y74 x`*.c-MK=B 7>yKk1 @@ $/Kqk>y4?7 x`* M MK=B 7>yKk1 @ /Kak>y7 x`+ M5k>yAE 2"p46+F4 W7K=B 47>yKk1 @ .B7Kp@`+k>yN MMK=B 7>yKk1 @ -_ k=7Kv \x`+lk>y? א NE MK=B 7>yKk1 @ D-k=7Ku x`+$k>yN k MMK=B t7>yKk1 @ $,Kok>y47 x`+4 ?5N MK=B7>yKk1 @ +7ןk=Kt x`+k>y WTN] M5k>yA 2"p46+F44 We7K=B7>yKk1 @ *Knk>y7@`+. -MK=BD7>yKk1 @@ D*JKsk>y7 x`+~  N M7>yB4)Kuh֠6?4> x`,m M7>yB4)RKthր6?4> x`,B M "5  8տKah2\ 4 M7>yB4(Ksh`6n?4> x`+֎ B@ M1/K|hӑ! 4-Mտ7>yB4'Kwh66?4> x`+ 4. -AU M7>yBp4':K}hנ7?4> x`,׮ B M/ߵKvh 4 MMտS@AH7>yB4&bKwh6֠6?4> x`+W 4 N  MA M7>yB4%Kwh6ր6?4> x`+48  k S > 4 _- ?M7>yBH4%@Kzh@7N?4> x`+. B -M-5Kuhҳo 4 u M7>yB4$X@Kyh 7.?4> x`+  M *"p56*P 4 JK>yC#"p76*P 94#@K>y7 Uk>yB7>yh BK>y@ Ka,4k>yBTK=4k748K5^ 4܋ MB`7>yh BK>y@ K|,yBK=4?k74.K5^e4܋ M\!@HB7>yh BK>y@ Kv,$k>yBK=7Ӝk=? Kk=?kv^]5 - MB7>yh BXK>y@ Ku,k>yB,K=k=郏K7K~^5 MB7>y7?" +տ =h #p47*F 44 74W U5K=@5Xh 459 F 4 744?W 5K=459 F |4 K=7?W 5=K=459 F $4 7? W =5K=459 F 4 K>7?RW 5K=459 F t4 474>W 55K=h K4,4h 7z4Oh ͵K}h 4"4h 47zh O4m459 F d4 474>W }5%K=459 F 4 474>W %5K= !p449+QF 4 W 7K=459 F l4 474>W 5-K="p46+QF 4 W =7K=459 F4 474>W5K=@#Kk1 #K>y6?k>y5k>yA,T@C4+4K>y459 F4 744?W5K=5k>yA,4k?Q4 k?i44k?Y47?Qk?a4?K>y7k>y4fCV4f+މWƁ_++.\459 F4 K=7?W5eK= Ap44Y,aFD4 Wu7K=BD7>yk4 ִ  Mל  M459 F4 K=7?W5uK=!p45,aFT4 W7-K=!p45,aF 4 W=7K=459 F4 K=7?W5K="p46,aFl4 W7EK=4(+\H 59O7+40h 459 F4 744?W5K="!p469,aFt4 W7MK=4(,.\ H 59O7+4`h 459 F4 K>7?RW5K=h K}44h 7z4Oah K|!k>yh Kw4"4h 7z4Oh ѵ"p46*F4 74W5K=459 Ft4 474>W55K=459 F4 474>W55K=459 F4 474>W5K=459 Fl4 474>W5-K="Ap46Y+QF 4 W=7K=459 F4 744@W5K=#p47+QFh4 W7EK=`27K=459 F4 74?4W15K=`1K=459 F4 74?4W5uK=`8459!pFP4 W7K>y4/k>y61A8$u$@*459!F4 W7ײ R  M`0K=459 Fx4 474>W5=K=`0/K=459 F4 474>W)5K=`/K=459 F4 474W5mK=`<459"FH4 Wy7K>y7k>y61C 8${$@*459"F4 W 7PMX  M459 F4 474 W5EK=459 F(4 474 WA5 K=4B7>y@*k>y7>yB4kտ i M459 Fh4 744?W5 -K=4(?,\H 59O 7,4Ph 459 F4 744?W5 }K=4(,v\=H 59O 7,F4h K>y59& P4,d@K>y7k>y4B87>y@*k>y7>yB4lFտ\ I MM`+WK=459 F84 744WQ5 K=`*K=459 F4 474W5 K=+d^H:K=K k=K=K=K=60 ,7=4'00N8D'DK<@K=KO K0+k=K=k>y4 k=K=4C(K҂4hkb1OQ@h K=4(K3 ^+d^H:K=KX ]+dH:KS4*JvX7 *459 `F4 W7K=QK `(WK=459 F84 474>WQ5K=`'K=459 F4 474~W5K=`'K=459 Fh4 744W5-K=`'K=459 F4 744W5K=`&K=459 F4 474>W5]K=`&OK=459 F04 474~WI5K=`%K=459 F4 474~W5K=`%K=459 F`4 474>Wy5%K=`%K=459 F4 744W5K=R@`$K=459 Fx4 474?W5=K=Rm@@[ %@47k>yKz14&T4"Xk=!p5 0W4Ky7?k>yc?K>yk=+}4+0k=+d4'!`5k=!`5k> !``5q k=!@`5R 0k=! `5",@ 4(! p4 b` WK=459 F 84 474W Q5K=`?K=459 F 4 K=47W 5K=`?K=459 F h4 474W 5)K=K>yA? K=4k=4V? 5k>y4Z>K=`>K=459 F x4 47 W 59K=5k>yAB> K=鵌( *5k>yA(059!5O=4! K>y7RYk>y459 F X4 474>W q5K=459 F 4 474>W 5K=459 F 4 474>W 5iK=59! O4 y6  k>yB"K=4T?_4? 6459 F4 474>W5K=44*e45k>y59!0O4 @K>y4Ok>y4" 4459 F4 474>W5K=K>y59!@O%4 bB=K>y459 FP4 474>Wi5K=K>y59!PO4 0@K>y59!`Oa4(GKk1uK>y459 F4 474>W5IK=K>y7?-k>y459 F4 474>W)5K=4$x45k>y59"O14 h4B4459 FX4 474>Wq5K=K>y59"O4y7k>yA4ڊ#Zב _0 1?M459 F04 7484WI5K=4(*>\H 59N7*4h 459 F4 744?W5AK=4(?*>\H 59N7*4h 459 F4 K=K=7W?K=4(*>\QH 59N-7*44h 459 F 4 K=7?W95K=4(?*>\H 59N}7*4h "p46,Fh4 W7AK=A4ʊyC44E$m47k>y59!@O4 K>yK>y59"pO4 (@K>y59"Oq4 K>yK>y59"O94#'Kk1UK>yK>y6?ek>y59"5P 4 4K>y6wk>y4P J MM59"5P4K>y 47_Hk>y59#PY4 @K>y4]k>y40 J- -M59#5P4 4K>y7k>y4 J M59# 5P40K=K>y7\uk>y59#05O 4 0[K=K>y7? %k>y59#@5O40 K=K>y7k>y59#P5Oi4/K=K>y6k>y59#`5O4/kK=K>y75k>y4؃ *459$E$4 VU7K>y7_k>y/ -M459$E4 V7K=459%PE4 V7_@O MM"T 6⟵䟥柕459%PE4 V 7 K=59#P5O14( sK>y6UMk>y59#p5O4 x4K>y64k>y459&E4 K>yCV7ˀל K>y59#O94 @K>y7Tk>y0E-M59#p5O4( K>y6k>y59#5O4 4K>y5k>y4  M A4ڃ 4 r5hk>y@ 4(W&t@\ H 59 N 7&>Dh 4_MM59#5OY4 4K>y4Yk>y4א] M559#O4 4K>y46k>y4/ J -M@ 4(_%L@\H 59 N 7%h 559#PO)4 4K>y48Hk>yK>y59#O4 K>y4/k>y4 J M59#5Oy4 04K>y59#OI4 @K>y7Hk>yK>y59#O 4(A@K>y7k>yװ k M59#5O 4  (4K>y59$O i4  K>y6 Hk>yK>y59$O !4(cK>y6k>yP k- MM59#5O 4 4K>y6k>y40 k -M59$ 5O Y4 (4K>y59$0O )4 K>y6Hk>yK>y59$@O 4(#K>y6k>y k M59$P5O 4 (4K>y59$`O Q4 K>y6}Hk>yK>y59$pO 4(KK>y6k>y k M59$5O 4  (4K>y59$O y4  K>y7 Hk>yK>y59$O 14(sK>y6tk>y k = M59$@5O 4 4K>y7Qk>y4 M559$O i4 4K>y7Pk>yK>y59$O 4 @K>y73k>y4׏ J  M559%0O4 4K>y70Pk>yK>y59%@Oa4 @K>y7k>y4O eMM45:PV4IK=6AK=7?4?5 459'E4 V7ˀ1 A7>y M4!45k>yA43"`B4T _(36k>yK>yC X7o(0:7k>yC(o8 ?759%Nm6Z!4K>yױ S֐  = M@ 4(x:@\H 59 N7:jph @ 4(}:h@\H 59 Ny7:28h 459'`E |4 K>yBV 70 459(E $4 V U7ˀ\ 4T=@K=59%N6Z Z$%K>y!p45,E 4 K=V 7K<59%N 6Z &K>y59%X6Z (uK>y59%Xi6Z *EK>y59%X96Z ,K>y59%X 6Z .K>y59&X6Z K>y59&N6Z }459& N6Z M459&0N6Z 459&@X6Z 459&PX6Z 4 59&`X6Z 4 59&pX6Z ]4A4‹;GK>y459&E4 7V6YK>y7>yA |4@J459&ED4 K>yC0V]74  M 45k>yA46 B4T (6k>yK>y59%O =4 (3K>y6k>y0 -M4T?K>yK=4!45k>yA4]!B4T (6k>yK>yC X7o(0:7k>yC(o8 ?759%N6Z b4K>yOQ M]p  }M4T? @K=59%NA6Z $}K>y59%N6Z &MK>y59'W6Z (K>y59'Wu6Z *K>y59%WE6Z ,K>y59%W6Z .K>y59&W6Z ]K>y59&N6Z %459& N6Z 459&0N6Z 459'W%6Z 459'W6Z e4 59&`W6Z 54 59&pW6Z 4A4<@459'E4 7V6YK>y7>yA4@J459(@EL4 K>yCYVe74  MA7>yX4 ֳ Z T  MA7>yXw< Q -M4!45k>yA4!B4T (6k>yK>yC X7o(0:7k>yC(o8 ?759%N16Z b4K>y/1 -Zװ  M4T? @K=59%N6Z $}K>y59%Ny6Z &MK>y59%W 6Z .K>y59&W6Z K>y59&N6Z 459& N6Z 459&0N6Z U459&pW6Z %4A4>K>y"Ap46Y(E04 Va7K>y"45k>yA49 B4T (6k>yK>yC X7q( 0:7k>yC(q8 2?759%N6Z 2K>y4T?=@K=59%N6Z0r59%W6Z0J59&W6Z0"59&N 6Z0 59& N6Z0 59&pW}6Z0#p7)1WM6Z 2A4? K>yak>yA4 2 Ap44Y)AE@4 Vq7K>yQ  M4 45k>yA4X B4T ( 6k>y !pK>y49)N 4 jK>y6Ok>y4 YP  YM4T? !p K=#pK>y7)Nm4 zK>y6&ek>y@ 4(&@[UH 59 N )7&h !pK>y5)N4 zK>y7(k>y@ 4(\&@[H 59 N y7&Z`h ApK>y4Y)N 4 zK>y6A,k>y@ 4(Y&@[H 59 N 7%h !pK>y49)N]4 zK>y6<.Uk>y@ 4(%@[EH 59 N 7%JPh K>y59&N4 K>y5k>y#pK>y7)Ne4 "K>y6k>yU4"pK>y6*N 4 "K>y6k>y4"pK>y6*N4 "K>y6k>y4"pK>y6*!N]4 "K>y6wk>yM4 "apK>y6y*1N4 "K>y7k>y4#pK>y7*AN 4 @K>y4V"k>y#!pK>y79*QN U4 K>y45*Mk>y#p7*aK>yN 4 (@K>y7Rk>y4"pK>y6*qN 4 (@K>y71k>y4 A4O9w #p47*E4 V7- 45:PV4b5K=A7>y\!MMAh7>y M@7>y M4h 4yh 4h 4Qh 4h 4)h 4h 4h 4h 4* h 4h 4 h 4h 4 h 4h 4 ah Ap4Y+5N 4(7K>y6 k>y(5 k>y :A42 "4h 5k>y@h @$7>yh  :4 J404\ k ) MM?4?4?45?k>y@t7>yh 7  4 404H /   -M  H Ȁ  BH Ѕ?4?w4?w4W 0 045:PVI4PH Ї RH Ȁ 0 45:PV4fhH Ї  BH Ȁ 045:PVi4|H Z׺  M@7>yh ֜ k Y M5?k>y@L7>yh <   -M@7>yh | k mMBK> 63?`4?S 645:PV94K=45:PV 4YK=k?ok? k?k?7#Y7??y4?#@`7W 7̤+dԨ4 +d7?qH:C 4+d h< X 8  Y4z@44c?44K>K?K?K? @O?̬5+d "ap46y-E 4 K>k?7]@K?Y@7?Ku8qKs8y k?Ku8QKs8Y k?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK37#7D K'`7e1Ɉ "#p47PV A4 " p44:PV 4D4 7D4 [UHzH[5Hzk?Hb X 4k?+dH:4$Hy@H_H"7H 45 @?5 D5z7D|H`4P5?W \ _6` 7866a49ס   S \  9< 77u7  d4 #@p7J4+ ID4 [ Hz J5_H 5?@4?HtJHv  Z Hv( 5)(~@4"p46-AEp4 HyPHxXV7#p47PV 4H" "!p45PV4 rHKa?4' gHJ_eHH <4HsJvHaH6 HDH \[ HzHI+ |HJ_HH 4H}KH|H xH @D@H[Hz HKHH9_HH HtJHH  UHH HI9_mHH<HsJiHlH  H @H GH K_HH HdHHtH FH 4K>K?IK?AK?9K?1K?)K?!K?K?K? @O?H ֵ  U }D4 [uKz` K DT4 \[Kz` K3|H|( KHN KP z4kHKKK(= t  0@KK  y@k(k(@KW`z@7? @ 77S(&`&i# p780/K_7?400 0n1'N 1A 9dG&V  # p770.00n7 7?W'I00N1 9$G'QJQ ?7@7?@4@@4k?ok? k?k?k?!k?)k?1k?9k?Ak?IK_@4 f7F!H7'4l!24v!"4x!4n!4p!H`! +dH)H5lhHI5 4zJP7+dH:7]q7H 7H@ 4@? …8 4"< 4,I ̰ς(K>Hςh( Ap44Y-D4 H@HP7MHXˀK>Ƞ4"I 02 04" 4 ?"8 4"6 4,)8̰r44"7 4,8"bH"R@B[E@K8IU[HH[K8K8#+J7,*H ![ KK8I 5U47T  ә׺!  +T Vb VJ X !0@H5_?B_ ע]*4,8 ע bv[ H @[ QH @[qHI h@H  (@[1@I | (@HI]4754 4?!p5H 4 @ 8@0b[@Ka?4!< :H[HI4] ȼ"HI]478<@}4"4?@ 4`Z#p7 4DT4 744Um4?+d4?ւ#^7As!ӋM$ sVP D4?@ 4E@Z"p46 Dt4 744U4?+d4?ע#>7" ֔!MD \p D4?@ 4%@#p47 D4 744U4?+dH!H<4K`4y74K>K?IK?AK?9K?1K?)K?!K?K?K? @O?4\4Ԁ- D? @ _`Z!p45 DL4 ?7 Ue4+d\4Ԁ  D4 @ 4 8`Z!`p45y D4 7448U4 +d4\4Ԁ D4?4?@ 4`Z!@p45Y D4 744U4?U+d4к\] DH@4`: H4@ ׻{] 7?ֿ@ R`Z! p459 D4 ?R7U 4]+d4?@ R`Z!p45 Dl4 ?R7U4+d#'75к\  DH@4` H4  [{: 7?ן @ ?&@Z p44 Dl4 ?7 U4+d4?_ @ ׿`Z p44 D4 ?7 U4M+d"g6vк\  D"6ԠD\4 D"Ԡ6 \U4 D\-4Ԁe Dȅ]+d p44.D4 U7ˀ]K>KXKKW@ +dH?C04 0v4 0B4@k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?QKD4@7C@7( ( "4@ (0+Kz14?kbh44&4&Ka?H?@4)%Ӛ &:@4 `U"HҺ@4  4 "@I?4@$ Ҽ J@4€?@ 4̀_`4 _A*4 a4 4 4 4 I?@$z Ҽ$"@ӷ 7'?'7 7?4@$: Ҝ?W@@__@ _@` _I?kgh"*4Bkwh@4 4#6kihI?#J Ҝ?wkghI?@4@ T V 6g?" Ӽ?@kghH?@4@ X  w 7?$@Z <?@@K}1 p@A! X@K}1 :!ap45y.D4 7U594? kghKl1 4K>K?QK?IK?AK?9K?1K?)K?!K?K?K? @O?H?"R P\N@@M@U@M@I?;@@W WH whׇ 6?SMU@I?M5@@M@I?4 _ 4 ؋>++@4J"b44@4 *!X44@4 ʉ `@4 艼 B@4 `7 4b @5?4 =Ka?x4M@;Ka?Kb1 : !p449.aD4 7U=5@ME@Ka?H?+|4?0 "4@  4 @ 5`X7Kt1 :!p45.aD4 7UE54? kgh+|4?0 (44@ 4 Z5::u7Z5Z+dH!8< @Z5Z4Z]5ZKa?4"\ @Z5Ze Kz1@:O Ks1 :!p45.D|4 7U59 ς dk?ok? k?k?k?!+}4k?144& dR_7K?1 V5 @ 4?@R4_d 4?K>K?!K?K?K? @O?+}48 k?7Kyh(@+dH7 *H: ȏB 4K?Y@7?+d]H:@+dH:K_4*KX4%7 2#p7 `4D 4 U97ς=K?Yk?ok? k?k?k?!+}7C44@4%L Hz M7 "4 4+}48 L!H  wB!B!*L Ht  |4"p6/1D4 HyU7HvB4X Z(0BHs6} }C (8 ?Hs44K>K?!K?K?K? @O??4Hz7Y yC?(0u4k?ok?k? p7CKZ4/M4 4Hs6a a4 4K?YK?K?@O?Hz4/M4!H7̄ bHz4/M4 H}7̒E |Hz4/M4 Hz7V̚ v4/ME4 (@Hy75 u4"Hz4/M4 (@Hx7 d̂]4Hz4/M4>U@Hw6̌ t44/D4 HyU74k?ok?k?K_4X7CC"47 z p401M4 `Hz7] }Hz40MU4"*Hs6e̒P e40AM4 Hd4̂ w# pHz79M4 @Hb4X ̆ xHz40QMu4 Ha49̈p yHz40aM-4 @H|7̊ sHz40qM4 Hv6̌ }Hz40M4 Hu6̎ Hz40MM4=@Ht6̐@ z440D`4 HyU744K?YK?K?@O?k?ok?K_4X7CC!H47 z#!p7901M54 h@Hz7] }Hz6M4 rHv6 ̆ b"pHz60AM4?"pH|7̂H a"ap46y0D4 HyU744K?YK?@O?k?ok? k?k?k?!k?)KD4@7C@ (0  JH}7 zCW (0ǒ 0HC4N 4J!zCP֜ ր g?A5C (8!CPEкc?Ha@(Pc?H|CPּ ֠ g?+}44&4'R_7 M7?~@5?_ ˀK>C 8>@CP c?Hb@_Pc?c?4K>K?)K?!K?K?K? @O?L)7?Hx7+} 8  s46uk?ok?+dH$7Xh84#+d4P]49 Ka?4? `@Ka?47 B x@+dH98 X@+dH:` :Hwhd4kwK?YK?@O?#p470D4 U 7Hhd4kk?ok? k?k?k?!k?)7E7&_7:hHH+d4H$h?4#P4@ 2!ZKz1 HyhdˀXkyHh}4XH@ R4@ (024@ ( 8 ?4 4_u4hd4@ K>"ap46y11D`4 U7Hxhdˀ(kxHwhd4@@kwK>K?)K?!K?K?K? @O?k?77_Kk?K4k?Kk?yK k?\yKHK>@7?k?o apk?4y1M4 p@K?Y4@O?K?4y1MU4 @K?Y4@O?K?4y1M4 @K?Y4@O?K?4y1M4?5@K?Y4@O?44y1D 4 K?U 7K?Y4@O?k?ok?7DF 7# z b#p472D 4 7U A44|K?YK?@O?c cccBk?ok?K_4X7DC 47 "ap6y)1M40bJ#p472QD 4 HC:YU 7H6 4|K?YK?@O?k?ok? k?k?k?!k?)k?1k?9KF7C4X@7'44"4 hA b4@ (0BHy78 xC ( 8 ?HyHC!@p5Y%L50̂*5Y%L50̄5Y%L50̆5Y'L50̈5Y'Le50̊5Y%V50̌b5Y%V50̎:#p7)1V5 Ԣ4?Hsi f4K>K?9K?1K?)K?!K?K?K? @O?k?ok? k?k?k?!k?)k?1k?9KF7C4X@7'44"(4 hA b4@ (0BHy78 xC ( 8 ?HyHC!@p5Y&V5!R5Y&L50̂*5Y& L50̄5Y&0L50̆5Y'Lm50̈5Y'LE50̊5Y&`V50̌b5Y&pV50̎:#p7)1V5 Ԣ4?Hsi f4K>K?9K?1K?)K?!K?K?K? @O?k?ok? k?k?KS4X7DBy6e#@4? @ b4@ (0BH7X C ( 8 ?HHC p42k?!4L 0`R42L40b*42L40d42L40f42Lm40h42LE40j42V40lb43V40n:43V40p43!L40r431L}40t43ALU40v43QL-40xr43aL40zJ43qV40|"43Vq404HK?!4|K>K?K?K? @O?k?ok? k?k?KS4X7DBy6e"4? @ b4@ (0BH7X C ( 8 ?HHC p42k?!4L50`42L 40b42L40d42L40f43QL40hr43!Lm40jJ431V40l"43AV404HK?!4|K>K?K?K? @O?k?ok? k?k?k?!k?)k?1KF7C4X@7%4"4 g@ b4@ (0BHy78 xC ( 8 ?HyHC! p59%L40̂"59%L]40̄59%L540̆59%V40̈59%V40̊59%Vy40̌Z59%VQ40̎2"ap6y)1V!4004?H} "@4܊ f4K>K?1K?)K?!K?K?K? @O?k?ok? k?k?k?!k?)k?1KF7C4X@7%4" 4 g@ b4@ (0BHy78 xC ( 8 ?HyHC! p59&VA4!J59&L e40̂"59& L =40̄59&0L 40̆59&@V40̈59&PV40̊59&`VY40̌Z59&pV140̎2"ap6y)1V4004?H} "@4܊ f4K>K?1K?)K?!K?K?K? @O?k?ok? k?k?k?!k?)k?1KF4X7C@44#P4 g@ b4@ (0BHy78 xC ( 8 ?HyHC!p5%k?A4L]0̂b5%L540̄:5%L 40̆5%V40̈!!p592Vq40̊592VI40̌592V!40̎j5&L=40̐B5&L40̒5& L40̔5&0L40̖5&@VY40̘593!V140̚z5931V 40̜R593AV 40̞*59)1V 404?HsK?At f4K>K?1K?)K?!K?K?K? @O?@ @K?@ @k?7@k?UK?@K? 0@@K?KKZm7K?Y@7?@ @K?@ @k?ok? k?@$4W k?k?47k?447Q Y7747L4x` H@4 ^ 44@\@Ve@K>K?K? @O?@ @K?@ @k?ok? 7D4Q k?k?+dH: v4xk?k?7_h4k?y4 k?qk?i\k?aV=@K>K? @O?@ @K?@ @k?ok? 7CQ 4` 7k?4P7?1+dH:7Wh 7?1k?` n4pk?4k?4k?yk?qk?i\yk?aV@K>K? @O?k?+dH:7Wh?5 5k?@ @K?@ @k?7@@@(7zV@K?Y@7?k?ok? k?k?k?!k?)^7C""+d4$ pHP@7434M4 @L4H7H7Pmh7_54_e7Hx S s434 MI4 jHH4'Ph7_!4Hә ?U8 u443C 4 7T E4H^F H6h^u@=HK>K?)K?!K?K?K? @O?@ @K?@ @k?ok? k?k?k?!k?)k?1@@Kwx 84##p473C 4 T 74^=kx$+d4$ p4*4$HP@744Q4 M5:!HH6Whӓ @7444aC4 5T74KKRS6sv k4M5:%zHK|Cc444Ma5: @HHH6W=h7p@*444CT4 T7KyC:5?T c:45A4L5: @H(H6hW]@7p@*445aCt4 T7KxG5?׵ g454L5: p@HH6aWh 445C4 T7Z46!4 L 5: "4614 L5: H^@ @H7h^@;HV@K>K?1K?)K?!K?K?K? @O?46A4L5: H46a4L5: 8@HHKiA5ֿa546q4LU5: 8@H(KhA֟Ea464L5: 8@HKb@\ן \464L5::46HKa@"_u`"446C4 7T59H% (@ @K?@ @k?7+}Ap4:k|K A4k|V =4[5@K?Y@7?@ @K?@ @k?7+}A4:k|K A@4k|U 4[}@K?Y@7?@ @K?@ @k?o[ @ K@4+dH?C70@h9W@` `7Y4zKa?49Y4zY4z+d49@Y]4zV @K?Y@O?@ @K?@ @k?7V -@K?Y@7?@ @K?@ @k?7@ @#p477!C4 T7V }@K?Y@7?@ @K?@ @k?7@ @Kyx"#p77q4C4 T)7V@Kb4kH] "k?P4k?Kt4fk?+dH:7Uhk? Bӓk?yӁ? Fk?qӂ_b Bk?iס ABӂ aAF { BBӜל 9\ T Tֵ ӡ U TӼּ J Bv[֖ ]ּ Sc TׂB A׽! B bVk?a4[ 4K>@7?Kz=@"p467C@4 Tq7?Kw :C* *C]40 0 _@4@ @K?@ @k?o[ 7C!K k?+d4:4k1^ E4 2#p477C4 T)7KyhY}K?+dH98Y}K?j+`4kw4Pi7?qk`C? 0 X7 2#!p47981C4 TI7k?Ka?4#K?YK?K?Y4yz :"ap46y8C4 T72"p468CH4 Ty7[ @V@K>@O?k?74Pk?k?K+dk?H:7Yh <k?yC34?k?q4lKֳ k?ה Vk?iӽ Sk?a4[ u4K>@7?@ @K?@ @k?7@T@Kx "ap46y9Cp4 T7V5@K?Y@7? #!p4799C4 T97@Kw?Kx#p479QC4 T7-@_}k`@ @K?@ @k?ok?+dH5P Qk?K?Y7 7#p479C4 K?T7+dH9#H36th4VA@K?YK?@O?Y-4Y4K?k+dH7^?m@+dH87h:4@84'Ku7qKs7y k?k?ok? k?k?k?!k?)k?17' pYuk?A+dH:74$4:L m4H!47_hHxhxKa?K?AY =4944z_4^@&24XHC 7hPAH7434L m5#@H'5H6L!hHP77_5:5_7K?AY7K8 Zk8Hg!p5L u4H 7ShY]K?A r J44:1Cx4 k?IY=K?AK?IT q7Hb_ȝhbHfhfĝ4z5L4 8H7WhHtր֟Ɲ=ht5L%4  0H7X hHa?Ȝha46L4 0H7YhH|ןʜh|4:Lu4  0H7Z hHv̜5hv4:L4 0H7IhHuֿΛhu4:L4;4zH4h4Huh434 LU5 H 'H7Ph7_)5K?AY7K8 ]k8H 4:4L5 X@H GH7ZK]hPh|@HH <44;C x4 7T 5H^@ H6h^@9HK>K?1K?)K?!K?K?K? @O?@ @K?@ @k?ok?+dH64#Pk?K?X7 x7Y@ X@^@!"Hs6t^ht?@@X]K?k?Hx^1 :Hw6hz4_K?p@+dH?+dH5( "YeK?K׿kKa?K?Y49V@K?YK?@O?@ @K?@ @k?o+dH9O}k?K?J=7 0@X =K?+dH?8#p7;4C4 T7^I@ B"p46;C`4 T7V)@V@K?Y@O?@ @K?@ @k?7@p@#p47<C4 T7Va@K?Y@7?@ @K?@ @k?o+dH:k? ap4y!B4 S7Vk`x[ @K>@O?B%44@7s@W$7}@?A$7y@V$z7x@ֿU$R7w@֟T$*7a@S$7v@׿#7u@?Y#7t@X#7s@W#b7}@?A#:7y@V#7x@ֿU"7w@֟T"7a@S"7v@׿"r7u@?Y"J7t@X""7s@W!7}@?A!7y@V!7x@ֿU!7w@֟T!Z7a@S!27v@׿! 7u@?Y 7t@X 7s@W 7}@?A j7y@V B7x@ֿU 7w@֟p@4?@k?7Kxȃ 0@Ky `@K?Y@7?#p47>aB4 S%7+`"p46>B4 S7eK?YKu6Ks6 k?k?ok>k>k>k>k>k>k>k>k>k>7'!!pk>K59>ԢԠ g?U4444!4+}@6@56 5 g?UH$@&H(^@ zk`1+dH?7k?I4*k`14^7?IKhABK?IiT7kc1##K>We47k?C?U'k?C?W]5k?K>44@k?ȼ`k?K>K59>ш>@+}@<@=\ ] g?UH$@&EH(^@>@!`pIA4-OmiM75y@4 L5 2IH I_7V uiX59>4L15 2IF IM5V iW܁B59?4L5 @I\Ƞ59?!4L5 c?UIV59?A5LA4 c?WIUp459?QBd4 S7IT] @IB4LiL]@=IAM+<k?C?U@4K>7k?C?Wx4_44K>YK>K>K>K>K>K>K>K>K>K>@O>@ @K?@ @k?ok? k?k?k?!K|x"04#+d pH:4$4>L4 "@H4>L4# @J 44 H7LY4#k`1H4k`1]4Kzh@ @@ @$7h4O}kw17J=4B774Q 7H4_4k|K 7WK(H @H(UUk|K>K?!K?K?K? @O? !p449?B 4 S E7U@}K>+}7S h@04: 07+}4:_M4Ȝ@kdH "+}4_ 4:7kd+dH:(WeH(+dH:(@H(Uk|uK>H+}7h@ 4: 07+}4:_=4Ȝ@kdH "+}4_4: 7kd+dH:xWUH(+dH:x@H(Uk|eK>J4H+} h@4:@ 07+}4:`_4Ȝ@kdH "+}4_4:7kd+dH:W ]4H(7W7H(@4Uk|-K>kfH WH(H @xH(U-k|K>@ @K?@ @k?ok?+dH8Ok?K?@07 @7P4H7]4H+d#p47@BD4 K?Sm7+dH7UK?YK?@O?@ @K?@ @k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qKv7E!@4#K|x!r Ap44Y0B4 S7U@ Kc@K>7 H !@+}41J"4#4. / TK>!6  3 ?  )ZH"p46B4 S7K|xg>+dH&4+Og>7Ji4B7k>4Q97IzD4 4Ksk>44 4 4?> 4 Ȁ=+}HW H]=kd 2 p44BT4 S7U @K= 5 ?5 5c>5c>5 5 =5 g> 5( 50 55 ? ]@$P@I|7ib]@$!p!pIqO@754KE6: 2IvI7V!iz:54 K6: IuIq69Viy7_}7"45 B4 S7"5`4 K56: 2ItIp6Vix*5>4K6: 2IspIj5WViw\5p4Ku6: c>Ia 05?4K-6: @I|ɠ@54 K6: c>Iv54K6: c>Iu54KU6: c>Ith56:K 4 05 5@4 B84Si7] @ I}7i|] @;Iq+dH+C>4C>Isѫ?4?Jw( C> C>4 _4; -?58- K>W47 (@W4C_c+dH:4K5_ 5:7Y4K>@P5h8@(`(C>Qk?h0 k?k?BK>5xk?K>5k?yk?qk?ik?a@ k?Yk|K>Wm4ȼm@k?AK>5xk?K>5k?yk?qk?ik?a@ k?Yk|U@Ka %KuJWJKc4 eK=K>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y+}4& 4.k`؀`!k`+}4#4$4%4&4'4(4)k? `W4  4 5) k? ]5 k? Ҙ4 k? 74  `@4 Hu ?-4c 5H"458k>5k>5 +dk>4%5 k>555555 5( p504c 4WI6: 7K4"(@H+dh2(4nKUJ(6YKE K> P uK>@ #7k?Y O769k? 4ck?a p k?y k?q k?iK>8 ?k?K> Bk? /@k?c >5HK=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O> K4 X@H+dh2x4K\K(6YK K> K)4 P@H+dh2 6YKVJ(Ky85K> K4 H@HK]4.6YK(K vK> KA4 H@HKX4.6YK(K UK> K4<%@HKW4.6YJ(K) K>k>44B4 K> 7Sk>K>k?ok? k?7$6k?!B4@ 7J K?!B`7 |K?!P7 eK>4? K>hy( dhz h`0h`8KwВ0kcK؈ Rkc#p47pB4 K?!SI7 47K8?7 h8j8Hx8kc7h80kck?K>4_K>4|K>K?K? @O?Ku7Ks7 k?k?ok? 7D4(B0k? 7JK?B7 |K?P}7 `K>Y ` zh` H0 h0K>ak?H K>y_K>4|K>K? @O?"p46B 4 K?S 7߀ 47K ?7 h j h0h k?o7C@@7:k?K>ak?Hy K>YK>y_K>K>K?@O?k?oKc؀` @k?HzJK? @Hc8`?@4K?Y4|@O?K|؃ *K @K8?@4@k?ok?Kc؀` hk?Hd0 :HJK? 8@H ?@Hc8`?@44K?YK?@O?K؃ bK  :K0 *K7 8@K ?@K8?@4@K|؃ *K @K8?@4@k?ok?7#"p7DKZJ6>ѓ0b J+dH?xH 8b 24K?YK?@O?ׂׂC\0D4@@ @K?@ @k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>4_k?+dH97:_7C@Ka?4%4444 4 4 7?a!p#b@x#JH4n4c@w4!4 | " H @ PH phH!J Ӽ!R֑ 6? 7?54c`p@rH! P ?M@P@ _7H ` _Haڅ ʍ 5p5I]685KI6u@K)6>֑ H 0hֱ 6Q?SK655I685P5?4  Y_6`   668?c67@4c_ 4zu4cUK?Z@K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>@ @K?@ @k?7@4Z@K?Y@7?@ @K?@ @k?7@4Z1@K?Y@7?@ @K?@ @k?7@4Z@K?Y@7?@ @K?@ @k?7Uy@ZA@K?Y@7?@ @K?@ @k?7U@Z@K?Y@7?@ @K?@ @k?7_ @T4ZA@K?Y@7?@ @K?@ @k?7_ k?TK?Z@K?Y@7?@ @K?@ @k?7_ y@Te4Z1@K?Y@7?k?ok?7DK_@KC`4_ Hw4@!`@H 2XA@!@@X H!"H (@H  Hx K Y@Hw! 0 4 4" (0’ 0Hu4  X 7 4K?YK?@O?ˀK?YˀK?YX@ˀK?YˀK?YˀK?Yˀ}K?YˀmK?Yk?ok? k?k?k?!K_@4f7C KD`4l r4v b4x R4n B4p 2H 2H|  RH H" B:ςK>"`p#46zPR%76X QHz"`@X Hz"@@@b@X=HzK8HXHzHzXK8K8#+J7'*Hz!X FHK8 5U47T ә׺!  &T Vb VF! @Ht@4` HzXiHe( ] 4z 4? bS@H4" _ rHy@ 04K>K?!K?K?K? @O?ςK>ςK>ςK>ٗ7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"ap6} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#p47 @R4K?Y4|@O?=7?4?#p7 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#p7 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"ap46z @R4K?Y4|@O?@Ku8Ks8 k?k?ok? k?K}1р!"pR6 T@K>K?K? @O?7B6 6B@?6b?+dH:k?4"pkw1_6 "@+dH8K?1TK>+dH?C+d70@h"+dH$@4D!4@+d4Ueh34 @U=@@+dH5B4@7?w(0(k?17C ?7C Z"pR }6 K>"pR U6 T@eK>7Cw(0(77C ?7="apR 6z pK>+dH"k?)HZRM@+dH<k?!#ApKR M7Z +dKu8aKs8i k?k?ok? Kw1 b Ap44Y 0A d4 R 7T-@K>K? @O?+dH?C+d7@0@h=+dH#@y4D!@+d4Uh?4 @U@@+dH8C+dH:4k?!4x4 _%kw1Ⴠ @+dH<K?!TK> !p449 A 4 R 7T]@-K>+dH8k?R]K"p46 A 4 +dH$k?7RHJ 4+dk?ok? Kw1ـ b Ap44Y At4 R7T=@K>K? @O?+dH?C+d7@0@h=+dH#@y4D!@+d4Uh?4 @U@@+dH8C+dH:4k?!4x4_5kw1ك @+dH<K?!TK> !p449 A4 R7Tm@-K>+dH8k?RmK"p46 A$4 +dH$k?7RHJ4+dKu7Ks7 k?k?ok? k?k?4+dk?7CH:+dH7k?!+d#!pH8k?)V }79 p7444^m7h`4>4k?4z_4hd`N}4k?744Ja74PI7?#p7 k?1VK?74\I4V4zkP+dH:_K?1744>4_7hd`K?!V K?)K>K?K?K? @O?@ @K?@ @k?ok? k?k?7C p7&K9J4 !r4 _4z @C(9AjKH@4@(=ArHH7?A#p7 0.4'F0@00N0'6?V k?1KP 44 R4^HvJ4 K?1U7H|K44%7K>K?K?K? @O?44 R4R̂@(44 RU4Xm7?Ak?7+dH:Ky'Y Y4K?Y@7?@ @K?@ @k?ok? k?k?k?!+d4#4@4XHgN @7W i4Hx7HC78h}W]@ RHt6hC 7hvHsBu04?HgT @K>K?!K?K?K? @O?7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"ap6}  : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#@47`R4K?Y4|@O?=7?4?#p7 p `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#p7 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"b@46z`R4K?Y4|@O?Ky 0ˀKx@K"b@G6w 79?ky u@ ך7?ky  ktG5t@Ҡ @ <\ XkvKw#@F7v@ : Ӡ \@K 2kzKu67kz@ktKw 4 @B7k}K zkv7@k|@kxk?o7C"@46A4 R17 DK?Y x@ H L P T@O?k?ok? k?k?k?!+|4#Hvk?1H}4$+dk?aHx7&4? k?yHw44: k?He k?4k?hhhhJ`k?4?y 4? "@4< 04 44 4 4?H F S6th(`"@4867?aJ 4w p@_eK?1ˀ K>_EK?14K>K?!K?K?K? @O?K?144@PK?yhe K?hgK?hK?hwK?aUhxk?ok? k?k?k?!k?)k?1k?9k?A+|H?7H7@87C7(4& Y D%48%4X&:kw4 kg6 RJ5JBkb_m4 4 _M4?5)HH U6H RT6@a@ҊJ "6? 0V b Er#@7 E 鸀 8z\|@_= X F f@0 (4g_4ן @40@_4 @4@_4 44?G7 @ ?7?0 (@8G׿8gD  @4K>K?AK?9K?1K?)K?!K?K?K? @O? ":? aD_ j@ aHe aL "b `D׿ }@ `H- `L " `D֟ t@ `H `L@ RW6d7P47? @7?_5`B  @57? D H5`L"_ @ғ V" `@dRD4 V i@Ј5?4 XI4z4=@ x@?] yD#@47@R4-4=@ `D_ z@"@46@Ri44=@ `D s@"@46@R46]4_M4?4  H@X  k@ ? 7 \4h_4z40 * k@_M |D04h _Z |S s@4h0@_4 @5@_4:4A5?4`058? ZY 7?_6?`J B@4Sx  S  @4G? Z4G w @ӗ97?@4@ 0Vu@4w @w4@6@E4G5w@_4z4@ @K?@ @k?ok?k?7?1k?1k?)k?!!0k?944@@ K?9 7B *7?6`Hw bB *7`?64c?`Hw?@K?YK?K?@O?He4eԠH>7H54?ԠH@? u4@ @K?@ @k?ok? k?k?k?!k?)CB77$#7W7x*!444Z44^4\` _#Z J4~V#4T%jc@ V#"ςpK>@%`߿ ($% @?%B60B4 6046B64A`_ (@B6` @%4%Bc6 `$] jB ZB`_ (6B6 $` B6cĂ B6 ( r4~4^4T @!# @#B6 ( E84!4ˀK>قb :@$B@6 86b?@ ZςK>@ @Bc6 c@ "B4@<]6@#Zǃ 4^#R4K>K?)K?!K?K?K? @O?@!R`!R`߿ (7$ "`/B@??BςUK>6?k?1`_ (@B@7y*!`&  @7g*!4 `  *4xK?1__%4 4@?@ςeK>ςUK>ςEK>ς5K>ǣoB@4\ςK>ˀK>ςK>ς}K>ςmK>ς]K>ςMK>7@*c  @7%|@b:/4AςK>ˀK>ˀK>CW 07\ *7C?@4@k?ok?k?4?Kw(Kx0Ky2 h x W W  araX4 P6? D X Ҥ `6 e4c_7`@ V   ֠ 476 m7 ` aH4P6? X ҃7 @67 D_4B`@ X  v 7ր 4\6 m7 7@ } Ku2 Ka(5ku(K|0 kb0K?YK?K?@O?Ku5!Ks5) k?k?ok?4$k` Ky2 ky(77z'_}ky0k|@4Z 4bHkz4V b(k`0k`0k}4|K?YK?@O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K>4'k`2K2 7Hk?K>7$7k? 6 4%Kt2 J4 0kj2 45_474k|2K  4#C!0@K2 Km( hk(Kn0 hk0Ko%Kb0Kw(W%% @_4K2 8k0kh(kh2 K2 & B4ZU&B&6 (4 0Z4 kv #*K}2 4 ZB :K?"B _4"Km A4 44 84 ?4z "5A ?5I:4!51Ky J - BK J:H !Z@0 6*61 J:@?}6*ku2 6 kp2kj AW 24z "5JAW ?5JI:* 4 Ky Jm * BKw I:H )`05+5) I:@?}5 6 46* #:@#K?@&Kq2 B &rKr B__4&BKa 49ky 4@+j_}5YK C@0Ka2 4,@0kl2 &4 t&C4= C4vS'"C,C+C+k2Ku2 6 kj2 (k0K2 @z C4Z C J7`8k2 C?7C ?7k(:K2 "@ Iu6Ћ:WK2 Ks2 6k2 Kw0Kx( ( 8_4kh(K0Kw( (k2 ̟4Km0̟7kr2 4hkq2Kh1 BK|2 Ka? B@ H4:@4YIA@H}Kz Kd k} k`1Kd2 44~kp2 Kv2 6k2 A! IW 50kf2Km1 !7? CKa?l 84:@#@HIWI17 @@IWk? "@49CHIHKz Kb ks ICkc1h4~ "@7kb2 kh2HKz Ke K? k} K? I_ID  44Kz1 :7?Ka? H"@4:@I6HKz Kx kx IZkz1@0tt4~4Kq1 Kl2 Ka?4:@C 2"@HKw I60@+Kr k?"@6pCHIqk`1K2 7kz2 7e'ke 4~Kg1 zKqKa? 84:@!@H5I5W(+!@H5I5Wkj1X4~C4 44 04 k2K|2 7kj2 _=kj K2 57Kp1 8@Ka?"@H4:@60I5Wkj1@ 8t4~`4545+ +Kf1 :Kv2 Ka?"b@ H4:@I6yH9Kz Ka ku 4~Kr2 6Yky2 "AS I 5Iki2Ke1 8@Ka?#"@HIw4:@I!79HYKz Kx ki 4~ 0@K2 A*7ka2 kj2HKz Kd ks K? K? @ -IId  44K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ko1 :7?Ka? H#@4:@I I7HKz Kn kl @0tt4~4k` 4k`2k`  "k2Kt2 6ki2 K2  Ky1 8@Ka?!@H4:@50I 15Wkj1@ 8 t4 ~k` d7kn2 km2k?7K?4k?_ =k?K?Y@7?Ku6QKs6Y k?Ku4Ks4 k?k?ok=k=k=k=KcH`!@K@Ka?h?!4$"@_ 60 7@w4^w z7>_4z Z"@6@_7= 2K=K>ɋ @K=K>= 4@477_m4 4DHH)4z R E@477_4?H+`h4kg@kcH4|K=YK=K=K=K=@O=Ku4!Ks4) k?k?74_7?K?K?Y : K? K? z 4 S 5עK>8    @7?@ @K?@ @+d4? 44_7+d4? 4666x77Y7!4=74 4447+d47 ,4474 b6b:b8b<b>b@@6 @P@K?@ @Ku2Ks2 k?k?o_4 (744|K?Y@O?_m4 | 274  wH14z`u4|@ @K?@ @k?ok?k?k?4@4744z  | f7C 04Hw7$Ԁ2_4?gHy@7HsHz d  thu7K?YK?K?K?@O?_e4 7Hv7H}m |@ @K?@ @k?ok?7CKZ@ H KD?4H 4zK?YK?@O?@ @K?@ @k?ok? k?k?k?!k?)KE7C7$ 4H 44H?H H!2Hz 4KH r F84H I@54?}@]HT@]HK_H @507G5?/KH d04 g4 sHHz H 1KE?4 dH @HH@?@ g4 vK>K?)K?!K?K?K? @O?k?ok?7CK?04hw87?@xPh}0 04h@ y`xP Hv8HzHA7Ȝ7:!77  dKv2)7Hs4 z d  z4 hy @uP֠ Ҵր `tPK?YK?@O?k?ok? k?k?k?!KW7CKX@vP  K_З KE6gHv8 X7HzH47܁a P7?4HzW   6?_`@  6H} 66Ha66w 6 Hb T Ha 3 u7Hg4G":@uP5B(@H @tPHv@HzH47@eP477 Kv2)7 f  h} H|070}4П7?A5P6?4H| 7 6?__`  Hb W 6?6?"H|7?7W? 4Hs} =Hg 'u79? 47@eP4   yԠ `ePK>K?!K?K?K? @O?k?ok?k?7$KY ! 7C K=@xPK%(Hv@HzH7 @wP7:7@wP`wP (4$w@xPK:D_@xP J d dK3hs yK?YK?K?@O??K?YT@K?Y@ @K?@ @k?7Ka?#@49@Q7PHKz2!K?Y@7?k?o+dH680Kt'+d0h48K|217CK4@z@2_}4 rK}21k|21K6k7  4K?Y7@O?K?Y@ @K?@ @k?ok?k?Kc21` bHx7?@2d 7  7_4?Hc`?@K?YK?K?@O?@ @K?@ @k?7+dH68 k? 7H]K?K?Y@7?k?7K2A kz2II4k|2AK?Y@7?k?oKs2A (7CI4Kz2A( \IY4+|4= P k?Kx2IKa?k?C4:@ 7w(#"@2@7w(H79_U4K>@O?@ @K?@ @k?ok?7C@04_ 4z 7_m4z4K?YK?@O?k?ok?7# 04 _ 4zȜ@T4y7 @_4z4K?YK?@O?k?7G=k?7_k?k?K?7GK?K?YK?@7?@P@K?@ @Ku6Ks6 k?k?o_k? 87+d4# @K?#@7 GE4zK?Y4|@O?k?77]k?)7?7?1k?!k?9@k?1K?Y@7?Ku6Ks6 k?Ku5AKs5I k?k?ok? k?k?k?!k?)k?1k?9k?Ak?I7D7#k?7G7:7?74G=4K?C! "@4& H4J!@4 T4 \7k?C!*B5 ҙGM5 BK?6k?5BG y?@K?CL,!H@K?7?k?7Yk?_KK?C K?7?֠k?K?4Vk?K?C>7_5z "74K>K?IK?AK?9K?1K?)K?!K?K?K? @O?7?_4K?C J 7k?CA) JK?7? k?7Sk?_K:|(K?7?_4 K?C5 yG5 BK?6k?5CG]ӹ?@K?Aӵ6?w4? 5kk?77?k?9k?)7?)_}k?1K?Y@7?k?7@@K?Y@7?@ @K?@ @k?7@@K?Y@7?k?7@@K?Y@7?k?ok? k?k?k?!7D@"7%@"+dH#@ @4&HyH4 bHc`?Hy" ZHyH}4#j(@4$ 4HM4 āHz_4"@7G]47_}4 |"74G4(@4' 4H4 gG47_4!`744G=4Hz @G@ fG547_U4 | 74G4H@ (@KHe4@@H@ 0h@ˀ0K>`u@ (@4< H|ˀK>ˀK>ˀK>ˀK>H@H jKHu4`H@HH (@KH-4_@H x H|K>K?!K?K?K? @O? _ : W ]  SV@ \CT x4@ӿ< 77Z<  @?@@k?o7hd>he>hf>hg>hh>hi>hj>hk>hl>hm>hn>Ka?H&7$7H7 %4%0Kh2Q+dH*@ %IYH 5 eIJ@?IY@%zIG@4^"!@G475s4 K?K?g~4` k?k?77h_5 @H4 D 4`5@ K?K?~  k?k?77h_5 H?w5@$4G 4!b@5y p@ 07IY@ 7@ 5:75:@ 77G 5z7G 5 5 K?K?~4`  k?k?5y7@ @7!b@5y p@ 77@ 55y @ 7G 5:7K?K?~4`  k?k?A774 tp4 `55775)76 7,?5y H5!5y H}5!45@ H5X 75@4!I  @5 @x4!X@ ?5!2A7 ("5)A7 ?5)>E@  ˀ84~4 !@M5 h44~Hb>YHn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>˄}hmhk?ok? k?k?k?!k?)KG7C k?1@4zHc`#Hh( H0"jHf$4HsHw d Hg$XH: GHuK?1DRĄX@H}7G? ܋ #D!HHt( Hu0 刀 6# @#*Hx7G? Ջ#D?Ht(Hh  Hh#Jz HH]K?1?-HHa Hy' Hc "Hx C HwH Hh!J HHK?1>HHb H}G Hc!H C GK?1K?1_7Hs(76y}Ht76y?Hb0U7 E 7@=Hyˀ8K>Hx Hc!H CK>K?)K?!K?K?K? @O?ˀK>_u@\E@_U@\@_5@\ H _@\E@_@\Hˀ K>_@\H_@\ H _@\@_e@\ G @4ś7 Ş'H| ˀMK>_@\% C L҇L HzH ZD:D  "@@6 #@@7 #"@@7< #B@@7\ #@@7 0"b@@6| @#@@7 `"@@6 pk?o b@k?^4z  C @^4z ` C `@^K? C 0@^4z  C04| K?Y@O?C8X7? (7W6 ?7@6?k?ok? k?k?@ 7E@ 8Kc2Q(@4$ P4H4 @(@4$ P`kd2QG47_ !k?! 7K?!4Gy4kf2Q G4zK|2QK>K?K?K? @O?k?ok>k>k>7#7Gk>k?K>4k?7zP7k>k?k?k?yk?qk?ik?ak?Y@k?Q!7@ @4z X7GY47_ y4"`74z4G4k?Y7?7? k?7?7?!k?7?7>k?7>7>k?y4z@Dk?K>Gy7K>k?47k?QK>4k?K?k?K? k?K>k?yK?k?qK?k?iK?!k?aK>@8K>! 7Ƞ4H @@4H H 4 `4 KX @@ J 4c ? ``4@44K>YK>K>K>@O>H @@4H jH  X4 K_ @x@ K:@  ?4?4G!4z4 _ : W ]  SV@ \Ku4Ks4 k?Ku5QKs5Y k?Ku31Ks39 k?Ku6aKs6i k?k?ok> k>k>k>!7D4@KZ@" _4"p77>_4 K>48bb@_ K>7" K>4g44_4!@ _ _4H B4% # 7 *!_I48 !H7 H(4 !hHz"H!hHz H!hHzH C   !`Hz H C h !XHz(h(H!XHz0 Ch0Kg2a40kw2a_4K=_4K=K>!K>K>K> @O>G4zK=_@\}@_u@\ _U@\H_5@\H_@\h(_@\ C G4zG4 Ku3Ks3 k?k?ok? k?k?k?!Kd0!4%7C4&4tk?qKx2y!:4K2C 4 "7k2C?7 8077k2C ?7_ @ _?'k?qK2C?=@>k?q4K>K?!K?K?K? @O?k?Ky`7?q_4>K2KKu4Ks4 k?k?o 7hd6he6hf6hg6hh6hi6hj6hk6hl6hm6hn6ho6757$K?K?~`4`  ~k?k?7Y77G 4#@ 7 G 4 "@49 Jy4#P7DvF04Ka?4&4'4(4 4 F44z7qM4%H@u7q4k7q"Һ ߀ H@H5kA}"Ӻ |ߋ?5kA _85l5kAbZ zH"B ߈ RH5kA|Ӛ@ *"@ \߃?5kAa ` 5kHAx! Ѽ߀ BH5kAv! <ߋ?5kA|#25m5kAw rH!b <߈ JH5kAw@ "!: Ҽ߃?5kA!* `5k0 iȀ04N @-@N@UHN@@N@HN@%@Ni@EHNI@@N)@H ` 5kKy2yKs2qy @h@G 57^-5!755G5Kx2yKt` 5G 7^5!0755G 5Kb2yK` 4Ko2y5kw2y5zG Q4 R44z7qM40`i7q4G 4z7q?4Dz4JA4 "Kz`Ky2yKw0)_444~Hb6YHo6Hn6Hm6Hl6Hk6Hj6Hi6Hh6Hg6Hf6He6Hd6@O6k?ok?K2q A04#^ ڃ `7K2yKy` G4Kw2q +`GYKz`kd`kc2qK?YK?@O?@ @K?@ @k?7KZQ K9K?Y@7?k?ok?k?7#7D 84G 47  `?44K?YK?K?@O?k?ok?k?7#7D h74 44GA@7 `? ?4K?YK?K?@O?k?o X7\ x4G77x7K?Y 04K?Y@O?"}6vT"6*  " < 6"6&g?  Y p _ 4  @k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=64 k>4K=ak>K=iGk>K>K=q K=yK=K=CCK=4xk>cC 4yk>ǃC 4 `_#ªG57J (@Ha5!e6 J?@R4K=Y GY56O ^u7#7K>K>5F4^K>K>4t_%566? 6@ 4CC*cCZǃCq> #ǣCr@$"K>7@ 5J>M@$jK=Q`$ZK>_K>7_4z@7>p֟t&a&i8G&qFq ^4:(#7P64ǣ@ 4@ `4 @47`4 4eK=YG5zM7G5ZU7G5:]7Ga4%7GA457G!45746K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>47@5ycܥ@4\7@`5Yǃq>4\7@(59Eq>z?@ V47@5ǣr4V7@4r4X77@X4`47@ 4eK=QF56K>_K> 4 @K> @K> (K>J I K>K>_]4 0o4oAj6 o!:4  40 ! Ǐ@K>K>_=4 7k?F6Zk?K>76Yk?5k?k?yk?qk?ik?ak?Y_k?Q - K>6X_uK>5?575?~@6 M k?ok? k?k?k?!k?)k?17$7C4 4Ka?H?4'4h " <߀ : 4! \ 4"?5 4 ^ 5!7!4 Ka?4'H `Ӻ! \ 0@ `KӚ `@H `!2 < `  4?%4c 4K>K?1K?)K?!K?K?K? @O?N @HN @H!"@59 @H4ܞ=@N@m@H@C8X7? (7W6 ?7@6?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK>76K>7I4K>4 K> K>y ` @ :C_ 4 4 r4V_ b4X R5)A? 8 (@ ( _8 ?5)K:: F4K?IK?AK?9K?1K?)K?!K?K?K? @O?? crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)? crt0: errno: tsdcc0cPc\c@cHcpc|ccc8c@cdldddldddldlddldlddddd8dld d ddddd8dld d ddddccdldddddccdlddddddldldldld\d\dPdee,eeeedeeeeeeeeeeeeeeeeeeeedddeeeeHeXeeeepeeeeeeeeeee$._ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789.mri 0m@m\m@m@m@m@m@m@m@m@m@m@mm@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@vm@m@m@m@m@m@m@m@m@m@m@m@m@vvvvvvvvm@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@m@vm@m@m@vm@m@m@m@m@vm@m@m@vm@m@m@m@m@m@m@vm@m@m@vm@vm@vm@v|pvo{yw,|n@yon./../bfd/libhppa.happ.cend of file in commentend of file in string: inserted '"'End of file in string: '"' insertedend of file not at end of a line; newline insertedCase value %ld unexpected at line %d of file "%s" end of file in multiline commentend of file after a one-character quote; \0 insertedend of file in escape character%dend of file in comment; newline insertedEOF in Comment: Newline insertedP  4 <<<<<<<<<<<<<<<<<<<<<<<<d<P<<<<< <<<<<<<<<4D|DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDtDDDD,DDDDDPD\DDDDDDDDlDDDDDDDDDDD8DDDDDDDD\DDDDDdlDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDdpdh(8D-JLMRWZfa::DI:o:vwXt:>B@./../bfd/libhppa.hGNU assembler version %s (%s) using BFD version %s Usage: %s [option...] [asmfile...] Options: -a[sub-option...] turn on listings Sub-options [default hls]: c omit false conditionals d omit debugging directives h include high-level source l include assembly m include macro expansions n omit forms processing s include symbols =FILE list to FILE (must be last sub-option) -D produce assembler debugging messages --defsym SYM=VAL define symbol SYM to given value -f skip whitespace and comment preprocessing --gstabs generate stabs debugging information --gdwarf2 generate DWARF2 debugging information --help show this message and exit --target-help show target specific options -I DIR add DIR to search list for .include directives -J don't warn about signed overflow -K warn when differences altered for long displacements -L,--keep-locals keep local symbols (e.g. starting with `L') -M,--mri assemble in MRI compatibility mode --MD FILE write dependency information in FILE (default none) -nocpp ignored -o OBJFILE name the object-file output OBJFILE (default a.out) -R fold data section into text section --statistics print various measured statistics from execution --strip-local-absolute strip local absolute symbols --traditional-format Use same format as native assembler when possible --version print assembler version number and exit -W --no-warn suppress warnings --warn don't suppress warnings --fatal-warnings treat warnings as errors --itbl INSTTBL extend instruction set to include instructions matching the specifications defined in file INSTTBL -w ignored -X ignored -Z generate object file even after errors --listing-lhs-width set the width in words of the output data column of the listing --listing-lhs-width2 set the width in words of the continuation lines of the output data column; ignored if smaller than the width of the first line --listing-rhs-width set the max width in characters of the lines from the source file --listing-cont-lines set the maximum number of continuation lines used for the output data column of the listing Report bugs to %s helpkeep-localsmrinocppstatisticsversiondump-configverboseemulationdefsymitbllisting-lhs-widthlisting-lhs-width2listing-rhs-widthlisting-cont-linesMDgstabsstrip-local-absolutetraditional-formatgdwarf2no-warnwarntarget-helpfatal-warnings-GNU assembler %s Copyright 2001 Free Software Foundation, Inc. This program is free software; you may redistribute it under the terms of the GNU General Public License. This program has absolutely no warranty. This assembler was configured for a target of `%s'. emulations not handled in this configurationalias = %s canonical = %s cpu-type = %s bfd-target = %s bad defsym; format is --defsym name=valueNo file name following -t option Failed to read instruction table %s invalid listing option `%c'gas/opt/binutils/share/localeas.c%d warnings, treating warnings as errors%s: total time in assembly: %ld.%06ld %s: data size %ld .text.data.bss*ABS**UND**GAS `reg' section**GAS `expr' section*%sllllllllldddd\\ddddd\\ddddddHt,d>3k>2H./../bfd/libhppa.hatof-generic.cnaninfinity+-failed sanity check.ddddd||dddd||\\\\TT\\\\\TT\\\\\\@l$\./../bfd/libhppa.h@$,,,,,p,,,,,,,,,,,,,,,,,,,T,@,,,,, ,,,,,,,,,$./../bfd/libhppa.hinvalid identifier for ".ifdef"non-constant expression in ".if" statementcond.cbad format for ifc or ifnc".elseif" without matching ".if" - ignored".elseif" after ".else" - ignoredhere is the previous "else"here is the previous "if"non-constant expression in ".elseif" statement".endif" without ".if".else without matching .if - ignoredduplicate "else" - ignored.ifeqs syntax errorififdefifndefelseendifendcend of macro inside conditionalend of file inside conditionalhere is the start of the unterminated conditionalhere is the "else" of the unterminated conditional<\hLT|DLxpxpxxxxDx,,Dx,, x x xxxxhh\ 8 Td|./../bfd/libhppa.h \ wCan't open `%s' for writingCan't close `%s'ǰ,LX<Dlxǀǔ4<ǀh`h`hhhh4h4hhhhhhhXXLɜ(ɜɜɜɜ ɜɜɜɜɜɜɜɜɜɜɜɜɜɜɜɜɜɜɜȜȰɜɜDTɜɜɜl|ɜɜɜɜɜɜɜɜɜɔ.L0./../bfd/libhppa.hFile number less than oneFile number %ld already allocatedUnassigned file number %lddwarf2dbg.cUnassigned file number %uGNU AS %s.debug_line.debug_info.debug_abbrev.debug_aranges`(0D0ܴܴܴܴܴܴܴܴܴܬܬܬܬܤܤܬܬܬܬܬܤܤܬܬܬܬܬܬLLLLLݐݼLLLLLLLLLLLLLLLLLLLtL`LݬLLLL,LLLLLLLLLD./../bfd/libhppa.h0< (P\dx dLDLDLLLLLLLLLLLL<<0 (8P`x??./../bfd/libhppa.h.debug_frameeh.eh_frameehopt.c$DP4<dpx,4x`X`X````,`,```````PPD <Ldt88888888$8 8888888888888888888888888888888888888888888888888888888888888888888XXXXtXXXXXt   0`$4H\p?./../bfd/libhppa.hbignum invalid; zero assumedfloating point number invalid; zero assumedL0.bad floating-point constant: exponent overflow, probably assembling junkbad floating-point constant: unknown error code=%d.A bignum with underscores may not have more than 8 hex digits in any word.expr.cA bignum with underscores must have exactly 4 words.backw. ref to unknown label "%d:", 0 assumed.Character constant too largeexpr.c(operand): bad atof_generic return val %dMissing '%c' assumedUnary operator %c ignored because bad operand followsstartof.sizeof.syntax error in .startof. or .sizeof..startof.%s.sizeof.%sBad expressionmissing operand; zero assumedmissing right bracketoperation combines symbols in different segmentsleft operand is a bignum; integer 0 assumedleft operand is a float; integer 0 assumedright operand is a bignum; integer 0 assumedright operand is a float; integer 0 assumeddivision by zero  l   |      t |        D   D D D D t  \ \ D D D D t  \ \ < < < < 4 4  < < < < < 4 4  < < < < <        <  h      L                        <                  ./../bfd/libhppa.hIdB@uhcU4ph䢮{3'"I2%% dKE0)bkȑMLJ<^GЙV`TH[\xF t?x:#Kt'r"(\<a+Hˡ+qT40{&)tJSյ ݞ@beya;IZ.5{yKpLZY]Z$żi\#^FI6SIsŽ* pGI?[l Ԯb9I-C4]0%A2|}<8T͇nu`hٟJLz5^+RSAQ_ಐ䓫s*fw\I[isCFEHis 8c4F[u|}ީ-GWQމ=L" Ns M.?-3=!- PknpJՕqn&f6$Z. 8/#tڼ3&Nk'06Sq.h>YPV^r>2#njdn8ڧ?Ot{9SzS A[-mxg36 Ƽ`R;i.NeQG3o#VBmf)?`MMCuao "4W]K<_XZ]`SOOJp?sa*'6N;\C9J#{L/ %Fu)^˺Ǎd(\\((\\((\\((\\( \|ltdl44444dLL4444dLL,,,,$$,,,,,$$,,,,,|,X<,t./../bfd/libhppa.hCan't extend frag %d. charsfrags.cattempt to allocate data in absolute sectionattempt to allocate data in common section  t         |  !!!!!!!L!!!L!L!L!L!|!!d!d!L!L!L!L!|!!d!d!D!D!D!D!<!<!!D!D!D!D!D!<!<!!D!D!D!D!D!!!!!!!!D""p"""""("T"""""""""""""""""""" !!""D""""""""""""""""""./../bfd/libhppa.hexistshash.c**<*\*h*L*T*|****D*L*+x+p+x+p+x+x++x+x+++++D+x+,+,+++++D+x+,+,+ + + + +++x+ + + + + +++x+ + + + + +x+x+x+x+h+h+\+ ,,8,,,,+,,,,,,,,,,,,,,,,,,,,+++,, ,,T,d,,,,|,,,,,,,,,,,./../bfd/libhppa.hinput-file.cr{standard input}Can't open %s for reading.%sO_APP Can't read from %sCan't close %s3,22222222322233333333333333333333333333x3x3x3x3p3p33x3x3x3x3x3p3p33x3x3x3x3x33333333x5455554\455555555555555555554@44,54x544555445555555555./../bfd/libhppa.h {standard input}macros nested too deeplypartial line at end of file ignoredPartial line at end of file ignored>>p>>>>>>>>>x>>???????H???H?H?H?H?x??`?`?H?H?H?H?x??`?`?@?@?@?@?8?8??@?@?@?@?@?8?8??@?@?@?@?@????????@@@l@@@@@$@P@@@@@@@@@@@@@@@@@@@@??@@@@@@@@@@@@@@@@@@@@@./../bfd/libhppa.hWarning:Error:{standard input}r %s %s page %d %s %02X% 4d %s % 4d ???? % 4d %04x %c%c**** %s % 4d %08lx%%0%lulxlisting.cDEFINED SYMBOLS %20s:%-5d %s:%s %s %33s:%s %s NO DEFINED SYMBOLS UNDEFINED SYMBOLS NO UNDEFINED SYMBOLS %4u:%-13s **** %s defvalscllineendeflntypesizedimtagstabsstabnwcan't open list file: %serror closing list file: %sstrange paper height, set to no formNew line in title^^8^X^d^H^P^x^^^^@^H^_t_l_t_l_t_t__t_t_____@_t_(_(_____@_t_(_(_______t________t______t_t_t_t_d_d_X_``4````_````````````````````___````P``````x```````````./../bfd/libhppa.h% operator needs absolute expression%d$NARGNARGMACROENDMunexpected end of file in macro definitionmissing ) after formalsmissplaced )LOCALLL%04x-1confusion in formal parametersmacro formal argument does not existcan't mix positional and keyword argumentstoo many positional argumentsIRPCIRPENDRunexpected end of file in irp or irpcmissing model parameter\$,@,  HHHHHHHHHHHHHHHHHHHHHHHHpH\HHHHH(HHHHHHHHH@./../bfd/libhppa.h%s: Assembler messages: %s:%u: : %s Warning: Error: Fatal error: Internal error! Assertion failure in %s at %s line %d. Assertion failure at %s line %d. Please report this bug. Internal error, aborting at %s line %d in %s Internal error, aborting at %s line %d %ld%08lxmessages.c@$,,,,,p,,,,,,,,,,,,,,,,,,,T,@,,,,, ,,,,,,,,,$./../bfd/libhppa.hCan't open a bfd on stdout %s somFATAL: Can't create %sFATAL: Can't close %s ( |||||||||ttttlltttttllttttttX<(t L,L$LLLLLLLLLDL,$LLLL0LLLLLLLLLLL,L$LLLLLLLLLDL,$LLLL0|xxxxxxxxxx./../bfd/libhppa.habortalignasciiascizbalignbalignwbalignlbytecommcommoncommon.sdatadcdc.bdc.ddc.ldc.sdc.wdc.xdcbdcb.bdcb.ddcb.ldcb.sdcb.wdcb.xdsds.bds.dds.lds.pds.sds.wds.xdebugdoubleejectelseelsecelseifendendcendfuncendifequequiverrexitmexternappfileapplinefailfilefillfloatformatfuncglobalgloblhwordififcifdefifeqifeqsifgeifgtifleifltifncifndefifneifnesifnotdefincludeintirpirepirpcirepclcommlflagslinkoncelistllenlonglsymmacromexitmri.mrinamenoformatnolistnopageoctaoffsetorgp2alignp2alignwp2alignlpageplenprintpsizepurgemquadrepreptrvasbttlsetshortsinglespaceskipsleb128spcstabdstabnstabsstringstructtextthis_GCC_requires_the_GNU_assemblerthis_gcc_requires_the_gnu_assemblertitlettluleb128xcomxdefxrefxstabswordzeroexistserror constructing %s pseudo-op table: %smdobjstandardEQUSETMACROUnknown pseudo-op: `%s'%slabel "%d$" redefinedAPP #NO_APP .abort detected. Abandoning ship.Alignment not a power of 2Alignment too large: %u assumedexpected fill pattern missingread.cExpected comma after symbol-name: rest of line ignored..COMMon length (%ld.) <0! Ignored.Ignoring attempt to re-define symbol `%s'.Length of .comm "%s" is already %ld. Not changed to %ld.%s%sattempt to re-define symbol `%s'Line numbers must be positive; line number %d rejected.start address not supported.err encountered.fail %ld encountered.fill size clamped to %d.Size negative: .fill ignored.Repeat < 0, .fill ignoreddiscardone_onlysame_sizesame_contentsunrecognized .linkonce type `%s'.linkonce is not supported for this object file formatbfd_set_section_flags: %sMissing size expressionBSS length (%d.) <0! Ignored.Expected comma after sizeMissing alignmentAlignment too large: %d. assumed.Alignment negative. 0 assumed.Expected comma after name "%s"bad expressionSymbol %s already definedattempt to redefine pseudo-op `%s' ignoredinvalid segment "%s"; segment "%s" assumedignoring fill value in absolute sectiononly constant offsets supported in absolute sectionMRI style ORG pseudo-op not supportedMRI mode not supported for this target%s REPTENDR%s without %ssymbol `%s' already definedUnsupported variable size or fill value.space repeat count is zero, ignored.space repeat count is negative, ignoredspace allocation too complex in absolute sectionspace allocation too complex in common sectionmissing valueBad floating literal: %sRest of line ignored. First ignored character is `%c'.Rest of line ignored. First ignored character valued 0x%x.illegal expression; zero assumedmissing expression; zero assumedbignum invalid; zero assumedfloating point number invalid; zero assumedinvalid attempt to set value of section symbolrva without symbolattempt to store value in absolute sectionzero assumed for missing expressionregister value used as expressionValue 0x%lx truncated to 0x%lx.Bignum truncated to %d bytesUnknown floating type type '%c'Floating point constant too largeExpected Unterminated string: Newline inserted.expected address expression; zero assumedsymbol "%s" undefined; zero assumedsome symbol undefined; zero assumedbad or irreducible absolute expression; zero assumedThis string may not contain '\0'Missing string/rmissing .func.endfunc missing for previous .func%c%spseudo-op table,%dllllllllldddd\\ddddd\\ddddddHt,d./../bfd/libhppa.hstabs.c.stabs: Missing comma.stab%c: Missing commaL0comma missing in .xstabsstr%sF%d",%d,0,0,%s %sL%d%d,0,%d,%s-%s %d,0,%d,%s "%s:F1",%d,0,%d,%s%sendfunc%d"",%d,0,0,%s-%s                    t   t t t t     t t t t     l l l l d d  l l l l l d d  l l l l l        l       P |                    4    l                  ./../bfd/libhppa.hsubsegs.cfrag chains: %p %-10s %10d frags h$08L8              TTTTTTTTTTTTTTTTTTTTTTTT|ThTT TTT$4TTTTTTTTTL0 .../4/D/T/\/h/p/x////////0?? ? ILEEEEILFdF|FFILFFGG,GDG\ILGtGHdHGGGGHHH4HL./../bfd/libhppa.hsymbols.c%sbfd_make_empty_symbolSymbol %s already defined.Symbol "%s" is already defined as "%s"/%s%ld.Inserting "%s" into symbol table failed: %sSymbol definition loop encountered at %sCase value %ld unexpected at line %d of file "%s" undefined symbol %s in operationinvalid section for operationundefined symbol %s in operation setting %sinvalid section for operation setting %sdivision by zerodivision by zero when setting %scan't resolve value for symbol "%s""%d" (instance number %d of a %s label)Attempt to get value of unresolved symbol %sSection symbols are already global(unnamed)sym %lx %s frag %lx resolved local written resolving used-in-reloc used extern debug defined %s %lx %*s<constant %lx> %s %*s<> %*s<expr %lx illegalabsentsymbol %*s< %*s%lxregister #%dbiguminus -<bit_notmultiplydividemoduluslshiftrshiftbit_iorbit_xorbit_andeqneltlegegtlogical_andlogical_oradd %*s<subtract %*s<{unknown opcode %d}symbol tablemini local symbol table%lu mini local symbols created, %lu converted KK`KKKpKxKKKKKhKpKLLLLLLL8LLL8L8L8L8LhLLPLPL8L8L8L8LhLLPLPL0L0L0L0L(L(LL0L0L0L0L0L(L(LL0L0L0L0L0LLLLLLLL0MM\MMMMMM@MMMMMMMMMMMMMMMMMMMLLLMM0MMxMMMMMMMMMMMMMMMM./../bfd/libhppa.hfield fx_size too small to hold %dwrite.cregister value used as expressionattempt to .org/.space backwards? (%ld)Case value %ld unexpected at line %d of file "%s" internal error: fixup not contained within fragrelocation overflow%s:%u: bad return from bfd_install_relocationFATAL: Can't write %sCannot write to output file.%d error%s, %d warning%s, generating bad object file. %d error%s, %d warning%s, no object file generated. %s: global symbols not supported in common sectionslocal label %s is not definedcan't resolve value for symbol "%s"alignment padding (%lu bytes) not a multiple of %ldattempt to .org backwards ignored.space specifies non-absolute value.space or .fill with negative value, ignoredNegative of non-absolute symbol %sSubtraction of two symbols in different sections "%s" {%s section} - "%s" {%s section} at file address %s.%ldValue of %s too large for field of %d bytes at %sfixups: %d fix %lx %s:%d pcrel pcrel_adjust=%d im_disp tcbit done size=%d frag=%lx where=%ld offset=%lx addnumber=%lx %s (%d) +<> -< ss(sHsTs8s@shsts|ss0s8s|tdt\tdt\tdtdttdtdttttt0tdttttttt0tdttsssssstdssssssstdssssstdtdtdtdtTtTtHsuu$uuuutuuuuuuuuuuuuuuuuuuuutttutuu@uPuuuuhuxuuuuuuuuuurRsSfFdDxXpPeEǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬTtǬ(0X<ǬTTxTǬ8Ǭ `$ǬǬǬǬǬǬǬǬ@ĀL`xǬǬ 8$X hǬll l(04ǬǬǬǬ\`ǬpǬtXPp@0ttǬ4 44444444444444444444444px44444444444|H44D4444444D4,44|4Tl4d8@|@@@@@@@@@<@@@ @p@p@@@@@@@@@@@@@@@@<@@@@@pp@@ǔp(tǔǔǔǔǔǔǔǔǔǔǔǔǔǔǔǔǔǔpǔǔǔǔǔǔǔǔǔǔǔǔǔ`|ǔǔǔǔǔǔ|ǔǔǔ,?UUUUU\|||||||||||t||||| |||||||||||||||||||||t||||| L88LL͈͈X͈XXXXXXXXXhXX?֘\֘֘֘֘Ҙ<֘֘֘֘֘֘֘֘֘֘֘֘֘֘֘֘֘֘֘(X֘֘|Դ֘֘֘Ӭx֘֘֘֘֘֘֘֘֘֐./../bfd/libhppa.h,CcY<>?!@+&U~FfGHINnOoZMadu|/=0123%e$m}ldicallretcmpibcomibcmpbcombaddbaddibnopcopymtsarlddldwldhldbstdstwsthstbldwmstwmldwxldhxldbxldwaldcwstwastbylddaldcdstdaldwaxldcwxldwsldhsldbsldwasldcwsstwssthsstbsstwasstdbystbysldoldiladdilbblgateblrbvbvebeblemovbmovibcombtcombfcomibtcomibfaddbtaddbfaddibtaddibfbbbvbclrbtspopbtspushnompushbtscmpclrcomclrorxorandandcmuxoruaddcmuaddcmtdcoridcoraddiaddioadditadditoaddaddladdoaddcaddcosubsubosubbsubbosubtsubtodssubisubiocmpiclrcomiclrshladdsh1addsh1addlsh1addosh2addsh2addlsh2addosh3addsh3addlsh3addohaddhavghshlhshladdhshrhshraddhsubmixhmixwpermhshrpdshrpwvshdshdextrdextrwvextruvextrsextruextrsdepddepdidepwdepwizvdepvdepzdepdepzvdepivdepizdepidepibreakrfirfirssmrsmmtsmldsidmtspmtctlmtsarcmmfiamfspmfctlsyncsyncdmaprobeprobeiproberproberiprobewprobewilpalhalcipdtlbpitlbpdtlbepitlbeidtlbaiitlbaidtlbpiitlbppdcfdcficfdceficediagidtlbtiitlbtmtcpumfcputocentocdisshdwgrgrshdwgfwgfrfldwflddfstwfstdfldwxflddxfstwxfstdxfstqxfldwsflddsfstwsfstdsfstqsfaddfsubfmpyfdivfsqrtfabsfremfrndfcpyfcnvfffcnvxffcnvfxfcnvfxtfmpyfaddfmpynfaddfnegfnegabsfcnvfcmpxmpyufmpyaddfmpysubftestfidpmdispmenbspop0spop1spop2spop3coprcldwxclddxcstwxcstdxcldwsclddscstwscstdscldwclddcstwcstdalignbegin_brtabbegin_tryblockblockzbytecallinfocodecommcompilercopyrightdatadoubledwordendend_brtabend_tryenterentryequexitexportfillfloathalfimportintlabellcommleavelevellonglsymnsubspaoctaorgoriginparamprocprocendquadregshortsinglespacespnumstringstringzsubspatextversionwordMissing .exit Missing .procend $global$$PIC_pcrel$0Invalid field selector. Assuming F%%.could not set architecture and machine-R option not supported on this target.Internal error: can't hash `%s': %s internal error: losing opcode: `%s' "%s" Broken assembler. No assembly attempted.L$dummy./config/tc-hppa.cMissing function name for .PROC (corrupted label chain)Missing function name for .PROCUnknown opcode: `%s'could not update architecture and machineField out of range [%d..%d] (%d).%sar%cr11smms s,Invalid Indexed Load Completer.Invalid Indexed Load Completer Syntax.mambInvalid Short Load/Store Completer.b b,eInvalid Store Bytes Short Completer,sl,bc,co,o,gate,l,push,l,pop,w,r,i,z,tsv,dc,tsv,tsv,dc,dc,c,tsv,tsv,c,c,tc,tsv,tsv,tc,tc,db,tsv,tsv,db,db,b,tsv,tsv,b,b,s,uInvalid left/right combination completer,ss,usInvalid permutation completer=<<=nuvznvsvodtr<>>=>uvvnznsvevInvalid Add Condition: %sInvalid Add and Branch Condition: %cInvalid Compare/Subtract ConditionInvalid Bit Branch Condition: %c<<<<=>>=>>Invalid Compare/Subtract Condition: %sInvalid Compare/Subtract Condition: %cInvalid Compare and Branch Condition.Invalid Logical Instruction Condition.nInvalid Shift/Extract/Deposit Condition.sbzshzsdcsbcshcnbznhzndcnbcnhcswzswcnwznwcInvalid Unit Instruction Condition.%r2%rpField not properly aligned [%d] (%d).L$0Branch to unaligned address%sr0,%r31Invalid SFU identifierInvalid COPR identifierInvalid Floating Point Operand Format.Invalid register for single precision fmpyadd or fmpysubInvalid operands %sBad call to MD_ATOF()Cannot handle fixup at %s:%dno hppa_fixup entry for fixup type 0x%x at %s:%dUnknown relocation encountered in md_apply_fix.Undefined register: '%s'.Non-absolute symbol: '%s'.Undefined absolute constant: '%s'.Invalid FP Compare Condition: %sacc8acc6acc4acc2accrej8rejInvalid FTEST completer: %ssgldblwuwdwudwqwuqwInvalid FP Operand Format: %3sBad segment in expression.Bad segment (should be absolute).nogrfrfuInvalid argument location: %s Invalid argument description: %dInvalid Nullification: (%c)**=*<*<=*<<*<<=*sv*od*tr*<>*>=*>*>>=*>>*nsv*evargwrtnvalInvalid .CALL argument: %s.callinfo is not within a procedure definitionframeFRAME parameter must be a multiple of 8: %d entry_grValue for ENTRY_GR must be in the range 3..18 entry_frValue for ENTRY_FR must be in the range 12..21 entry_srValue for ENTRY_SR must be 3 callscallerno_callssave_rpsave_spno_unwindhpux_intmillicodeInvalid .CALLINFO argument: %sThe .ENTER pseudo-op is not supportedMisplaced .entry. Ignored.Missing .callinfo..REG expression must be a registerbad or irreducible absolute expression; zero assumed.REG must use a label.EQU must use a label.EXIT must appear within a procedureMissing .callinfoNo .ENTRY for this .EXITCannot define export symbol: %s absoluteUsing ENTRY rather than CODE in export directive for %splabelpri_progsec_progpriv_levUndefined .EXPORT/.IMPORT argument (ignored): %sMissing label name on .LABELextra .LABEL arguments ignored.The .LEAVE pseudo-op is not supported1.01.12.0w2.0Unrecognized .LEVEL argument Cannot define static symbol: %s Nested proceduresCannot allocate unwind descriptor misplaced .procendMissing .callinfo for this procedureMissing .EXIT for a .ENTRYNot in a space. Not in a subspace. $TEXT$$PRIVATE$sortunloadablenotdefinedprivateInvalid .SPACE argumentCan't change spaces within a procedure definition. Ignored$GDB_DEBUG$$GDB_DEBUG$Undefined space: '%s' Assuming space number = 0.Must be in a space before changing or declaring subspaces. Can't change subspaces within a procedure definition. IgnoredParameters of an existing subspace can't be modifiedAlignment must be a power of 2accesscode_onlycommondup_commzerofirstFIRST not supported as a .SUBSPACE argumentInvalid .SUBSPACE argument$CODE$$DATA$$BSS$$LIT$$MILLICODE$$UNWIND$Internal error: Unable to find containing space for %s.Out of memory: could not allocate new space chain entry: %s Out of memory: could not allocate new subspace chain entry: %s %02o%03o33L3l3x3\3d33333T3\34444444$444$4$4$4$4T44<4<4$4$4$4$4T44<4<4444444444444444444444444x4x4l455H555555,55555555555555555554445555d5t555555555555555?UUUUU\./../bfd/libhppa.hweakOnly one .compiler pseudo-op per file!Expected quoted string.compiler directive missing language and version.compiler directive missing versionGNU ToolsFATAL: Attaching compiler header %sOnly one .version pseudo-op per file!FATAL: Attaching version header %sOnly one .copyright pseudo-op per file!FATAL: Attaching copyright header %s$GDB_DEBUG$$GDB_STRINGS$$GDB_SYMBOLS$./config/obj-som.c@@@@`@l@P@X@@@@@H@P@A|AtA|AtA|A|AA|A|AAAAAHA|A0A0AAAAAHA|A0A0AAAAAAA|AAAAAAAA|AAAAAA|A|A|A|AlAlA`ABB<BBBBAB BBBBBBBBBBBBBBBBBBBAAABBBBXBhBBBBBBBBBBBBBBB????E,DDDE,E,E,E,E,E,E,E,E,DE,DDE,E,E,E,DE,E,E,E,E,E,E,E,E,E,E,DDDE,E,E,E,E,E,E,E,E,DE,DDE,E,E,E,D./../bfd/libhppa.hcannot create floating-point number.NaNs are not supported by this target ./config/atof-ieee.cInfinities are not supported by this target --%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument PWD.memory exhausted %s%sCannot allocate %lu bytes after allocating %lu bytes undocumented error #%dlmHlmHllllllllllllllllm4llllllllllm4m4mHmHmHlm4llllkm4kllm`lm4llm4-+ #0hlL/opt/binutils/share/localemessages/.moCPOSIXLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_ALLLC_XXXLANGUAGELANG/locale.alias/opt/binutils/share/locale:.risoKMXMN@NNPNNXNNNNOO ORXRTXT\T\T`T`TdTdThThTlTTTTTTU\U`UlUpUUWW[8[\<\@\D\H\d\h\\\\\\\\]]]$](]D]H]d]h]]]]^t^x^^^^``a$a(aaaaaabbbb b@bDbxb|bbcc cccddddd d4d8dLdPdXd\d`dddhdldpdteeffgggghhhhhhhhhhhhhhiiL~,~0~D~H~x~|~~~~~~\`pt \x X\#<X @Dhl$(lp8<`dhl$X008<`dx| dh04X\`dx| 48hlLP`dLhd<@ <p,0`|lp08Ttx<@(,LP (,@DX\dhlptx|@\8 <TĈŌŐŤŨ<@txƼ04HLTX\`dhlpɼ LPTXptʌʐʼ$(HL˄ˈ $8<̠̤8<pt LP$(DHдиhlLPԤ֐ ֔,0 <@TXڈڌڰڴ$(lp۴۸܀܄ܨܬܴܰ  lpptވތ޼ $X\ߠߤ,08<@DHLPT@D LP4C8LCPptE48lp(,@DLPTX\`dh $   HL(,DH8<HLlp 0          @ D X \ |      D H   8 < @ D X \ p t           X\  04HLlp48(,04HL`dx|PTx|pthl ,0dh ,0HL $HL`d   L P!!!@!D!H!L!`!d!x!|!!!!!!!!!!####$$ $X$\$h$l%P%T%%&x&|&&'|''''''((( (((((((()))(),)L)P))))****++ +++(+,+@+D+X+\+d+h+l+p+t+x+|+,,,,,,,,-<-@--//////04080011 1 1$1T1X1|1111111282<223L3P3t3x3|333333333333333585<6P6T77 7777888 8$8L8P9990949L9P;;;;<<>>H>L???<?@?D?H?\?`?t?x??????????AA4AAAABBBBBBE`EFFFFH HJ JK KM MQ0 Q4QQSSU UW$ W(WWXdXhXlXXXYY$YlYpYYZTZXZdZZZ[\\(\,\d\h\\\\\\] ]]$](]H]L]]]]^^^^___ __$_(_<_@_T_X_`_d_h_l_p_t_x_|``a(a,a0aLd,d0dpdeff(f,h$ h(h hl lnnplppppqqqqrr y y  8<PT $hl| hl8pthlx48TXPTdh<@ 48hlLP`dL h PTx|48|HLptx|48P4(8tx$@XtLPD`$(Hd4Pdh ,P (D,H48 (|ƀǤ(DtȐXtɠɤ hʄ̰̔ @\҈Ҥ0`dӼ $ ,H`|ٔ٘@Dߔ߰  <@ptdh,0@\  PTtx0 $,HXtt$@ HL8<@D\` @Dhl$(lp8<`dhl$( DH4 8 4DHpt  , 0PT    H L p t       , 0 t x @ D h l p t               , 0  DH(\lpTXlpDH\`,0tx  $(tx04LP|""""## ##$t$x$$$$%%%&&&'(',''''(\(x)  )1  111224X4\50545D5H5p5t556@6D6H6L66666674787t7x77778809999:: :::D:H:T:X::::;X;\;;;;;; >$>,>0>T>X>h>l>>>>>>>??4?8?l?p????????@@ @,@0@h@l@@@@@@AhADDE\E`ItIxIIIIJ JJ4J8JLJPJpJtJJJJK8K<LLL,L0L4L8LLLPLdLhL|LLLLLLLLLMMOOP(P,P\P`QQ QQQQQQRRR RS  S<S|SSSTUUUVVWXWtZ ZX] ]D^t+8^x_+8_`p`a|aaabdbd` ddg gggj jl l l0lp0pqLqPqpqtqqqqqqqrrrr8r<rprtrrssssssstttt,t0tDtHtPtTtXt\t`tdthtluuuuv,v0v`vdvvvvw w$xxyyzz| | |@ |D~~0000ptȘȜȴ4 8͸ ͼ ,0Ӑ Ӕָ ּ   X\hlݠݤ $LPߤߨhlDH  PT(,04@D,0x| Tp8`d$@$@Xt04\`t8T$@0 ( D   < X P l   , 0 l 048T |! !$t $x% %&'''''(,(0(t(x(()))D)H)l)p)))))),,,--$-@-`-|----..8.`.|..////111111112 2$282<2\2`22223$3(33444 4$484<4P4T4h4l4t4x4|444445555686<888`8d9999;;$>>>>>???,?0?P?T????@@@@A AAAA,A0ADAHA\A`AhAlApAtAxA|AABBCDCHCpCtCCCCCCD$D(EPETEEG GJ K KKLLNpNtPPP0P4RR4RR[[\x\|\\](^^|^____``8``aa0alabbccffffffg g$ggggh h<hlhphhii8ixi|iijjHjjjjlh llm mmmmmn nn(n,ptpxppppt tt tvvw|wwwwwwwwwwwwwwwwwxtxxxxyPyT{8{<{{{|4} }~L ~h<@`| 4PT \`  TXd R R f g i `   $  ` x  @ ( P h @ X d  <  D X Ԩ   - / / A B Ed Q Xp X Y Y Zh Z a4 dt <   | P l  T  ( \    H  L  8     8  ,  0   Ǩ , x \ l ̘ D Ҍ   0 d ߘ  D   0 \ x (   ,  (` 1 8 Al Q S$ U U U W\ Z Z( ] ], `t bh ~ ȸ    X    (  ( \   x < (   ,   @  T   p  <    & ) , , -( -d - - . .d 5 8 ; (b),xceK(s,b),xceK(b),xl(b),xj(s,b),xj(b),xcxccx(s,b),tcxccx(b),tcocc@(s,b),tcocc@(b),tcmcc5(s,b),tcmcc5(b),tl(b),xj(s,b),xj(b),xcxccx(s,b),tcxccx(b),tcocc@(s,b),tcocc@(b),tcmcc5(s,b),tcmcc5(b),tl(b),xj(s,b),xj(b),xcocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)cqx,&(b)cqx,#(b)cocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)cex,<(b)cex,J(s,b)cex,J(b)cex,>(b)cex,K(s,b)cex,K(b)x,l(b)x,j(s,b)x,j(b)cocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)x,l(b)x,j(s,b)x,j(b)cocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)x,l(b)x,j(s,b)x,j(b)j(s,b),xj(b),xx,j(s,b)x,j(b)cxx(s,b),tcxx(b),tcxx(s,b),tcxx(b),tcxx(s,b),tcxx(b),tcxccx(b),tcmcc5(b),tcxcdx(s,b),tcxcdx(b),tcmcd5(s,b),tcmcd5(b),tcocCx,@(b)cmcCx,V(b)cscCx,V(s,b)cscCx,V(b)cxccx(b),tcmcc5(b),tcxcdx(s,b),tcxcdx(b),tcmcd5(s,b),tcmcd5(b),tcocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)cxx(b),tcxx(s,b),tcxx(b),tcm5(s,b),tcm5(b),tcm5(s,b),tcm5(b),tcm5(s,b),tcm5(b),tcm5(b),tcm5(s,b),tcm5(b),tcmx,V(s,b)cmx,V(b)cmx,V(s,b)cmx,V(b)cmx,V(s,b)cmx,V(b)cmx,V(b)cscCx,V(s,b)cscCx,V(b)csx,V(s,b)csx,V(b)l(b),xj(b),xk,bk,b,Zk,bcpnXLclnXLclnW,bcgnW,bnWnW,bnW,bnx,bnx(b)n(b)cpn(b)Lcln(b)LcPn(b)n(b)clnz(S,b),Yclnz(b),Ynz(S,b)nz(b)nz(S,b)?ynx,b,w?yn5,b,w?tnx,b,w?tnx,b,w?tn5,b,w?tn5,b,w?dnx,b,w?dnx,b,w?dn5,b,w?dn5,b,w?Bnx,!,w?Bnx,B,w?bnx,!,w?bnx,Q,w?bnx,w$x?Sx,b,t?sx,b,t?sx,b,t?Lx,b,t?lx,b,t?Lx,b,t?lx,b,t?Lx,b,t?lx,b,t?Lx,b,t?lx,b,t?Ux,b,t?ux,b,tcT?Ux,b,tcT?ux,b,t?ux,b,t?ux,b,tci?Ub,tci?ub,t?ub,t?ub,tct?ai,b,xcv?ai,b,x?ai,b,x?ai,b,x?ai,b,x?ai,b,xcY?Ax,b,tcy?ax,b,tca?Ax,b,tca?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,tct?Sx,b,tct?sx,b,tcB?Sx,b,tcb?sx,b,tcv?Sx,b,tcv?sx,b,t?sx,b,t?sx,b,t?sx,b,t?sx,b,t?sx,b,t?sx,b,t?sx,b,tcv?si,b,x?si,b,x?si,b,x?Si,b,x?si,b,x?si,b,xca?Ax,.,b,tca?ax,.,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,tcHx,b,tx,b,tx,*,tx,.,b,tcSb,*,tx,.,b,tcHx,b,tchx,b,tchx,b,tc*a,t?Xx,b,!,t?Xx,b,~,t?xx,b,!,t?xx,b,p,t?xx,b,t?xx,b,p,tcS?Xb,!,%,xcS?Xb,q,|,xcS?xb,!,T,xcS?xb,P,T,x?xb,T,x?xb,T,x?xb,P,T,x?xb,P,T,xcz?Xx,!,%,bcz?Xx,~,|,bcz?X5,!,%,bcz?X5,~,|,bcz?xx,!,T,bcz?xx,p,T,bcz?x5,!,T,bcz?x5,p,T,b?xx,T,b?xx,T,b?xx,p,T,b?xx,p,T,b?x5,T,b?x5,T,b?x5,p,T,b?x5,p,T,br,AcrU,tR,tU,tR,tx(s,b),t(b),tx,Sx,^xtS,tcW!,t^,tcw(s,b),x,tcw(b),x,tcw(s,b),R,tcw(b),R,t(s,b),x,t(b),x,t(s,b),R,t(b),R,t(s,b),x,t(b),x,t(s,b),R,t(b),R,tcZx(s,b),tcZx(b),tcZx(s,b),tcZx(b),tx(s,b),tx(b),tcLcZx(s,b)cLcZx(b)cZx(s,b)cZx(b)cLcZx(S,b)cLcZx(b)cZx(S,b)cZx(b)cZx(s,b)cZx(b)cZx(S,b)cZx(b)x,(s,b)x,(b)x,(S,b)x,(b)x,(s,b)x,(b)x,(S,b)x,(b)cZx(s,b)cZx(b)cZx(s,b)cZx(b)cZx(S,b)cZx(b)cZx(s,b)cZx(b)cZx(S,b)cZx(b)Dx,bx,bx,^^,xcZx(s,b)cZx(b)cZx(s,b)cZx(b)cocc@(s,b),fTcocc@(b),fTcxccx(s,b),fTcxccx(b),fTcmcc5(s,b),fTcmcc5(b),fTy(b),fecJy(b),fed(b),fecJd(b),fecocc@(s,b),ftcocc@(b),ftcxccx(s,b),ftcxccx(b),ftcmcc5(s,b),ftcmcc5(b),ftcq&(b),fxcq#(b),fxcocCfT,@(s,b)cocCfT,@(b)cxcCfT,x(s,b)cxcCfT,x(b)cmcCfT,5(s,b)cmcCfT,5(b)fE,y(b)cJfe,y(b)fe,d(b)cJfe,d(b)cocCft,@(s,b)cocCft,@(b)cxcCft,x(s,b)cxcCft,x(b)cmcCft,5(s,b)cmcCft,5(b)cqfx,&(b)cqfx,#(b)cxx(s,b),fTcxx(b),fTcxx(s,b),ftcxx(b),ftcxfT,x(s,b)cxfT,x(b)cxft,x(s,b)cxft,x(b)cxft,x(s,b)cxft,x(b)cm5(s,b),fTcm5(b),fTcm5(s,b),ftcm5(b),ftcmfT,5(s,b)cmfT,5(b)cmft,5(s,b)cmft,5(b)cmft,5(s,b)cmft,5(b)Ffa,fb,fTIfA,fB,fTFfa,fb,fTIfA,fB,fTFfa,fb,fTIfA,fB,fTFfa,fb,fTIfA,fB,fTFfa,fTFfA,fTFfa,fTFfA,fTFfa,fb,fTFfA,fB,fTFfa,fTFfA,fTFfa,fTFfA,fTFGfa,fTFGfA,fTFGfa,fTFGfA,fTFGfa,fTFGfA,fTFGfa,fTFGfA,fTIfA,fB,fC,fTIfA,fB,fC,fTFfa,fTIfA,fTFfa,fTIfA,fT{_fa,fTFGfA,fTF?ffa,fb,hI?ffA,fB,hF?ffa,fbI?ffA,fBfX,fB,fTHfi,fj,fk,fl,fmHfi,fj,fk,fl,fm,=mNv,ONv,oNtv,1Nbv,0Nx,bu,2Nucxx(s,b),tucxx(b),tucxx(s,b),tucxx(b),tucxt,x(s,b)ucxt,x(b)ucxt,x(s,b)ucxt,x(b)ucm5(s,b),tucm5(b),tucm5(s,b),tucm5(b),tucmt,5(s,b)ucmt,5(b)ucmt,5(s,b)ucmt,5(b)ucxx(s,b),tucxx(b),tucm5(s,b),tucm5(b),tucxx(s,b),tucxx(b),tucm5(s,b),tucm5(b),tucxt,x(s,b)ucxt,x(b)ucmt,5(s,b)ucmt,5(b)ucxt,x(s,b)ucxt,x(b)ucmt,5(s,b)ucmt,5(b)%arg0%arg1%arg2%arg3%cr0%cr10%cr11%cr12%cr13%cr14%cr15%cr16%cr17%cr18%cr19%cr20%cr21%cr22%cr23%cr24%cr25%cr26%cr27%cr28%cr29%cr30%cr31%cr8%cr9%dp%eiem%eirr%fr0%fr0l%fr0r%fr1%fr10%fr10l%fr10r%fr11%fr11l%fr11r%fr12%fr12l%fr12r%fr13%fr13l%fr13r%fr14%fr14l%fr14r%fr15%fr15l%fr15r%fr16%fr16l%fr16r%fr17%fr17l%fr17r%fr18%fr18l%fr18r%fr19%fr19l%fr19r%fr1l%fr1r%fr2%fr20%fr20l%fr20r%fr21%fr21l%fr21r%fr22%fr22l%fr22r%fr23%fr23l%fr23r%fr24%fr24l%fr24r%fr25%fr25l%fr25r%fr26%fr26l%fr26r%fr27%fr27l%fr27r%fr28%fr28l%fr28r%fr29%fr29l%fr29r%fr2l%fr2r%fr3%fr30%fr30l%fr30r%fr31%fr31l%fr31r%fr3l%fr3r%fr4%fr4l%fr4r%fr5%fr5l%fr5r%fr6%fr6l%fr6r%fr7%fr7l%fr7r%fr8%fr8l%fr8r%fr9%fr9l%fr9r%hta%iir%ior%ipsw%isr%itmr%iva%pcoq%pcsq%pidr1%pidr2%pidr3%pidr4%ppda%r0%r1%r10%r11%r12%r13%r14%r15%r16%r17%r18%r19%r2%r20%r21%r22%r23%r24%r25%r26%r27%r28%r29%r3%r30%r31%r4%r5%r6%r7%r8%r9%rctr%ret0%ret1%rp%sar%sp%sr0%sr1%sr2%sr3%sr4%sr5%sr6%sr7%tr0%tr1%tr2%tr3%tr4%tr5%tr6%tr7false?falsetrue?true!<=>!?>=!?<=!<>!>=!?>?<=!<=!?<?>=!?=!=t<=>=t?=?<<=!>?>>=!<<>!=!??=<>flldlplrlsltltpnnlnlrprrdrprrrsrtrtpt$CODE$$DATA$$LIT$$MILLICODE$$BSS$$TEXT$$PRIVATE$$TEXT$$PRIVATE$$TEXT$$TEXT$$TEXT$$PRIVATE$$PRIVATE$$PRIVATE$$GDB_DEBUG$$GDB_DEBUG$$GDB_DEBUG$@E@E@D,@D@D,@D,@EP@D@@DH@DP@DX @D`@Dh@Dp@Dx@D @D @D @D @D@D@D@D@D@D@D@D@C@@CH@CP@CX@C`@Ch@Cp@Cx@C @C @C@C@C@C@C@C@C@C@C@C @C @C@C@C@D@D@D@D@D @D(@D0 @D8@= @=(@=0@=8@=@@=H @=P @=X @=` @=h@=p@=x@=@=@=@=@=@=@=@=@=@=@=@=@=@=@=@=@> @>@>@>@> @@>(@@>0@>8A@>@J@>HJ@>P@>XK@>`K@>h@>pL@>xL@>@>M@>M@>@>N@>N@>@>O@>O@>@>P@>P@>@>Q@>Q@>@?R@?R@?@?S@? S@?(@?0A@?8@?@B@?HT@?PT@?X@?`U@?hU@?p@?xV@?V@?@?W@?W@?@?X@?X@?@?Y@?Y@?@?Z@?Z@?@?[@?[@@@@\@@\@@@@ ]@@(]@@0@@8B@@@@@HC@@P^@@X^@@`@@h_@@p_@@x@@C@@@@D@@D@@@@E@@E@@@@F@@F@@@@G@@G@@@@H@@H@A@AI@AI@A@A @A(@A0@A8@A@@AH@AP@AX@A`@Ah@Ap @Ax @A @A@A@A@A @A @A @A @A@A@A@A@A@A@A@A@B@B@B@B@B @B(@B0@B8@B@@BH@BP@BX@B`@Bh@Bp@Bx@B@B @B@B@B@B@B @B@B@B@B@B@B@B@B@B@C@C@C@C@C @C(@C0@C84@#4@# @#(@#0 @@#8@#@@#P Ȅ@#` Ȍ@#p М@#Ѐ@# ؀@# ؈@# @#@# @# @#@$ @$ @@$ @@$( `@@$0  3@$8 3@$H @$X @$h @$x @$P@$P@$ @$  @$  3@$ 3@$ @$  @% L@%L@%( L@%8 \@%H\@%X\@%hH@%xH@% H@%  @@%  @@%  `3@% `3@% @@%  @@% D@%D@& D@&  @&  @&(   3@&8  3@&H @&X  @&h  @@&x @@&  @@& ( 3@&( 3@&( @&( @&(p@&(p@&0 @&0 @'0 @' 0 @'( 0l@'80l@'H 0l@'X 0|@'h0|@'x0|@'0h@'0h@' 0h@' 8 `3@'8 `3@'8 @@' 8 @@' 8d@'8d@( 8d@( @  3@(@  3@((@ @(8 @ @(H @`@(X@`@(` @`@(p HL@(x HL@( Pl@( Pl@( X @( X @( ` @@( ` @@( h @( h @( p @) p @) x @)( x @)8 x @)H x @)X  @)h @)x  @)  @)  @) @) @@) @@) @@) @@) 3@* 3@* @*( @*8 @*H  @*X  @*h  @*x  @*  @@*  @@*  @*  @*  @*  @*  @*  @+  @+  @@+(  @@+8  @+H  @+X  @+h  @@+x @@+ @+  @+ 4@+4@+  @+  (@+  (@+ (@+(@+(@+ ( @+ (@, 0@, 8 @, @@@, H@, H@,( P@,0P@,8P@,@P@,HX@,P X@,` X@,p X@,x `@, h@, p@, x@, @, @, @, @, @, @- @- ``@-(@@@-8@`@-H @@@-X @@@-h @@-p@@-x@@-@@-@-@- @- `@-@@- @-@-  @-@-  @-@- @-@-   @-  @.   @. ( @. 0 @.(0 @.0 0 @.8 8 @.@ @@.H @@.X @@.h H@.p P@.x X@. ` @.`@. ` @.`@. `@. h @. p@. x@. @. @.@/  @/@/  @/0@/@ @/P  @/X @/`  @/h @/p  @/x @@/ @/ @/ Ȕ@/ А@/А@/ ؐ@/   @/ @/ @@/  @@/ @@/  @/   @0  @0  @0   @0  (@0  0 @0( 8@00 @ @08 H @0@ P @0H X @0P ` @0X h@0` p@0h x @0p @0x @0 @0  @0  @0  @0  @0 @0 @0  @1  @1  @1  @1  @10  @1@ @1P @1` @1p @1  @1  @1  @1  @1  @1 !@1 ! @1 !@1 !@1 ! @2 !(@2 !0@2 !8 @2( !8 @20 !@ @28 !H `@2@!H `@2H !P`@2P!P`@2X !X`@2` !`?@2h !`?@2p !h @2x !p@@2 !x`@2!@2!@2 !`H@2!@2 !@2 !@2 !?@2 !?@2 !1?@2 !1?@2 !?@3 !?@3 !1?@3 !1?@3( !?@30 !?@3@ !1?@3H !1?@3X !@?@3` !@?@3p !?@3 !?@3 !?@3 !?@3 !?@3!?@3!?@3 !?@3 !@3!@4!@4 !@4 "@?@4( "@?@48 "@@4@ "@@4P "@?@4X "@?@4` "@@4h "@@4p " ?@4x " ?@4 "(@4 "(@4 "0?@4 "0?@4 "8?@4 "8?@4 "@@4 "@@4 "H?@4 "H?@4 "P@4 "P@5 "X@5 "`@5"h@5 "p@5( "x@50 "@6@58 "@ @5@ "@&@5H "@ @5P "?@5X "?@5h "?@5p "?@5 "$ 3@5"$ 3@5"$@5 "$@5 "$@5 "$@5 "\@5"X@5"\@6"X@6", 3@6", 3@6(",@68 ",@6H ",@6X ",@6h "P@6x"P@6"$ 3@6 "$ 3@6 "$@6 "$@6 "$@6 "$@6 "|@6"x@7"|@7"x@7", 3@7( ", 3@78 ",@7H ",@7X ",@7h ",@7x "p@7"p@7"$@7 "$@7 ",@7 ",@7 "$@7 "$@7 ",@8 ",@8 "<@8( "<@88 "$@8H "$@8X #,@8h #,@8x #$@8 #$@8 #,@8 #,@8 #<@8 #<@8 # 0@8 # 8 @8 #(0&@9 #(8& @9 #00F@9( #08F @98 #80f@9H #88f @9X #@0@9h #@8 @9p #H0`@9x #H8` @9 #P0@9 #P8 @9 #X0@9 #X8 @9 #`0@@9 #`8@ @9 #h0@9 #h8 @9 #p0@9 #p8 @9 #x0@9 #x8 @9 #0@9 #8 @: # @:# @:#0@:(#8 @:0#0@:8#8 @:@#0 @:H#8 @:P#0@:X#8 @:h#0@:x #8 @: #8G @: #@: #ؘ@: #0$ @:#0 @:#0$ @: #0@: #0@:#0@:$@: $@; $@; $@; $ 0@; $($@; $($@;0 $0,@;@ $0,@;P $8$@;` $8$@;p $@,@; $@,@; $H$@; $H$@; $P,@; $P,@; $X$@; $X$@; $`,@< $`,@< $h$@< $h$@<0 $h$@<@ $h$@?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000@"@"d2.11.2 d<.P!;#.?@*@D@EFh/B_XiA-XԨ|i4RE|@(p-~P`E{]@|0dtBATdX8\-EdRj{QAliDp@jgl\|x(fj0(<8UP],Z@,(`(~`<(Z(&; h5`tT8ȸllDbhR`@i /0̘hP@<xL\D(ߘDXpd\lH8X Y Y,0ZhҌǨ,x\dZ1QS$UUW\Z]X-d ,-((-(\x<- ,.   @.d T  p),=(@`>(@<>( @P>( P@ Ph>(XD@XDt>(&@ >('@>((@>(P@$@>(R@@@ Y  ? @>@ $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$y0'H/0 "4p(O4hů;A8v˚v)g''6!xy!x!xry 4g6mTL'!xT/}!x݌/!x )k W!x/P )'6Y//]! !x/Bj 4gy!xng@ ƿ˚v8vhů;An bY;tltD8rP.Y;2Y;Y;'#/`744445 bנZRke"qke"y (4Ц @Ц D(43 H? 0(ਃ 43 ` 7+4>7D7%7744z#'74444@H@7D7%7#)@7444Kx"7D7%77Kv 24u74444#0-P7@@@@ 7K?@ @@@@k?7k?#Gk? 7Y0k?4@4 @@K?K?7@4K? *@K? K? 7@@4K? rKa?H:@7?!#7@4@4@x7?!7?!7@4#'79P4@4Ka?@ xH:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 860.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?ok)4`@44` G>- ""46_4K>9K>Qki *K>y4ߟ444K>IKa_k? k?54@844? 7 G4Y`7z#_4h4k?4K>a5k?4@44?"H74@4Kk>7t"Qk>Kk>v k>Ks"qk>7g"ak>y 4 c?K?7}"yk>Ka?43k? Ka?44k?֠ k?Ka?45k?7vk?1+4<P! k?!k?)#7`4_47=)"64_4 G=-"6@7z#_4+"g6yP7z#_U4 '49`7z#_%4 k?)Kk?9k?A k?Ik?Q@k?QKqK>Akf k?q( k?4? 0k?(0k?47k?+dk>  k>45Pk?y7>7>444? 7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4!4! <4?@@k?7k?#Gk? 7Yk?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?!#74_-4@x7?!7?!7_4#'794_4Ka?_H:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 86p0.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?7Kv+ H4?P4447-7K?Y@7?K?Yk?4?k?474_4$4?7 k|_M@eK?Y#77z$Q_U4-K?YKu>Ks> k?Ku=Ks= k?Ku>aKs>i k?k?ok?7#k?_=7:k?@w_EK? X7K?4_E4y 2@_4?744K?YK?@O?7KYC779 WǷ@44?@7?Ƿ#7.& U KYC87?'00N9F8G'I  J79YC3 X6?Ǹ_M w @7? ]ǽ2KA4<\C XǸ_@4?@7?k?oK_4C7Cx x7 b@Y7v9 _ǿ@_4zHC4] 2ϟ@K?Y4``J4r@:6?7 aK?Y@O?ϟK?YϟK?YKu?aKs?i k?k?74_ 24 4X 2ςK?Yׄ4K?Y@7?_M@K?Yk?7N:N!JJ ‡FF BbB B@ "_@K?Y@7?#7"6#7#G7\0#'u7<P#]7p"gE6|"-6k?7_ @_7K?Y@7?7w$J 07\6 (@?6@4@k|=Ku=Ks= k?k?ok?7c$Hw :Hy_K? :4cH?Hy4K?Y@O?H|Ku?Ks? k?k?ok>7#4k>4_7>k>#7>  Kw=  #Zk>K>^?*EK> p7K>?@Z"K>@4yȜ84K>@7>7@ 7>4K>YK>@O>k?oK?7Cr Z:7? 87='Hz'8G'FB |K?Y@O?Ku?AKs?I k?Ku=Ks= k?Ku=Ks= k?k?ok? k?k?k?!k?) 7Ck?4p4 _=k? 44c 4@4#4x#4_4z! @_]4z0 _ w 67B7 @ R4@4 Z@_ 8"@?7044K>K?)K?!K?K?K? @O?C48"Z|4_77?7?_e45? b K?79 VǶ5?@J w  TǴ26?` @ w  Yǹ_6?@2 w  "6? x ' (4 w 0H64`4@| S4 y X@ w 6  <]m7 w  Z Y? w }? 5?4\ 7\ w  w < w 6 u < w 4_4z77?7?_ 4@y4x: (K?4_4y444_4x4k?ok? k?k?k?!44k>k>KEXk@XKFPKD`KCpK>kPK>k@pK>k xK>!C`!B7?QK>K_^7>A7?Q7 (@K>7>A7?Q7 @@K>C "K>7>@ 7?Q7K>KP 2#7B7?QK>jPKX 2"6B<7?QK>@jXKxB *#7 B7?QK>jxK>7?Q@4K>hPK>k%XK>kD`K>kpK>K?!K?K?K? @O?Ku?1Ks?9 k?k?oB7CHz@ @_@Hz@ @_e@K?Y@O?Ku?qKs?y k?k?ok?k?k?7C@7$44z_u4HH @H@@4H0!jH Ax4H8" H(B4H"H B4H@#RK?YK?K?K?@O?B  |H_  7B4Ha% \4HsHe  _4H@e_m@H0B4 u |H_ % 7B4H 4HtH  _%4H _wHH8Bl  |H E _ @7B$4Hx  <4HuH % _U4H(_e@EHB -h|H_M 7B\4Hz E 4HvH  _4H_wHHB4h|BX7HzBHHeK?Yk?ok?B 7CHz@ @_ @ `h`HHw H`X4HHw  _@HwH4_@_mHzh`Hz@ (@B@_-Hzh`K?YK?@O?k?7_k?_K?K?Y@7?k?ok?k?7#_-7 4B4z84#74B4zHd4K?YK?K?@O?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK27D7%B_744444)4 7l%k>7k%k>7j%k>7n%k>!57j9!4 4?47W?u4? w ǚ6\ C(b _ AǡRH6V B((@ _ VǶ_@k?444A04x (7H Y4BP6YH^4 rk?444A4xH7^4 6S  06Qh`_=@Hp Thp 0HH7 Hy@ 82H6 @? ?@HC0 7  bhh44@4x 06Q (7H ?4A469H@ ^_HC (4 244A7?Y P7Hǡ K>@K>B7?Y4zBP7?Y 46B H4^ޟ4^_ B444BP4x$7H^_HC#7 7?A4A47B7?Ak?B(7?)k?B7?A 0H447?A@@7?) (7H "4A69Hǹ@K>@K>B7?A4zB87?AHXB5PB7?)4zB7?)HX7?hXHP HX*4zB7?)HP6?hPB(7?)B7?A 4H@ @9 @B07?qH52 44AP7?qK?qK?y] 75PB7?q4zB7?qB07?q P@H^rk?44k?4@4xHPH4ZҠ_4 H7H^r44A<4x47 ! bHƿ@4^_ A$444A4x74 !*HB_@67W? :H^"44A<4x7 H H` #7`B4zHp@ ZHoHp "6PBX4z_aHp7B04z5<K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O> %@k?ok? k?k?k?!k?)k?1k?97& k?A74pB77?iA44 !x4K?i A`44x4 7 7 K?A4_4x!7K?i@ 4@B04zHC?m@7 4B 4z`K?iK?A4A7? 74zB`7?B 7?K?i4_4 HsBz?4| 4PB (4z4B 4z4K>K?9K?1K?)K?!K?K?K? @O?B 7??GHsK?iKu=Ks= k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Y77#k?i 4k?a47B 0k?qHz7_ 4C4(0x47h&7i&4 4K?aK?i4y@K?q 7HwB( H}Cf!44K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O??4_!Hz474 L_ (7 Hy_=5x :5? L@>H}UK?a4PK?i4B 4 , B 8K?iK?i4B 4Hx  yK?i4B h4Ht6 uk?ok>k>k>k>K747#k>B!j4!4!r444!4#K>7B x4Hy7: z_4z7 "67?Q_4K>Bp7?Q@ * "HC7 0 g44K>YK>K>K>K>@O>4y_}4ܟ44k?K>4A4yܟe44? jB J K>4B4Hx7 } 4̂5@>%@_i4z@k?ok?K!7#4k?@?? "4y_4 K?Y4ڋ_ :#K?7B4Hu6 vHtB7d9 YǹX@HyK?BP4Ha45 uB Sdz_HyH|C4\ "gK?6yB4Hv6 yC? XǸX@HyK?Bx4H|7 tB ]ǽ_HyHuB4ʊ #K?7B4Ht6 xC WǷRHyK?B4Hv6 sBb ZǺ_Hy4K?YK?@O?Ku>AKs>I k?k?ok? k?k?k?!6K77$k?1B47E!46 _4 87H H`_ 4 4|!4ڊ :#7K?1B4H4 "6K?14B4_ 4@`4|!r`4|H " BK?14|K?1B4h4|>@K?14_4|(4|\ @ g?aK?17?aB4K?14Bh44| _ 94>@#G7YK?1B4 `4|#'K?179 B4(4| *K?14_=4|4| !4? B4k?K?144@4|4|_ 477R 2#K?170A4HB@4k?9H7_=4K?9 F _H (k?A"K?16A$4K?A 0K?1AlK?A_IK?A@AK?!K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>K>77)K87 97CK>6444 $4 Ad4z7I?C40#7 ,_5:$7Hy @HzLD_i5:$H$ A4 $Hx A5z"4z@597A 7?1'r'44z595_5'7 II B P6Hx <6Hw _IHu 4A5A5K? 5kxd4J>7?17 ?4z59_ 4&7_5:_m7_I:WK? 5PA4I94AD5 p@B 5Ha+ \5Hv _I9Hu I4 u /_5:Ak? _I:K? aHpǰ8 !I:5@_404  @I9K? A4 @I9K? A5zI5K?  ? "6 A47? @5:!"5A7?1YK>K>K>K>K>K>K>K>K>K>K>K>K>@O> zK? B h|K? 4haK? `2Hs  7K? @K? a4 4 4 ! 5@A4I?C;@7 74z59@7?1=74A 7?1=@K?9K?1 YB(5Hs k 5H} _iK?1H} o 7?1 @A@K? 7?qA,7O4z @A54 *"6A4`@HBz?4|] "6PA4"6 A4 0]@HH ? 8484zA4 5k?ok? k?k?k?!K_7G7$K>76^"g6y`^4  b7 }^4z""H   C4X!@H^_ 4p^m4 P 4^E4 ( 4`^4 H4" b^4z!BH   @C4 7ς z4^m4 ` 7 f^54z H   C4 4K>K?!K?K?K? @O?ˀK>7ς }ˀK>ˀK>7ςm yk?ok? k?k?k?!k?)k?1k?9KH7#7EK976h 8 & 4#7?Ik?7?A4_4%@A 7?YHyK?A *AD4Hh_ HH hh!5 A d4K?I4 4 7?YA @K?IC7#R!47?I@ 7?Y$*4 t44y@7?Y 4A \7?YHsB 8 4A L4A $7?YHCR" 777! *44yA h7?Y?/44 A 4A 7?YHC70 w0K>7k?I7?IA 7?Y"z847:^=4x @Hy <@ @A d4(HyHy4A 44Hy4  hA <7?YHh HH hh 4 A $4444 4 44yA7?Y>4 %47k?I47?I@ 7?y 5A l7?Y7?YA $7?y5A <7?YK?IC j7k?I7?IA x7?Y :4A 7?Y5A4K?Iu7?YA@K?IH4"?h5 AT4Hj@ Hz4^u4 zHwB4V ZBB B7z=^ "4A4@HjHh7hh4HyA4Hj F  K>K?9K?1K?)K?!K?K?K? @O?k?ok? k?7#4k?!7:^%k?)77ȠJ^uHz@0@K?!K?)4y_u444K>K?K? @O?k?ok? 7C7?k?4Ak?A84zk?!K?4z_7?!@HxPK?HsXrHh K? 'k?K?A7?H}X0@HyP76?hvPk?K? $848A 4zK?K? ? 848K?!A4zHb@߿7y%@_7y%ALK?K?A7?4AD7?4K>K? @O?#K?A7PHzX7U?huXk?ok>k>k>k>k>B67#k>K%7D4"H^޿^_"6^ =5"h@AT7>K>AD7>44^57>7>^4A!z44K>4yAP5K>4_4y! 7 eAK>K>Al7>4^]7>5C @C :7C b?7C?7 ("7C ?77?A@>4_7>A7>4K>YK>K>K>K>K>@O>4K>44yA`5Ÿ}4Ku?Ks? k?k?ok? k?k?k?!7#7DK:^uk?14Z"Hz6^4  2#Hz7^m4  @Hy7: z4hx#@7s9 VǶH"4(ȠhHPHƟ@ ^_b GHz4Y0^4"2H}7 |4hP^HzZ Hz4^%4!*HtB7z=Y^@!HCC!bC4 R7 v4K?1hX4@4y!@44 7 u4K?1hP4@4y 4H^ _@ Hz4 ^4=HHs6a a4hXHf44^47 7C?7 4? 2#7@_u4@ 7? <H`ȠHPHz!J@7u9 WǷ@:4 *4_ 4? 4 Hƿ@ ^jǷb4 f^4zHyA`K?1^UHzHt x wƿ@:^"^_HP7^_hP4 bHƟr@4v Z@4< B^@K?174_ 4y4_@4 @4ڂ *4 b@4 }( B^@K?174_ 4y4!@7t9 VǶ@4 ^޿ ^_K?1@4z!@ 4@?4#G7Y^]4 7B0ȠzK?14_ 4yȼ4@ 2K?144y_4ȼx44HP HX BHyK?1A4^HzHa  b4K>K?!K?K?K? @O??4EHPKu?Ks?  k?Ku?QKs?Y k?k?ok>k>k>k>k>k>k>k>k>k>k>K?47#k>C7D4 P4C7z=Y^Q@ HC#@HC C :C4 + "C4 C"4 7 :C4 "C7z=^yҙ"HC `@C!ә^)5p *7i=Hz_}59$x7 Hz4^4'HHz4^4 *HC4҃'4̂'44K>YK>K>K>K>K>K>K>K>K>K>K>@O>_7y=7HyK>A5Hw  }7_7y=""Ƞ4Ha49 y^ 4&7Ƞ47 sHX6hXHC: 7 jJ A_7 iA?5:!7h%7i%7j94+4 4 J ( k?K>44@ `4yȼ}Hzk?K>44k?_4yȼ5Hz _ XǸ@^4zHz^Q7}HyHz_7y=4 ZH=@H`߿95AK>Hy7: zHzC_>m@ gAX4yP%4Hy78 x4 C R4 4 k?K>44@ @4yȼ:k?K>44k?_4y7!rȠE4^4z@7^9Hz@ Ƞ4@@Hz5^Q4 HC46 CC r^5: P@K>A p5HbF  z_59@HHyK>A4Hh   H>u@7 yH߿7y&K>_7y&A @^HzHyK>7A 7H}  b7W w^4z97Ƞ44^i7?!K>A 7?!K>A 4^4^HzHz \ E a7 nA 87g&!4 (7g&A R4 4 zk?K>44@P4yȼjk?K>44k?_ 4yȼ(@K>4@ 4y7 "HtB Ƞ 4K>ᐠ A 44k?ok? k?k?7F6k?!7#A6Hy77^-4 H^i4 87K?!A 04^4 @HyK?!A 4^4Hw  xK>K?K?K? @O?k?ok? k?k?k?! 7CKZk?14^4" 4H}7k?C 47?^a@!K? k?C C 7k?K?Bv?7?Hx7 wB@ 44z^@!7^Hz`HyK?1A 4Hw  C H@CF 0@K?1A40Ht6 gHuB ?4zK?1A(4P(4Ƞ4Ԡ44K>K?!K?K?K? @O?Ku?Ks? k?k?ok>k>k>k>k>k>k>k>k>k>67D7&@7k>4 4 4 0@HPӀ_HXӇӀ_'AP7?9A@7?QHB4H#z6 ^a4 H |@r44K>YK>K>K>K>K>K>K>K>K>K>@O>H A7?9 c5I?7m&k>7z&qk>4 4 5,A7?QHCW 4 7 HCw"k?44k?47?9_7?Q#7K?9< Ap7?9"4 @ZJ^ 4"744_ 7?9PK?944@7?Q"877?9A7?QK?9K?A ? 848@ 4 `2Hǵ K>@K>A07?9}5)?K?9 ^ !4 7Ƞ4B4?67?0 Ƞ4 ` g?1_7?1HC74 7 H7 <@4=H7 ^ 4 H }'HȠ-@4K?9K?A ? 848K>@ 4 zH߿7y&_7y&@ 7?9HX!'59P@7?97?9@7?QK> "4z@l7?9h@HbHfF 2HЀ߿7y&Ѐ_7y&@<7?94zA7?9@t7?Q@d7?94KA@779 S`_ˀ7?5KT6WB ]ǽK=46B S \6? dz_60V0=4@k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7D7&k>@7?1@7? @K>7b&k>7m&k>!G44447i95J(!g4 4 44T4LHB?7? 4? Q 4*?HHC6?QB4 w)4 )4)K>4@ 47`04@? @|K>K? K? R#G7YP@DK>K>@7? @|7? @@\7? )`04 4|6 HǴ@5y@7? `04?6 5y@7? `046 K? K? H@C ( *5y@7? 5y@7? 5y@@7? HCM *444^7? 7HC 7 5yP@,7? 6 7>_ 4 K>H@@"4=WK? hK>H 7?!Mk?!6 K? K?_ H@C ( *5y@d7? 5y@7? 44@ \7?  (@HC (0 Ƞ@&J;U@7E 6 045y@D7? HCS 84HǼ K>@K>@$7? HC? ? ]ǽ@^94 k>]HK>@ Ƞ@H@l7? HK> X 4 4! 7?Y4_47?Y@7? 5y@7? @HC4 4 4? *^H6 7H7 4CS!Ƞ5@ k?@7?qk?444^7?q8e7K?qK?y 8@7? @T7?q5y Bk?444_ 7? >=7Ƞ-@"44@<7?  HC Ƞ@7 HӠߒ 0/K? K?_ 5yP@D7? ^I6:7@7? 6 HbK? K?Q 5yP@7? HB^:7@7? H6% k?K>44_ 4ȼU@7 7>_ 4 K>H(vGHȠxK>7 ]4 87H H`]4 4K>@@@7? 44|K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>H " @dK>@K>@D4̢K? Ku?!Ks?) k?k?ok>k>k>k>k>k>k>k>k>k>k>k>7G7&k?977?A44@ 44 !G4 4 4 44HC ( 8""#B#Hh@HHz_ 5YP@4zHB]Ӛ7@|4zH6 4^ U4c?%]H4H   47?9_}4K?94^ 4HhHo 4P@ T4z4z@ <44K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>4k?4k?44^7?A74z@ ,7?A?47 HyHt 5YP@ 4z5Y`@ 4z7 HxHsx 5YP@ 4z5Y@ 4zb7 HwH} 5YP@ D4z5Y@ ,4z@4< HC:@4? '4< @47 HuHi5 "6P@ t4z"g6y@ T4z47 HtHh #7P@4z#G7Y@4z47 H|Hk| #'79P@4z#7@d4z%47 HaHl, "6P@ 4z#7@4z47 HvHjV !5P@4z!5@t4z547 HuHf !g5yP@4z!G5Y@4z̨47 HtHe !'59P@4z!5 @4z̪E47 HyHv  4P@,4z 40@ 4z̪47 HzH|\  4P@4z G4Y@@4z̬U47 HsHbS  '49P@<4z#7`@4z̬47 H}Ha= "6P@4z"6p@4z̬e47 Bt79 X_ȀH4 4C.77?!7" @X 8p47?!HB  6yH6` C9 ?HHA 4Ƞ47?!  H6M ] HH@ p47@7?q44^7?q @K?qK?y ? 8484@ 5H}Hb] !5P@4z4z@7?q@4@D7?qȀu@k?ok? k?k?K747#k?!B 4 6 a@7404 *4 K?!@4Hb4_ C7e9 _ǿ@׀4K>K?K?K? @O?4 ˀK>"K?!@D6Hf4ςu ǿp@4&HzC_7y=c=@K?!Hy78 xC Sdz_@ #K?!@x7ςK>k?ok? k?K?7#4k?!C7D *4K>K?K? @O?7 s] M4z`7ˀK>#G7Y@K?!@4k?)Hy7]4K?) E ]5H 8k?1K?!@7]K?1(H}HyK?!@H4H}  t]K?)ςK>k?ok? k?KW4Z7Ck?!B jc=K?!@7y=Hv6 aHuB7d9 _ǿ@:ˀK>4V?Hu6 |ǿp@4%HzC_7y=c=@HK?!Hy78 xC Sdz_@4K>K?K? @O?k?ok? k?k?k?!k?)44HC!7 ]4A8h|@"HC!Z7 444z7CK(7%7@7H_-@Hy7? ph}ˀK>@ 4h|@(7Hx4z_a4 ˀ(K>@44K>K?)K?!K?K?K? @O?ˀK>Hz@?@@x@-HxHy@84H 4z@5ς5K>k?ok? k?7CKZ7@ k?!Hx@HH`b *4htH@ 40 | WhwHHz@ L |@ 4K?!77]4 `H@7hy@H} K>K?K? @O?k?ok? k?K_077Ck?!KX @b *4 hs0@ |4(0 | Whw0Hz@  |@ ,4K?!77]4 H 7hy Hz _ K>K?K? @O?k?o7CKZ(H8@b *4 h}8@D4(0 | Yhy8Hz@ |H|(7h(Hx  K?Y@O?k?ok? k?k?7D7k?!6@d7K?!77]4f H K>K?K?K? @O?k?ok?KW 7C@jH6?hd   *]E@Hw HHw _6?Hw(@jH6?hd(  *]@H  HHw(_6?K?YK?@O?k?ok?KW@7C@jH6?hd@  *]@H HHw@_6?K?YK?@O?k?ok? k?k?k?!k?)k?1k?9k?AKG7C7$k?Q4X4!g5y@7HA !GK?Q@5YHC4(0 4ʊ HvcZ4!'4 4 ("B7 C *7?_14 ˀK>k?H@ ^_Hy@4c]I4k?CH^ޟ ^_K?7?k?K?cHs@czHx`K?4A?Ak?HyK?:  0k?Hs@K?Q@59@7?4z_7?a"H}@K?Q@87?a@7?aHt_-4K?7? k?H "HuK?Q@59@4z4_7?a" HtK?Q@`7?a@ 7?a4HC(0 <@Hx\@HC4ʈ" b7 HwB #'K?Q@ 79#K?Q@ 7Hz#K?Q@ p74K>K?AK?9K?1K?)K?!K?K?K? @O?ˀK>7?_4<7HˀmK>ˀ]K>ˀMK>ˀ=K>k?ok? k?KD7Ck@H7hwHe_}h`k?!Hz@ @@ `@hdHy78?hxK?!heK>K?K? @O?k?ok? k?k?k?!k?)k?17%K977D6 7@ 4z4@ 84zHz@4 Hs:@4 "444^4wH^ޟ ^_J Hz]a4&0@Hz]94&zHeH `ZC4ދ BC49 *C7z=]!@HbHz B *`R 4`]4 *HhA 7z=]a9#HC4%@C%C4ފ C4$8$C7x9 UǕĪC ZǚĐ@C"J447g& D]9 0@Hb 4Y]}4%Z4?@K>HsH ` 74P]4 +447h&HxHz X E  ])6?< *H  7]u58#4?}@K>447g&H|Hh D  ]y6? *Hy 79]5#B4?}@8K>4‹"C " 447g& D] 0@Ha 49] 4#J4?@K>Hg4 k?7?4_I7?i!0@@4z4@4z4z@7?i@(7?iK>7k?7?4_7?i @@P4z#7@H4z4z@7?i@7?i0K>HP7hP@4zK>K?1K?)K?!K?K?K? @O?HX4EhX@`4zK>@@4z40@@4z7f& @ 4z4 `@4zK>@4z#70@4z7v& @4zK>@p4z!'590@h4z7u& @H4z]K>@4z!50@4z7t& @4zK>k?ok?7CKZ `7$`@4@@4 |  | dK?YK?@O?HwH _K?Y _k? $  Y@k? |K? 7 aK? | E bk?o7CKZ@ "]Y@ ` ` `K?Y@O?@@@@K_@_k?ok?7$ 7C@ j]4k?4z_7HzK?]4HwK? hyK?YK?@O?k?ok?K?7$7CK7 Z k?_4zHzH]YK?HK? hxK?YK?@O?k?ok?77C Pk?4z_M4HzK?]4H hwK?YK?@O?k?o7# @k?@ *]4zK?7@p4yK?Y@O?k?77?K9K @ ?K?Y@7?k?ok?77C k?4z_4HyHz7??_2C 7?Hz@K?]4Hz D h}K?YK?@O?k?778k?#7]A7?QK?_7?QK>@7?Ku>Ks> k?k?oKy=!] Ak?#7 7 _}K?(K?Y_]4y]4zK?Y@O?Ku>Ks>  k?k?ok? gKx$k?_4y07$K :7 K?_U4y@ ?4K?_%4yPK?YK?@O?Ku>Ks> k?k?oKxPk? gk?!_4y`K?_}4y_K?4y k?_MK?K?_54y _UK?K?_ K?K?_4y P_K?!K>@O?#@7!`#@7!p#@7!`@@K?@ @Ku>Ks> k?Ku>Ks> k?Ku>Ks> k?Ku>Ks> k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K# k?Kb=14!kcP4#kb= 7g.a7$7E5B4$8@4)Ka?4*4 4 4 44444~$⁜#Z$% $$\#b5Z@_4Hk?5 5z_e69_6:#I 4??i fI(6Ui(Z_%5 I7?i4eI6:iB/  S m 4\5 `/I5?6i@eH61I6iB J Z M?u@4\5?O ^E@CuPKt= 4 U84    87 p  h6Ky=!]) =7CxPX :I 77?d i I(6ai(j5 6_69]y6@]Kz=!7]@k?445B4<%@K=yA4&@*_ Kg=y4k=y4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>4_5Z k`= Kx=)KyP_U4!ˀ%K>Yukq= K=!_Uk=!KxPKw=Ka?4:@_4"ςK>YK= r"߁? B_ R4  b4  24  "4 4 ( Z_=@ȜP+`_5@Ȝ0+`_-@Ȝ+`\@4%7f97gPKa?4(4)4 \7kP4 4 2_E5-@_%5@5 _-4\5 _ 5 ok?7KxPKa?7W#4:@_}7"P_m4K?Y@7?Ku=Ks= k?k?7_@ 7K?Y7@7?k?"_6"`K?Ku>!Ks>) k?k?7_@ 7K?Y7@7?k?"_E6"`K?k?/,/-/.ok?97C4@"(k?@"K?B 4Z":cr@x4"06.`7?a \ &00N8E&E_7?aa"#G07T. . 7?aK? ''001n0N 1A 'I9 @B D7`!7?a$'('(08G'0G0N9E'8E0 8_7?a4K>K?9O?1/0./0-@/0,7:Bl4` K|=AˀK>}K|=AmK|=Ak?ok?_4(70`"K?BH4z04K?Y4|@O?k?o@ ] KC `?4zK?Y@O?k?ok?7DKZ7#K]KS } `@K_77? ҕu B4@ P4HK_4xKVB  H4ˀ K?YK|=A?HK?YK?@O?K|=A?@k?o7C_4 7 K|=AHwk 4 K?Y@O?K\K @_K_@KK_@K_K @kK_KK  P4@ K6? \0@4@KWJJ@  k?ok? k?7DH7k?!4B@k?)!@7HK4KK?) BK?!!@H H? J@@ _h H(7_ h( HH(6 h4H( @Dԃ DK>K?K? @O?K|=AB84K|=AH(4h 7B4eK|=A `BKW7`2KZ( Y CӳK@ˀ@k?7_4 0K?Y@7?k?o7CKZ@ _@\4zK?Y@O?K_ KW0Y j Y@k 0K\K ??@@4@K_0?@kY0k?ok?7CKZ0Y 07$K__h0Hz0D?@K?YK?@O?@K\0k?ok?7D_e4@ 0744|K?YK?@O? d44h d ` `BPh`0 h|8`}4|Hw _ ڋ?Mh|(B`Hz8`54|k?ok?7CKZ0@ _KD?4Hx7?`2H( B4?@\Hz(_}HzBHz8\4zK?YK?@O?Ku>qKs>y k?k?oK_7#C 7ˀHk]Ks=I "0_]6k|=IKy=I#K|=IK?Y@O?k?74_-k? BK?_ 4 @@(K?04K?Y@7?k?o_E7Ck?Hw4HzC_JJ 8  k?i4 r@4z "@K>AX4z 4z_K?4K>@O?7?a@4z?@H|C?4z4?w4zK?a??47?iA4z?M@%4zk?ok? k?7D_7#k?!H44@_ Pk?I4 b4"4@4y"K>A 4"x `HC@0C4!(@H76hK_KW"06B "47?I@4!4H@94  0@K?!4_=4!X@A4!:K?I04 }4A4y?GHK> `7?I@4 @HC<4 p@K?!4_54 P@A4 2K?Iz04 z@ `4K>K?K? @O?K|=A?@7?Ik?ok? k?7Ck?!_%4!7Hd@4䃟 4? 4_!:B x40!74z@4HzKW4@KTB  z4HzK_4KSB  !*H_m4zB 4P4Ke=A?HzH_4zB 4 jK?!@4z H74z_U47044Ke=A4K>K?K? @O?Ke=Ak?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>7C_=7$k?aHt4k?B4&44`4 4 4 4 !0444p4r@4z"B HsBu "HK?_}4z!HtB@!:_(k?a HQ@* ?H@R @ (K!" HzK_5KYB ( ?  ˀJG!A 4z!"K?a04 4K>7?a4zA`4 ‚K>HtuHs '04< K|=A?@pK>YO?@AT4z?u@0K>Y@0#0@ 7K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>k?7KB4`@_ @4r`@`@ bhK>4 4! 8?@@04K>@7?4Š44_g44Ƌ :K_C0C4074@7??E@54#07k?o7C47?@4 @K? #'0p7<PHx8@4z H@HzK_KWHx8B(  44K>@O?K|=A?@4Ku>QKs>Y k?k?ok? 7#k?4k?B k?! (7K|=AK>K? @O?K?K?4@HK?!HK?_ 4 |B4ˀ}K>k?ok? k?k?k?!k?)k?177D k?A4H! JHC4܋: *7hK?AB 4Z!4`4H444 rHCH @" @H h 7hCB K?A?HK|=A"06K>K?1K?)K?!K?K?K? @O?K|=AˀK>k?ok? k?7D77%B74zB4!r@ZHC!b7hC9B 4z!BHKv` '04: k?!\HdK?!74\17 r C4\ 4 4Hw 2C4 #07 BH4z4K>K?K? @O?K|=A G04\K|=Ak?ok? k?KW67kVB6kBB47D7w/Aи"H64`xB24rb"HKA#07 KSB0 a "4_40 `K>ق#@#"ӽc4 7?A \$A00N8E$IE IR\7Ӆ ] HB3Bց ?-֝ ӵ?@ Hg?HKA"06@K_B !4HKVKYHBh 6 !p4Hˀ a4 8 B"06].K|=A=@K>HK\"06 K]A  `44@\@0 `K>K?K? @O?K|=A?@4K|=A?@]HK|=A?u@uHg? G0E4\` k?ok?k?7DA44 87Ke=A4K?YK?K?@O?444_4yKah!@HK_"06KYA ? 0Ke=A HKW4xKTA  4HKS4K\AD  (@A4z4Ƞ4Ke=A4zAT@?@e4Ke=A?4z=Hk?ok? k?7CAl44 x7Ke=A4K>K?K? @O?Ke=A! Ad4?4(4444z_=4Kh?@HzKW '048KTA, 0Ke=A?=@HzK]4K\AL >+4HzK_4XKSA  A$44_4z ȼM4A|4 k?!Ke=A444z_7Kxh @HzKVKDK?!A$  4HzKC4KWA  (@AK?!4Ƞ54Ke=AK?!A@?@4Ke=A?K?!=Hzk?oK_4C h7C4Ћ7 7hz_4z z4z_4 RXK?Y7h}_4z "4z_q404K?Y@O?"g06|k?ok> k>K_47CC"7hz4_4z%7HzKY#07K]A %r47>i_=4z%74K}`,7hsHz#0KTKE A\7,44z_I@$x7@4z$X7_4zk>!A4#(7444z_e44_ 4z 7@@4z7"@Hz"g0K_6xKSA  "4HzKYK]K>!AL *Ƞ`K>!47*7hCҕ6?{4?#G07U Ke=A"RA4"z4Ke=A"b4zKe=A"B4zKe=A""4zKe=A"4zKe=A!4zKe=A!x4zKe=A!4zKe=A!h4zKe=A!b4zKe=A!BX4zKe=A!"4zKe=A!@4zA 4K>!Ke=AKe=A=oHzK>!A @Kth=@HzKV4@KUAD =+4HzKU4KTA4 A T444K=K>K> @O>Ke=A?4u7>i7hbHz '0KUK_ A 48@<@44z@@?%747hdHz G0KVKW 4X`Al@<_+44z@@>7u4Hz7hw#0KBK] A7;+44z@x@=747hxHz"0KDKS d A<6;o+44z@@=U7E4Hz7he 0K\KX  A4Ѓ:+44z@H@<747hHz 0KAKY ! A 4:}@44z@@<%74Hz7h| 0KAKX  A t4 :@44z_@;74_4z;e7HzKT4PK_A 9+44z_i@:747hvHz 0K\KW A D4`9+44z_@:]74_i4z:57HzKS4PKEA  8+44z_9@9747haHz 0KBKY " A 48'+44z_@9-7_4z9 7HzK]4PKDA  7+44z_@874Ke=A844zKe=A#0=7"g0%6e@k?ok?K_47CC!7hvB?4bcz4fCh@HzK\KAHx8A< #@4H7hyKxhCЗ"6?HzKW#07 K]A "4HzK]7a3KT $ AD "4HzKU4KVA < "ˀ44#7huBӟ4`b4dBrHzKU4KBU A @"H4HzKVK\Hx8A "04Hd4hxKwh@_ 7?HzK_"06pKYA ? !4HzKY7b3KS D AT y !4HzKT4KUAL !44K?YK?@O? 04K|=A?@HK|=A?@HzK|=A?e@%HzK|=A?=@-4 G04\0K|=A>@HzK|=A>@HdK|=A>@HzK|=A>@5HzK|=A>]@M4 g054|@k?ok? k?k?k?!KW47Ck?1B7%"44?!4_#:4%4! @@4z 87HyK34K=  44K>K?!K?K?K? @O?Kg=A?4HKg=A?4 HKg=A?g44z4z@H4?%7?44Kg=A#@HH4X   Ap4?@46h|4z_e4>]7HzHA4T>o+4H4 4K?1_4z=746ha4z_4=7HzHA4L=+4H45 6hv^U4z= 7@4z<7^4zHzC_4 (7K?14z_44 "4z@x4@@84z h7^U4z H@HzK_4@KUA<  Kg=AHaH4H?  <@#0HzHA7<_+4HzHA4 H@HH4X   A44Kg=AHvJ#07 J  HzK]KWA :+44z@ 4:-7H4_ k?ok> k>k>^m7Ck>!Hx4z4C_k>k>)4``з4r@4 4"j7>@4z"(74AX407^4z"k>14z@ P4HzK_4KUA $H9^u4zA44HzKY4@KBY Ap@$44?^4z_4z#7K>1^4zK>K>!^]4z#P7(4zHzKT"06K_A` $4H|7h_4z"7??K>4z4‚@J4`:4䀶 *@4z"P7Ȁ(4z6?4? 04 +Kf=A#G07F4@4z>74@04z!7Hb@Z4U>@K>K>!^54z!(7@4z>M74He@@0@` 4r@ 4!7>@4z x7Ha@94 *@4z=}70444z^K>)44K=K>K>K> @O>Kf=A?4HvKf=A?4X4zKf=AH9^4zA84??4HzKf=A?454?@ 4z>7H|4;@Ȁ4zK>!7>_4z>}7ȀU4zKf=A>_4UH|HzKS#07KFA` >7+4Hv6hf_4z=7@He4hw_ Y4z=u7HzK]4@KEA =+44z_E@=77#'07&0k?oKW7CB4X x4‚@ 4@ G04\K?Y@O?K|=A @K?Y@O?6h|_ 4z04K?Y@O?7}0  " '0K?Y4<@O?HzK_KYA ? ?+4HsK?Y6tˀhtk?ok? k?k?k?!k?)k?1KT7C7$B4 04@4H4 440A 4!Hs6aha@?! b HaH6? !4@Ap4!hK|=AHa"H7? !4@A4 K|=A@4K>K?1K?)K?!K?K?K? @O?H^4H7? >_44@AP4>?40EK|=A5K|=A44PA(4>HsK|=A44pA4=HsK|=Ak?o7Ck?^4!HtB4: rK}h H@HzK_#07KWA  p4Hs6uhuK?@p4z J4z^404 K?YK|=A?HsK?Y@O?k?ok? k?k?k?!k?)k?1k?9k?Ak?I7DKZ(4?KAKF7% A4P!z4 HC"4" 4'4!'04 @!^ 54 4 _4!@^ u4Ka7I7? U!4@A50Kk=A75|K>K?IK?AK?9K?1K?)K?!K?K?K? @O?Kk=A`?5|mH|m5|IH 5A8  H!"7hHC 4c>@HKB4RKH  A @@!J4 !b!G0u5K4 8@HHA5>@Kk=AA5`?H5|`:HK_58K]A  :4 4_ @>}7}5|Kk=A`?4U5|Kk=A`>@-5|` !'0`05+5|k?7^@04K?Y@7?k?ok?k?k?7%7D^E44!4HC]Ӻ4 pӿ4`A4ra A4!7444_4y7! !j!"`# 044K?YK?K?K?@O?Kf=A?@@Kf=A?u@(H^U4 @@4 p@^474^]4ܞ@ܞ4Kf=Aܞ4ܞ4_ U4>}7 P@HK_"060KSA   Kf=AHH=H? 6?= HKY4KEA =+4`>@HKW4xKBW A@=+4HK\4KSA0 |  @`K? @O?HzK_KYA ?  4ˀK>K|=A?@}K>k?ok? k?k?k?!k?)k?1^7C4 7K|=AK>K?1K?)K?!K?K?K? @O? @HzKW4KTA "ˀ4zH|8k?A@4 h|8%K|=A4^4z>@4x^)4z>@4& 0444z^%@>@@H4z>m@^e4zHzK_77K]@  44^M59HuB>%@4|^ 4z=@Hb4AhaK?A@Hz8he84z^M4ˀ]K>K|=A>4z5K>K|=A?4 K>k?ok? k?Kth7CK_ C4€@b4`RKe=Q6?? 4!z4ăD!4҃"4؂"HzKU4PK]A #44z_-@"7HzKT4RKYAH 4 #Z44@$@#Xk?)Ke=AKe=A 4Ke=A h4Ke=A@K?!!:Ƞ84 0407hb@_4` p@HzKS#'078PKW@ ?+4Hu6Ƞxhv4b? RHzK]#07`K_@\ >+ȠHu g04ep4K>K?K? @O?7h|@4k?!444z^m7 H7HzK_KVK?!@  ȠKe=A4 d8 HzKWИKU@< =o+@K?!m4Ke=A>4M4zKe=A>w44444z^7 x7HzKAKBK?)A @@ (@@K?)4Ƞ4Ke=A@dK?)?@4k?oK_4C!7C4 Z7hC4 j7h}^4z b(K?Y_4z04K?Y@O?_E4z?@4z^ 4?@47hs@H4z?e@4z^4?=@-4k?ok? K_47CC 4"@4z!744^q4z"7?94^4z"h@^4zk?K?9BP@HzK_4PKV@ 0Kd=A"@_4z7!@HzK]4RKY@ = !4HzKYKWK?@| #@@K?h44>_4@4z2D44K>K? @O?Kd=A?404zKd=A?4xK?9Kd=A?44z4=4?C4Ȝ%4Ȝ4Kd=A>]@@$K?>4HzKT4PKU@| >+44z_@>e7HzKS4RKT@ >w+4K?9&>4HzKU 04K]@l >7+44z_=@=7HzK_4RKC@4  ȀE4EKd=AKd=A='4 4k?o7C^4拀 4^4z @_4z p@HzK_#07KW@  @44z^@04K?Y@O?K|=A?@4zk?oK_4C 7C_ 4z BHK?Y_4z "4z^q404K?Y@O?47 Z7hsBz4?m@^4z?@]4z"0e6@k?ok>k>7$7C^4!He@4 Z4?k?K?4Y4z^Y4'(7#'07<4`` 4r@4b"4B47?4H^4z?5@K>YK>K>@O>K|=A?@4K|=A?@4K|=A?u@ 4K|=A?M@04@K|=A?%@4@K|=A>@4K|=A>@04K|=A>@@4K|=A>@4K|=A>]@4PK|=A>5@Hd7??4?#G07_ `4HzKU#07KA@ 5 ?U@ˀHHdHzKT 04KU@ D =o+44 4HzKS 04KT@ ='+44 `4@HzKh 0KVKW 8 @ T4`<+44*@ 4<+44@ HzKxh 0KAKY @ ! @ 4 YHzK\KW@  844z^404 K>YK|=A?4zK>Yk?o7C^!4!@^A4z!b4^4z!@@HzKY"06K]@ !4HC4V HzK_"06KS@   44H|7ha@4z JPK>7?^4z "4z@x404K>@O?K|=A?@HK|=A?@4k?oK_4C!7C7haKth BHzKW#07 KV@ "4HuB4`?@4r_`47?i4^4z!K}h "K?iHy]6!ZK|h!@@HzK]4KC@d}  jˀ4Ksh`?@HzK_4bKU@  ˀE+`K|=A K>و jKvh ZHzKS#070KBS @<@ ˀ K|=A04K>@O?K|=A?@HuK|=A?@=+`k?ok?7CZEk?A2@4!@w4!^a4z 7Kd=A^4z 7^14z4^ 4z X7^94zk?K?@x7 hKd=A@K?^4z@4K?@4y Kd=A@44K?YK?@O?k?7"0k?6@Z4 P4K?Y@7?H? @ @@K?ˀK?Y@h4k?K?_m7?+@K?]K?YKa?#04:@] 7PZ@K?YCW 07\ *7C?@4@k?ok?k?4?KwKxKy=y h x W W  araX4 P6? D X Ҥ `6 e4c_7`@ V   ֠ 476 m7 ` aH4P6? X ҃7 @67 D_4B`@ X  v 7ր 4\6 m7 7@ } Ku=yKa5kuK| kbK?YK?K?@O?Ku>Ks> k?k?ok?4$k`Ky=yky77z4_}kyk|p@4Z 4bHkzx4V b(k`x0k`x0k}x4|K?YK?@O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K>4'k`=K=y7Hk?K>7$7k? 6 4%Kt=q J4 0kj=y45_474k|=qK 4#C!0@K=yKm hkKn hkKox%KbKwW%% @_4K=y 8kkhkh=yK=y& B4ZU&B&6 (4 0Z4 kv #*K}=y 4 ZB :K?"B _4"KmA4 44 84 ?4z "5A ?5I:4!51KyZ - BKJ:Z !Z@0 6*61 J:@?}6*ku=y 6 kp=kjAW 24z "5JAW ?5JI:* 4 KyZ * BKwI:Z )`05+5) I:@?}5 6 46* #:@#K?@&Kq=y B &rKrB__4&BKa49ky4@+j_}5YKC@0Ka=y4,@0kl=y&4 t&C4= C4vS'"C,C+C+k=Ku=y6 kj=y (kK=y@z C4Z C J7`8k=y C?7C ?7k:K=y" Z =6:WK=yKs=y6k=yKwKx ( 8_4khKKw (k=y̟4Kmx0̟7kr=y 4hkq=Kh=i BK|=yKa? H H4:@4Y]1@ZKzKd k}k`=aKd=y44~kp=yKv=y6k=yA! IW 50kf=Km=i !7? CKa?щl 84:@#HIW]!7@@IWk? (49@CH]ZyKzKb ksICkc=ah4~ "@7kb=y kh=ZKzKeK? k}K? I_ID  44Kz=i :7?Ka? H"4:@]6Z)KzKx kxIZkz=a@0tt4~4Kq=i Kl=y Ka?4:@C 2"HKw]6@+Krk?"60CH]ak`=aK=y7kz=y7e4ke4~Kg=i zKqpKa?р 84:@!H5p]5W(+!H5]5Wkj=aX4~C4 44 04 k=K|=y7kj=y_=kjK=y57Kp=i 8@Ka?"H4:@6]5Wkj=a@ 8t4~`4545+ +Kf=i :Kv=yKa?"h H4:@]6y@ZKzKa ku4~Kr=y6Yky=y "AS I 5Iki=Ke=i 8@Ka?#(HIw4:@]79ZKzKx ki4~ 0@K=yA*7ka=y kj=ZAKzKd ksK? K? @ -IId  44K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ko=i :7?Ka? H#4:@]97ZKzKn kl@0tt4~4k`4k`=k` "k=Kt=y6ki=yK=y Ky=i 8@Ka?!H4:@5]!5Wkj=a@ 8 t4 ~k`d7kn=y km=k?7K?k?_ Ek?K?Y@7?k?ok?7$ 047C] 4 d74  `K?YK?@O?k?7k?]4k?K?_%7K?YK?@7?k?o7CZKZZ4zK?Y@O?k?7K_k?Z@K?YK?@7?k?oK_777C`7 Y7@  y]Hz |K?Y4|@O?K_@@k?ok?7CY H7$H_4z B4K?YK?@O?Z@HHzZyHHς k?ok?7C7:Zk?74z_-7 "4K?YK?@O?HzZK?ς dk?ok?k?7C7X @7%HH  _m4z *ˀK?YZ@HHwA`@ "_P4_?HvH 7   _6?` H|H w <  6?7?HtH    U7?77?HzH  z X HsH S y  4HwH [aHHHt 4hsK?YK?K?@O?k?ok? k?7C7%k?!Z7Hu7 _4z0ˀHwA2 }P7?Hb W   B  9_6?` Hsw   VHt6?   !7?H}   Hs6? D z   \=7W?HvK?! [!4H| ha4K>K?K? @O?k?ok?k?KU7$7C7_60ˀzHwA2 }P7?Hb W 6 B  9_6?` Hsw 6 VHt6?7  !7?H} 6 Hs6?7Tz   \=7W?Hv  4Ha4"hbK?YK?K?@O?k?ok?7C7:Z Qk?Hx7  _4z "4K?YK?@O?HHw Z)K?Hy $ ςhzk?ok?KT7$7C_60ˀbHwHy 4Hs6Hz _ H}7huK?YK?@O?k?ok?k?k?77C7&` H x` Z @4z_40ˀ4?AZY?P7??HHz  W  Y \_6?` HH}  t 6? HHv 7?  " E 7X?HHa:   } 7?HH|  Hs d 4 dK?YK?K?K?@O?? crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)? crt0: errno: tsd? ?<<<<<<<<<<????????=4<\??=|??d??<<????;?????????????????????><\kl kokklokkkkkmkmkklklkokkkkkkkkkkkkkkkkkkkkkkkkkkkkkkowswwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwHwHwHwHwHwHwHwHwHwHwwwwwwwwwwwwwvxwvwwwwwwwwwwwwwwwwwwwwwswwuuLvwv<wwtwwt\wwwwwutrwsut nw newdl deletenewdeletevn new []vd delete []as=ne!=eq==ge>=gt>le<=lt<plus+plapl+=minus-miami-=mult*mlamu*=amlconvertnegatetrunc_mod%mdamd%=trunc_div/dvadv/=truth_andif&&aatruth_orif||ootruth_not!ntpostincrement++pppostdecrement--mmbit_ior|oraor|=bit_xor^eraer^=bit_and&adaad&=bit_not~cocall()clalshift<<lsals<<=arshift>>rsars>>=component->ptrfindirectmethod_call->()addrarray[]vccompound, cmcond?:cnmax>?mxmin*szsizeof autoAutomatic selection based on executablegnuGNU (g++) style demanglinglucidLucid (lcc) style demanglingarmARM style demanglinghpHP (aCC) style demanglingedgEDG style demanglinggnu-v3GNU (g++) V3 ABI-style demanglingjavaJava style demanglinggnatGNAT style demanglingconstvolatile__restrictconst volatileconst __restrictvolatile __restrictconst volatile __restrictoperator operatorassign_type_ada____<%s>global constructors keyed to global destructors keyed to import stub for statictemplate <class> class()%d.e'falsetrue0JArray1Z__pt____tm____ps____S,_GLOBAL_{anonymous}___imp____imp___std____sti___ virtual table0123456789Qt__thunk_virtual function thunk (delta:%d) for __t__vtbl__::[]unsignedsigned__complexvoidlong longlongintshortboolcharwchar_tlong doubledoublefloat%xint%u_t-2147483648U...__ct__dtT%d2.11.2%s {%s,%s}Usage: %s [-_] [-n] [--strip-underscores] [--no-strip-underscores] [-s ] [--format [--help] [--version] [arg...] strip-underscoresformathelpno-strip-underscoresversionInternal gcc abort._$._$.<>#,*&[]:(){}_ns:jGNU %s (C++ demangler), version %s %s: unknown demangling style `%s' %s: %s virtual memory exhausted???UUUUU\`````P4``````````````````````````````````````4444444D4\44\4\4D444444444444444444444444444D XhϐAllocation failed.Expected ?std::Unexpected end of name in .::Unexpected character in .Unexpected character in .Zero length in .Internal error.Unexpected end of name in ._GLOBAL_(anonymous namespace)aN&=aS=aa&&ad&ancl()cm,co~dV/=da delete[]de*dl deletedv/eO^=eo^eq==ge>=gt>ix[]lS<<=le<=ls<<lt<mI-=mL*=mi-mlmm--na new[]ne!=ngnt!nw newoR|=oo||or|pL+=pl+pm->*pp++pspt->qu?rM%=rS>>=rm%rs>>sz sizeofoperator operatorUnknown code in . [nv: [v:Unrecognized .guard variable for vtable for VTT for typeinfo for typeinfo fn for typeinfo name for java Class for non-virtual thunk to virtual thunkcovariant return thunkconstruction vtable for -in-Unrecognized .Error.in-chargenot-in-chargeallocatingin-charge deletingUnrecognized constructor.[Unrecognized destructor. [::*Non-pointer or -reference function type.complex imaginary Unexpected character in .signed charboolchardoublelong doublefloat__float128unsigned charintunsignedlongunsigned long__int128unsigned __int128shortunsigned shortvoidwchar_tlong longunsigned long long...Unrecognized code.Non-alphabetic code.restrictvolatileconst [extern "C"] , Missing function return type.Missing function parameter. () Template parameter outside of template.Template parameter number out of bounds.ibi iii ll ii i Unimplemented.falsetrueUnrecognized bool constant.:(stdstd::allocatorallocatorstd::basic_stringbasic_stringstd::stringstringstd::basic_string, std::allocator >std::istreamistreamstd::basic_istream >basic_istreamstd::ostreamostreamstd::basic_ostream >basic_ostreamstd::iostreamiostreamstd::basic_iostream >basic_iostreamUnrecognized .Substitution number out of range.string literal [# [#0]_ZMemory allocation failed. --%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument D`dx| H L L P P T T X X \ t x x | | !L!P!\!`!|!##'8''''((( (<(@(\(`(|(((((((())) )<)@)X)`*,*0*<*@*\*`,,,,-<-...(.,..../T/X/d/////00 0h0l0000001$1(1,1H112P2335,506677,7799:4:8:X:\::@ @@ @B`BdBxBC CD` DdEHELEEG`G|JTJXMMOOQ(Q,QXQ\UHULUUVVWWXXXX]]]]_` _dc cdpdteef fi ijLjPp pq( qDr rw wx|xyy yLyPyzzz{{|$|(||}}}}~`~d`d4 8p t lp$(DH`||,0,PThlbb DH$(48@DLP`d|HLpt(,pt48TXhl04(DTX$(hltx t xlpDH < @@DX \ ðôDHŠŤ\`ȈȌX\ʜʠ̘̜̄̈8<tx\`҄҈ ՌՐռפ<@ (,txDHTXX\txx|PT  -@ /h 0 10 2T 6 7 B| Gd X ] e q,  d       , ר @$Revision: 92453-07 linker linker crt0.o B.11.06 981204 $/usr/lib/dld.slERROR: mmap failed for dldERROR: mmap failed for TSD(0HPp x@.::.::.::.::.:: type_info node type_info function.::.::.::.::PX`hpXxh ( 08@HPHX`hpxp H (8@8HX`Xhxx (0(8@H@PX`Xhpxp ( 08@8HPXP`hphxP_hsphjxnv (08HPX`hpx (08@HPPX`hpx@ (08@HPX`hpxX(8(8H8HPX`px(@POSIXLY_CORRECT  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000$.$`x?B|22l0-XdGd,-pר-@]eq,62T]/h7X10@H@D@L@P)binutils/binutils-RUN/opt/binutils/bin/gasp010075500000000000003000002400000732753203100176200ustar000300000000000000@"@@@Xdd(G?( @0P"  92453-07B11.17;^ 92453-07B11.046g0@ X"  LX  tX!Pޤ"PޤX <<X 8 88X H(.(X I 0X X 0(>(0@`>(0@<>( 0@P>(08@8h>(7@\@@\t>(&7x@x >('9@>((90@0>(P@@L@>(R@ Y  ? 0@>P@ $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$y5/x,|< /4p(Olhů;A8v˚v)8'i0VL'6!xD!xry 4'APנu R`aDg6mTLL''̃(24/Xk )kX\T !x )'6Yiנ'/+ 4gyg@ ƿǪ z'?A,˚v8vhů;An bY;tltD8rP.Y;2Y;Y;'#&744445 bנZRke-ke- (4Ц @Ц D(43 H? 0(ਃ 43 ` 7+4>7D7%7744z#/74444@H@7D7%7# 7444Kx-7D7%77Kv؆ 24u74444#$7@@@@ 7K?@ @@@@k?7k?#Hk? 7Yk?4@4 @@K?K?7@4K? *@K? K? 7@@4K? rKa?H:@7?!#7 4@4@x7?!7?!7@4#(7904@4Ka?@ xH:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 860.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?ok)4`@44` G>- ""46_4K>9K>Qki *K>y4ߟ444K>IKa_k? k?54@844? 7 H4Y@7z/_4h4k?4K>a5k?4@44?"H74@4Kk>7t-k>Kk>v k>Ks-k>7g-k>y 4 c?K?7}-k>Ka?43k? Ka?44k?֠ k?Ka?45k?7vk?1+4< ! k?!k?)#7@4_47=)"6p4_4 G=-"6 7z/_4+"h6y07z/_U4 (49@7z/_%4 k?)Kk?9k?A k?Ik?Q@k?QKqK>Akf k?q( k?4? 0k?( k?47(k?k>  k>7u k?y7>7>444? 7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4!4! <4?@@k?7k?#Hk? 7Ypk?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?!#74_-4@x7?!7?!7_4#(794_4Ka?_H:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 86P0.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?7Kv+ H4? 4447-7K?Y@7?K?Yk?4?k?474_4$4?7 k|_M@eK?Y#77z/_U4-K?YKu=Ks= k?Ku=Ks= k?k?ok? k?k?k?!k?)KwKx Ky@ *4 @7fKa?44<4'!@ 4@5 _4__4zK>K?)K?!K?K?K? @O?k?ok?7D7#:E |@4P4?Hz W _6` Hv 6Hu @78Ht 7Hs w 6HvK?YK?@O?KYKW A4$h?P7??BTָB  ?_6` 6|׸B  8UB  }!3B93הB  U6#7@ Ku>Ks> k?k?ok? k?k?7D7#_57:$#H7X/7?AH00n'1 1%N 1A 9dG'V | B KHy_Hx zHH? E@4P kH7Dh74D4y h 4K>K?K?K? @O?k?ok? 6_ k?K 7D4z(Hx0 rKa?4:@@k?#47 E4 K?_7K 7ky 4hs 4z(DPk?!K?!DXK?K>K? @O?k?o_7k(K?Y@O?k?ok?7D7#_7:$#(77.7?\H00n'A1 1%N 1A 9dG'IVI | JHHx H_}Hy HH?@44K?YK?@O?k?7K? k?K: @ zKa?4:@@(k?#(479 Ep4 K?K?_57Kw 6kx K?Y@7?Ku=qKs=y k?k?/,ok?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?a7?77$64D& H7aBHKa?H?4(4 4 4 4   (ҍ Ӽ 2p5?_5I?H -H h 5?S MH mh Z5?`J7?FH4'I9G'QEQ'^ x  4K>K?aK?YK?QK?IK?AK?9K?1K?)K?!K?O?@/0,k?ok? k?77#k Dp Ka?H?7Hu    44y4_474D4yK>K?K? @O?_%@?4Hx 7    Hx`X4Hy$  24@ 6$  _4 4D D 7?yKa?4:@@k?)"h46y pE 4 K?)_7Kb 4Eke 44yB(7?y7D 7?y4Ka?4:@@k?!#47 E P4 K?!_7K 7kx k?ok? k?7#D@7Ha < 4? 74Z!z4V 4P "4y_ 4Ȝ47ZD4y74y@ 4Ht 4R!h747Z4y_4Ȝ`47Z4y_474_4H 4D4yK>K?K? @O?7Z4y_4Hk?Hk?H h HX H Ȝ5 Ka?4:@@k?!"h46yEP4 K?!_ 7K| 7kz k?/,ok?k?!k?)k?1k?9k?Ak?Ik?Q7#_7Hfa7Hg 4T 4^!@Ka? H4'4\/ 4(4 ^!HH 44y_7?q+ h7 4T_47?q_4T7?q$&8G$F4^_e47?q_M4^K?q7?q '0$ 1n00N1 $IH}@*Hse ҟ( ?84D 4yK>K?QK?IK?AK?9K?1K?)K?!K?O?@/0,4@@ 5z45YPE4 5z_ 7Kz 7Uku k?ok? k?k?k?!k?)k?1k?9k?A7#_57Hsb7Ht ҿ4V 4Z!Ka?4'4(4 Z!HH 47?q_4y+ 7!*HK?q  H rK?y b4@@ 5z45YE4 5z_7Ka 49ky K?yK?K?y  HHbHK?q  K?yK? h Hb`*Hk e ( ?8G4D `4yK>K?AK?9K?1K?)K?!K?K?K? @O?k?ok? k?k?k?!7#_7Ht`7H 4L 4 4y_U7?q P74L_47?q_4LHK?q Y H}@H ?W44D4yK>K?!K?K?K? @O?k?ok? k?k?k?!k?)7#_-7Haap7Hb E 4 4!24H 44y_7?q `7 4_ -47?q_ 4HK?q UP 4_ 47?q_ 4HK?q  H}@*Hse ҟ(84D4yK>K?)K?!K?K?K? @O?k?7k?D(k?K?K?_7K?Y@7?Kuِ0C4`K>K?K? @O?@ @K?@ @k?o7k?7:67?q_e7k?!K? @K?@ ZKa?4:@@k?"hK?K?_6yKw 6kx K?q }K>K?!@O?k?7@0KH@0KP6?@0kP7YKzHK_ "7?kY K?Y@7?C@K?Yk?ok? k?6k?QKyH77h4#kwH7k?I7} 7?Q H4U.4<'00N8E' E @K}HC$70KzHK?IC7Z0KuHj(4KvHjPKtHj KsHjeXKvHj`CKzHKzHC K?QK>K?K? @O?Ka?4?@k?!@7K?!k?!"h46yD4 K?!_7Kk?A7k?Y_kxuK}Hk?ok? k?4#KwHk?!7d Xb C40HPK?!7?40_7KxH4h@K>K?K? @O?k?ok? k?k?7f XHPk?! h_!4y@KwH4h7@4%HPK?!4yP_4hKH 40@*4?K?!_4y`_@K>K?K?K? @O?@P@K?@ @Ku>Ks> k?k?ok? k?k?k?!k?)k?1Ky4k?I4$#4Kf8H6? c@Cz< Kv8J7j C59Bp@ 7BP@?7?!rKs RK8K6?:cKw8J7j4?/K?IB4#7Ka @Kb8HU6? I bCz< Ks8Jt6juKa8H46? bP 9Kv8J7jA@E4!Ka?4:@_k?A"46pD4 K?A_7KKi7 XkuKh8I6?` Kx8K44k 4|K>K?1K?)K?!K?K?K? @O?_Ky8Ks( +`_]Kz84&4'4VKy8_4=4|`-4|_UKy8 @_5Ky8Ka8Ky8_ 4V_>4|_@4|k?ok? k?k?k?!7C7:CTk?1Ha@?7e 44 K?1C HC4 @4w 4L Hv@z44L YK?1C|4H  @ ( Hy$_ 4K>K?!K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K?7#7DF@k?7eKa?4&4'4(Ka?4)#H4*7K4 4 D4N!4P4RHw Y#4c@ #r4`b Y9 JK?C<4H@"Hu 91?K? X4H$ <!Kx<7?4_4yK?75_=7?QK?C7?QHud(@H|  K?C4HzDCHv  _K?H  HCK?Hs4cRHrD ӹ *C' Kt<> 79?} 4? y 444 452@_6Z45Dl4 Hu 6Z_ 7Kt 6kx 447?_ 4yK?75_ E7?QK?C 7?Q@H_y@m@C $K?4HZOHwK>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>k?7K<4 8kw0CD@#Kz87_ A7K?Y@7?k?7k?7?yk? CDk?K? K?_7?Q7?Q_}7?y7zK?7y_7?yC 7?yK>@7?k?o7C4C 4yHy< "4_?}4?"h6z_ `+4kw<K?Y@O?4kt<K?Y@O?4ku<K?Y@O?4 kv<K?Y@O?Ka?4:@_ k?#47D4 Kx<K?_7Kx 7k} K?Y@O?k?ok?47CK?7$ 0\4c 4!"4؃!"4ă 4 4 4 4@ (0@Ka?4:@_ Uk? H44Y`D4 H 7_IK?Kw 6(kx 444|K?YK?@O?k?oC <7#H`"Hy< 7x z@* H4K?Y@O?ςK?Yk?ok? k?k?k?!4k?A7F7#77g/C$7?Q"Bk?A4"Z"`+07g0 Kz84$4_a44C4yKv< 87H|` @Ha & 4D!(4_ 4y"4X47?y_4y77?y_U7?Q4CD7?QKz8K?Q_Y4Hx`@@Hy&  @Kz8_ 444_4y?47?Q4yA87?QK?Y7@4K?Q7?A4_4yܝK?A7g/7g/ @Kz8_ 4K?Q Ӹ4_Kz8K?Y4_@7?QC(@Kz84C<4xKz8_i4K>K?!K?K?K? @O?k?o7?q_ek?k? h44yD4 K?K?7?y_=7K?C7k?!44y D4 K?!K?7?_7K?k?4y`Kz8K?y_K?qK>@O?k?ok? 7D hk?44yD4 K?47?_ 7K?C7k?K?74_ek? @K?K?C4k?!44yD4 K?!K?7?_A7Kz8K?^4y Kz8K?^}4y@Kz8^e4yK>K? @O?Kz8K?^%4y ?@m+`k?ok? k?k?k?!k?)k?1k?947k?7#7?_k?77_4y!R4%4X 44 5ZC4yHz\ 785J44PD4 7?75Y_14x7 ($ K?73k?7?''7?aKz848G'F^-5Z_=4y>5ZK>K?9K?1K?)K?!K?K?K? @O?k?7Ch@#Kz87^m7K?Y@7?Ku=QKs=Y k?k?ok?k?k?Ch7#Hy`74% Hx  4_M4 (@Kz8^u4`HHw 4_4  @Kz8^4 4 H4_-@K?YK?K?K?@O?k?7k?7?Ck? K?K? A 7?C07?#Kz87@^57C7?K>@7?k?7Kz8#^7`K?Y@7?k?ok? k?k?4x4k?7#Ck?Hz7aZ Hx  4p_4 R44D4 47?74_Q4x7H44 D4 47_%4 R44Dh4 47?74_4x7Hw4^@#(Kz8K?K?^790K>K?K?K? @O?k?ok? k?k?k?!k?)k?17D7#K>k?A6C74C4yHdx7BzHw4 4NX"R 7f X2ǸD K?AC04Hw  Ǩ߿ 4c4NW( +`7| ǩCp@7g4NH ((  K?AәCP4Hw`jH 9 R K?AҙC4Hw@H  ? "Hu y4CK?AHzDBJH} >@ (  ǡޯH4Ha $ 4J @Kt< 0 44PD4 47?a7_Q4xK?a74_17?qK?AC7?q44D B4x 0+Kh<= @4 N<@Kw< 0bK?AC4DK?A4AP4yK?A7Cp4D04K?A4A4y74K>K?1K?)K?!K?K?K? @O?k?ok?Cx7#Hs| 4P x7Ka?4:@_ak?#47D 4 K?^u7Kw 6kx 4C4yK?YK?@O?k?ok?Cx7#Hs| 4R x7Ka?4:@_ak?#47D 4 K?^u7Kw 6kx 4C4yK?YK?@O?k?7k?7?ak? C 8k?K?_K? K? 7?a@7K? _}7k?#K?i7_ 7?K?C7?C 7?aK>K?@7?k?ok? 7D7#k?C 07?!C 7?A4_4y74y@ 7?!7C4y74y@ 7?A7CX4yKa?H7H7!@  Ӽ!Bk?i4y_4k?K?i4?K?)D@RK?!K?A ^K?I!(@K?)4$_K?!"h6y4x_ 7?K?C p7?C 7?!C 7?AK?K>K? @O?^@>k?i#74D4 7?i74_ 4xȜm4yd"hk?ok? 7C7?qk?CXk?K?_4zK?7@ 87?qK?C7 h744y0D4 K?7?7_ 4K?CX7744ypD@4 K?7?7_ 4K?_7k?!K?aK?`K?y`  `K?C H4DK?`ZK?K?q7k? ӹCK?K?6?`_k?K?C4DCp7?qK?!K>K? @O?K?C4y`Ku>Ks> k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K77#7OWfk?7d44\444 4 4 H4 L4 P4RH !25A"  r K?C5HrOE@H5? ?@Hw@  2K?54@P4z0Hw@B y 2K?45@4zHw5 X(5_E 4| Hw5_ 4 X@Hb P _@\ *K?5_54yHwH5 ?a@H  5_U 4< Hr5_%Z \ Hy_0  @Hb5 S _@ RHa5 _ 5 < *K?6:_4yHwHu5Ua@H !"5_% !H5_ 4 H_ 4\ @H|5_  zHv5 _u  RHx_U < 0@K?6Z_}4yxHwH   @Hw5`P@  26@ @  _6B\7?yH|  C7?y7z^ 7?y K?B7(@Bd7?yB7?y0Hw K?C5HwYHK>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>k?7k?7?qk? Bk?k?K?47?q_ K? k?K?4_7?qB7?qK>K?@7?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yB7>B7?Bt7?!Bd7?ABT7?aB7>_7>Ⴠ!7c4$4%4&4'4(4 t!H4 \4 T4 BK> x@@@ Kz8^95YKn0$Z47?a_5PK>Ka<!K>@_ (!C7>Kz85Y^7Kn0 0@B$7>_q7>ዀ>@K0 @Kr<@ x@Ka?4#@_4z!45C4 4z^7Kp6kqK=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>7>_7?a7n7B5K>  :85  b ǓHXK>`25  } ǙӸ_5K?i!@K>\4x "Ka< Ku<<@ 5 x86162W@b ? 5Z_Q4 :K>T @K>  x  _K>62 R|@K> 6 5Z_4 ;@K>2 "K>  } `@45B7?aK>a57>A @7?A;Kn0@@;Kn05@ 7>ዀ;Kn0Ku @@B5Kz85Y^7@Kz8^5YB\7?57>_7?B,7?!47?_)7?!B7?!Kz85Y^!7Kn0Kv:wKn0@h@:WKn0B5Kz85Y^7Kn0k?7@ K_ B7Z(K?Y@7?k?ok?7?qBlk?!K?K?!_7?q#470C4 47?7^57?qKs @Ka?4:@^%k?#(479Cl4 K?^17K 7Hkx 7zp^7y7_M7h` K?hw(BD7?qK>@O?k?ok?7?qBk?!K?K?!@ 7?qKz @Ka?4:@^k?#74C4 K?^7K 7pkw 7zp^)7y7_74hy 4z(Bk?)K?)B$7?qB7?qK>@O?k?ok? K|< 7#_4yȜ@BD4y7B7?H}@Kz<@ Ht  R4zHx 9B7?H4@:Kw< Hsd  R4Hx7z7y4^ 7?B47?K>K? @O?4_ 4y044_ i4y047k?ok>k>k>7E7#k>6B$7?9H@H 7f Z ҙBD7?9H4cc@"H  _ H # 0N4c7zp^7?9 ڀ @Ka?4:@^}k>#47C 4 k>Bd7?9K>K>^i7Kd4ke"K>B|6`7?9K  J K(4^u7?aK>B7?a 7?9K>B |7(7?9B @4|K>YK>K>K>@O>k?ok? k?k?k?!7$B7H77`p4H _%@@_ Ӈ4 ӗ4 €4 Ka?4:@^k?1 44pC D4 K?1^ 7Kv 6΀Xkb 4 8Ā24 z4 W8Ȁ Z4 4B4 fK>K?!K?K?K? @O?4>@4 ̟}4>@Ɵ]4k?ok>k>k>7D7#B 7?B 7?9B 7?Y4B4yHt 4D$!7#7`44 C,47?74^ m4x7?7_u4y7B,4yH "P744C4 7?74^ 4xK?"j47?B@B7?9Bt7?Y4|K>YK>K>K>@O>44y@7?7?y7_%4y74y@7?YK?!K?a X84 (@K?^aK?Y04K?y 0zKa?4#@^m4z#47C4 4z^ y7K} 7`=ku 4_Ka?4#@^ 4z (449C4 4z^ 7Ks6v`kv 怂! B ]4TK?K? 8457?K?K? $(47?K?K? X47?K?K? x47?K?K? h4u7?K?K? EH4E7?k?7Kx47W`7?77v ""4kx7b7aX 8 K>`@7?k? Ka?4=@k?7kxk?^ k?K?Ks4k?1K?4 ks"hK?6y k?K? k? k?Ck?K?Kz7k?)K?kzK?7k?K? k? ^qk?K?K}k?!Kb4YkyK?k?9K? k?Ak}k?k? ^Yk?K?K?K? Kxkx6_7Kxk?oK7z W "7}04@47c w7y ? Ղ xKa?4:@^k? (449`C4 K?^7Kv 6k| K 4 WK?Y@O?k?7K "7?kwK?Y@7?Ka?4:@^k?#(479C4 K?^7K 7kx K?Y@7?K7w @k?oKvk?)47`k?1 H44Y`C4 K?)K?17?^U7l(K?l!bhh!d*d ғ048+`Ka?4?@k?^7K?k?"46C04 K?^7Kk?!7k?9^)kx H 4`+`P@40+`p4+`P4K|7kw7yK> =7z W Ԓ`047x  @@O?k?ok? k?k?k?!7%7B6H`7H $ Y4N&!" J4zB4H@"H '?4zHy7??@`@Hw 7x Dž27?` @  ǖ_7?7 z4K>K?!K?K?K? @O?4NB4zH4`H Bh4zH  "H4@* f H4D_ 4B4Ȝ4k?ok? Kv7$k?)4ȋVA7B7?QB7?qK?)7?Q4X_4Ha@H \ 4X!747?q_}4vK?YK?y 84 "K?Q^AK?q04Kd4k7x  7x 047a  7? `K>K? @O?Ka?4?@k?^7K?k?"46C4 K?]7K}k?!7k?1]kt@Ka?4#@^4z"46C`4 4z]-7K| 7kb k?7K<Ka?49@ `k?^q7:"h46yPC4 K?]7P+`^7:#47CX4 K?]%7Kw 6kx K?Y@7?k?ok>7C @k>k>B7?IB7?)K>4z_7?)4_ }7?)Kw4744A 7?I!"` @@$@k>B87?y7?yB7?IK>B7?y4B7?y7?yB`7?I4 B7?yK>7?y4^7?)B7?yB7?)B7?IK>YK>@O>Ka?4?@k>^7K>k>44C4 K>K>6?]}7Kxk>7k>]kzk?7Ka?4:@^k?#7@4C4 K?]7K 7kw K?Y@7?k?ok?KHKXb ` f r@(K`KHK` JKXC :@@KHK` KX#?@K?YK?@O?k?ok>7C@7$k>B7>B7>B7?4z4_ 7> h44ypC84 47?97^y7>Kt< 8+Kw4 4z4yA87?(@Kw4 4z4yA7? K?9A@@l@k>7>B7?K?9AzKx<04y@ 4y`7?Q^i7?7>B7?Q7>B7?Ku< 4yB7>7>Ka?4?@k>^7K>k>44yC 84 K>K>6?]7Kyk>7=k>]%k}MK?94yB7>7>K>7>^4B7>B7?B7>K>YK>@O>k?7Ka?4:@^k?#74C 4 K?]7K 7kw K?Y@7?k?ok?7?ik?!B k?)Cw< k?Ky4k?7?iK?)K?BpK?! `7Ka?4:@^yk?"hK?6y]4xKz 7]k} B7?i#Kz87]U7B 7?iK>@O?k?7Ka?4:@^k?#74C 4 K?]7K 7kw K?Y@7?k?ok? k?@`k?!k?Kw4K?K?!7A7x 7Ka?4:@^k?#470C4 K?4x?7]4Kw 6kx K>K? @O?k?ok? K7C (7$4K>K? @O?k?B4Cw< H # 7?AA<7?I ˀK>K?A ZKa?4:@^!k?"K?AK?] M6Kz 7]k} B p7?i"h46y`C4 7?iB 07@@7?i74^ 7?IB 7?iB 7?Iς]K>k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?a7#Bpk?qHC7Hb N 4D 24x "4N#Ka< #p@4%4&Ka?4'4(4 x4 B4 N4 |!Hw 8#Kv< K|<!5 x ( HP4X 5 K?q9B P7HwHw Y "5A /!BK?qH5bH  85? 885YK?qBx5Hw Ҹ 8!Hy.^@545C`4 57?75^4xK?K?qB7Hsn  b4@^ q545C4 5]7K} 7ku H@BHx ( 78 Kb<@K?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O? ?H5_HKt<k>k>k>k>k>k>k>k>k>k>k>k>k>7P7%7B7?a Kz84#]406^)4#4Ka?4'4(4)4 4 4 4 4X7?aBH@6B477^4"k?46:4^ 7?a 7K?i`j4@^544@B4 K?i5]7Kv 6k| Kz8K?i4]m4K?i`x4 @Kz8]-4K?a 84]Kz8K?i61_4 2 Kz8]4Kz8]4`6B4 (76:^4>k?Kz< "H  H 606^4=E7?aA\@Kz8]4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Kz8]4Ka?4:@^k?44B4 H 1 X7]K?Ke 4kf k?ok? k?7D7?Ak?) h44yBD4 K?)7?q7^4k?1K?q@@Ka?4:@^qk?!44ypB4 K?qK?!]7Kw 6kx 4k?qK?1K?)BH4K?)7_7?K?q @ȡ(Kz8 Kz8]4yKz8]4y0Kz8B`7?Kz8]4yK?q4_}@A7?K>K?K? @O?Ku4#KuH7w 7?Q#7, 4<&00N8E&E KvH6hktHj(KbH4Z0AD@KaHK?aA$4:0KuH4jPKxHk KwHjXKHk`AKzHK>4@O?k?Ka?4=@k?7^k?!K?!k?! H4K?k?4Y4 K?Bk?KvHk?Y7?Q#(k?K? 75z.7k?iK?!k?yK?7k?&q00N8E&yE] yKyk?Q7=k?qK?k}])k?K?k?ok? k?7#k?9A7?QA7?qKb<!PK?94y_7?QKc` 7?qA@4yA7?q4^A7?q7?qA7?QA7?q_7 Hc`?o7?q` 0@AD7?Q_U7!@A7?qA7?QK>K?K? @O?At4yHv^7H| 7e ǘ^u7?QA\4Hs~G+`Ht Y ǝ߯7?Q+`Ka?4?@7]7 (4449 0B4 4k?!77?QA7K?!4]7Kck?14e]kek?AKu=Ks= k?k?7KH7w 2K( _@KxH7?kyHK?Y@7?Ku>AKs>I k?k?/,ok?KxH4#KK 7k KwHKJ J  88 88KtH\ 88j Ⓚ0KaH0H6P60h"PK>K?O?@/0,K( jK6?@`0KHK(J7j5C_=K(4?KsH7d 7?AA"6/'A00N8E'IEI`>@_%@_@>@KwH7?A"6.`'00N8E'E>7K>"6/ _e@_@=@KH7?A T$@00N8D$HD H?u@}K>KH@KPk?7Kx Kw4Ђ@(@6k|K>@7?Ka?4?@k? kw7]k?K?Kt#(k?!K? 479 pkt4 k?B k? K?Ks7k?K? ks]k?K?Kxk?K|7kk?)k?1kx]k?K?KwKu=Ks= k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?yKa?H?4$47e4@444 4 X4 D4 v4 x4|4R4P44H#B Ҝ q(C  BKy< * `0\Bw`0\w"@ | *" Ӽ q(C  C_?f j` j8P@k(l80@m(n8@o(  CA?_A4Ā# b4C R4w B4x 24y(g8@h(#  C<ן<f(r  CCz< Uu  Bֿ4c4]E@K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?_]4zH]i4z%H_4z%Hk?ok? k?k?k?!K?7#7Dk?1 4\7E "Ky< @Kz<(: 84K?1A 4 Hx`@ z7g bK?1A 4Ht@84  @ K?1K?1]7z"@7H(YzKv BAT7z"hKz86y] Q7(+ HKz84Y] @Kw< H(4 2 zA47?yH A 7?yA 7?yKz8 (49 ] 7A7?yH(}h@A K?1K?14^4yA4zK?14]4x4_a@ xH("h6w 44j 9  H_74ˀK>4 @r Z4 <* R4_4y0@_Q@@_y@ςpK>ٷ4@@4444 X4@P@p4(44 X4@Ka?444X@h@4P4 44H4(@4P@44+p@@444@448@440444 44`444h@84x@4 48@Kw4!Ky<4kz<4@4ςK>^e@ςK>_@ςK>4#@]m4z"46 B4 4z]y7Kv 6k| 4K>K?!K?K?K? @O?]4zςK>4y]4ςK>4y]4ςeK>4y]]4ς=K>4]54yςK>^!4yςK>4_A4yςK>_4yςK>4y_4ςK>4y_4ς]K>4]m4xς5K>^4yςK>_ 4yςK>_ @ςK>_!4yςK>_@ςK>4x]4ςmK>^4yςMK>4^4yς%K>4y^Y4ςK>_4yςK>_4yςK>_q4yςK>_@ς}K>4y^4ςUK>^q4yς5K>^4yςK>^4yςK>^)@ςK>^a4zςK>ςK>4y^4ς}K>ςmK>]4zςMK>^E4yς-K>^4yς K>_@ςK>^ 4yςK>4y^4ςK>4y^4ς}K>4y^]4ςUK>4y^54 ς-K>4y^ 4ςK>4y^4 ςK>4^4yςK>4y^4ςK>4_ A4yςeK>4y_ 4ς=K>k?o7Ck?A7?q7?qA4y7zk?K?]7?qA7?q@y : `7@A7?q b?4cK?K?]97?qA7?qK>@O?k?ok?7x5K@ H@7c57d5  `_4 x?4cKy< h@7}41K` H@7c417d49  `_4 x?4cK?YK?@O?k?ok? 7C4k?qA`7?Q@ J4z @A7?Q4c@ ?@7zp\7?Q7^7h` K?q7?QAh(K>K? @O?Ap7?@x 24cA7? ` ?4c#47! B4 47?q7] 7?A7?+`Ku>Ks> k?k?ok?7# k?44"pB4 KxK?\744%B4 K?\7` 244(B4 7y3_7\m4zK?YK?@O?k?7#47(B4 Ky_m7Ka?4_}4: K?Y@7?@P@K?@ @Ku>aKs>i k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k> k`7} k?7Ck}H4kg7$4)_4 4) 4)0B5Bp5HkzB @47y\47y\u47yp\]4A7z4)pk? 7w9k?4zB4$@@4(4)4*4+4,4-#(4.7/4v4? Ka?4: kz84'_@Ka?4< Kv8KYK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>KfK? @O?k?ok?k?k?7C7$7A6k|84?kc0k`kd(ke kfK?YK?K?K?@O?Ku>Ks> k?Ku>Ks> k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?i74k?qk?y_k?K?y_7HhK?74z7$:4'Ka?4)4 \4 @4 t4 4HKs0!5Kt(!HaZHw Ҹ x( :5A @ 8 x(0`HbI? O #P ߈ "Ha /  ( Hx5@jI?Hv#h  <ߋ?HxHzO Ӱ ( 8wHu`H|  85HaHw Ҙ x( :5A@  x(0abH W K}0 Ks(!* W85K?q ] E4 `@H|  :HzI?W ! ߓ04HvK?y ] 4 ZHp  :HaI? 7 !` ߓ0!R4A@4zHhK?4z 7<Ks004K>K?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?_@5@_@@_@%@_@ hk?ok? k?k?k?!k?)K67$7CVak?1Ka?H?H4%"X  | *HC 4 4H!rH # ҙ4cAK?1HA2HH !H ߈ 2H# Ө4 4H 44HH y4cA K?1HC@jHH!(  Ӽߋ?HH Ҩ(8O+`H<0 0@Ha`H 0L4c4|K>K?)K?!K?K?K? @O?_@@_m@-@_M@k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Y7#Ak?aHB7Hh  4D b4xW "K|0 @@Ka( *4N"x@Kg0"`@4&4x44 B4 4 N4 |Hw "4 8 ( HH4 8 4 K?aҹA6Hw 9 "4@ Y. ApK?aH4aH  85?K?a85A4Hw  8 H|^@4H@rHt >5@ *K}0>HwKs(`>Hw Kz0@=Hw4K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O? >H4^4 Hw4?  8 M4 Kx0 B = 24 K?a@ H=7  Sn= K?a@5=Hk?ok>k>k>k>k>k>k>k>k>k>7D7#K>k>6@74A4yHwF7DH4 4 N*$z 4 āx j4 Z4 ⁸ J4 :4Ѓ *4 4Ȃx 4#4@(04X&4D%4v%4 R8%4 PX%K|0 4+Ka( 4xX%4 |%z4 x4 | K>@44H %* 8%@( 8$@ 7( W8$Kx0 Ky( ?O $?7 4dz4N?( J4@_(0:4X$* $Kv($ 4N4 @4 XH (  K>@4Hw`jH  R K>ѹ@L4Hw@H L? # @H ҹ4@K>HsdBHt >@ ( "  8">HKy0 "bKz(@>gHH4Hb D 4J? @Ku0 0 44 A4 Kv47?a74x7K?a74 \%7?qK>@7?qP44D j4x (+`Kv0 BK|( 0@Kx0<]4)4N@d4DK>4_4yK>7@$4D04K>4_E4y74K>YK>K>K>K>K>K>K>K>K>K>@O>k?ok? k?k?k?!k?)k?17D7%k@ 7A7C(h0Ha4pA@77@D54(@,5:@4H4@4474_m5H@!@74@4H h7H`RH 4z 2k?4458_47@5H07A4H hh4@4H 6uh 7 g4 H^4pKh( A 4p7k?A@L7@<4(@,4HKv   H 4G 4 0K?A@4H04AP44 ?hh f 4K>K?1K?)K?!K?K?K? @O?Ku=aKs=i k?Ku44_ 7?y7@474z_4K?`4Ka?K?y4%H!  \ 8@ _ӚK?y d K?yK?4$_H@7?yKz874xA`7K>4 kt4K>K?)K?!K?K?K? @O?44 `A 4 K>4z4_ 4EK?_@uK?yk?ok?7$_56H`bH\ ӳc BK( Kw "Ky  4 87K?YK?@O?k?ok? k?k?K>7F7%k?)k?1_4Kx  x74 bf H4y?  :44L K>@ 4Lp4|@K?)K?1A7?4LKP H7(@ DK>4|K>K?K?K? @O?K>K> (k?!K?)@64|4@ 6K?!@K?)M4|Ku>Ks> k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7D7%K=k>7>4@k>H4mp4K=k>4(Ka?4)4 L4 ! 4 ?4RH Z#2@7>Kb('5HGZH X'Bk?4N4K>k?54k?_7>HH6@ 4H ,7'+4pA@77@L6@<6Z(6QH@$6:C56jMh_}4Ka@48kx@75 \7?A6:@7?A@ d6K>7@ 6X+6C5@ 4H *7>4p HH&  ҜH O _ 7?SK>5*76?Kh&H@K?@ H4\"5 X80@ X0 R5I@@ ?5 H&H 8&rH5FZ ӳ8 0@ X05Hx@ T?5XH$I?$: ߀$I?H$(  Ҽ=oI?HO 7W?4P# 5`b  R @l4H5@ H ? H ."BHKs0 Ky( =@I?#@ | 2H/ 4 4H=e@ BKb  2]=@H5?Z =@K> zH5 `bH/ 5]4  0@H 4@ _(0W@|7>Ka 04H 7Oӹ@,4 Hk?K>47>k?_]k?H#( 479 A4 hK=ىx BKx5 \97?7?@4H5 ;K}(4@$44L@ 4H_y@@\ @@_@UHKP H7(@x4`Hk?@07>k?4N5k?K>4_}7>H^ @4Nk?4K>5k?47>_k?HH 4D @Kx( B4N 2 9@45w ZKz  JH5a w!4@4H!Z4z!JH5WA2 4zy!@(7>54_)7>7@\7>K>@7 R4z@44z@44@7>HKP "50@4XH4`@840H @45HR@@7>р 4eHd@ 4K>4@7@@4@04z(@ 4zH_4z?u44K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7F7$K=k>7>@pk>k>K>k>I#( (k>@4zHHc`?@K>IE( BHh@0@H @Hh@Kr( 4#H`H 4\ k?A4p7@@7@04(4H@54 ?hh4K>H( 45h(_474@4HC7H ъK>K#K>5 (k>4X4@4z4 D4 v4 R4 P4 x4|4N6 ! 8h@ =( ]8H@ }( 8*Ky0 Kz(  ( 8@Kz(@ ғ 0 87d2  8 @ =( ]8 `@ }( 8 B (@ ( 8 @ ?O7CzK|0#j #Z4k>@x7>64_y7>H< H$7K>@7>J:0@ D7$7k?62H@6Z466X_!4K>J3P7`Pk>7Kx(%B6@47H@*H =K><6Kl( @@7>Ks ` 7y;q`07y;7>@@K>@7>I0@ 77H@h4" K>6 \7?a4@7?aK>k?4k?K>KX(K>_KW0"Km( RK>J( 86(HK@#K7?H@07>Kb4DkdH4K>"  Ka( "A H4p7@7@p4(@`4H K>4?K( 8K>JJh H6J?@74hhk?4H@ 6:6864_i4HP`7K>6k>HyK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>! 450A 4 EK=H 86 (0:@H@ 7H@ x4:(H@ `7HH_KEʅ Ku?1Ks?9 k?k?o7hd? he?hf?hg?!hh?)hi?1hj?9Ka?H?7Hhy?ACZ76"p4&  BA4 *4 H? K|("24 \""HA"h5 <߈ "A4 4H j4 4 HH4"@ \ߋ?4@ ?( _8  5]K?K?~4p > k?k?757_5X I  @A: `5(H!: Ҝ  _z  @?5Kz8@59 7ˀ(4~^9@44~Hb>Hj?9Hi?1Hh?)Hg?!Hf?He?Hd? @O?^M@@^-@H_@@@4z?q@ r 0X@ @ 4z?q  0 4?@k?@@Hz?AHw?A44y?q_4 @84z?qH> ς=4~k?ok>k>k>k>k>7C7:K>k>74@ ` 4p7@87>`04K>45^=7>郀"@@7?@7?1@7?Q44_)7?K?"`7@@k>@ 07?K>7@7? #@7k? 4K>@pk?q4@ 4H` 7H X!k?K>7>7? k?_K>"X7x5 B4@ p4HBH| !@h7?QH Y@P7?Q4k?K>7>7? k?_K>!7!4@ (4܁H44A4 @544A4 5 0D4`  4D`>M@k?444_Q7?Qܞk?@ 4H7@"H ??e@@K>@07>45K>YK>K>K>K>K>@O>Ku?!Ks?) k?k?ok?k?k?4<7$"A7C7e f@@6z f@֟7} K7: K 7 a d | `K?YK?K?K?@O?_m@+`k?7_m4 K?Y@7?KX7KW KYKZ @zk?ok?7$K9@p7CHHw H_HHHy 8 hzK?YK?@O?k?o7?KYKW8x@ ֿ`7C<|@@*79:z@׿79_7?q7?q_4y_-4zK?qK?yhaK?hsK?hthbK>@O?@@k?ok?7$7C_4HwHx6 h$K?YK?@O?k?ok?7C7:^k?74z_7HHw 4_}K?Hx  hyK?YK?@O?k?ok?7C7k?_57HHw 4_K?Hx  hyK?YK?@O?k?ok? k?7#4k?!K:@@4( 0 @K?![4 Hx 840[K?!Hw4_4K>K?K? @O?k?ok?k?k?K77$3`k?97E7FH7? Hy`p$ H6hHz4D_HK?YK?K?K?@O?\!4Hzk?o7C_4K?YH|@O?k?o7C_4Hw6?hK?YH|@O?K?@p7\K7 Y4@ (2 :7@(@ 9 ( 0@K?_`p7\K7 Қ4@ (R :7@@ Z (@0`K6 `0X7@jK7 94@ (2 :7@(@ ӹ ( 0@7w@7?@ k?o79?y@WW_!K?Y \@O?44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"h06}H : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#047^4K?Y4|@O?=7?4?#07 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#07X 7C7:_ 4` C4_Ea C ^4Y@_] # C#7 @_% h C_`H C"6@_ c C#7 @_  C_` C#'76_  C_ ` h C#7_m 8 Cz0K?Y"h046z^4K?Y4|@O?Ku?AKs?I k?k?ok? @ 4hKyK? @O?K?@\4Ha8k?oKTk_87C` 7ZHx0Hw `:H}@ _ 4zK?Y@O? hs hs(Ku=Ks=  k?k?ok? k?k?k?!7SC:7#44 H79ֺ 1   Ӷ7 @?79ן 1  D JfJy 4 H P4H$ H_u4y b4H?@44K>K?!K?K?K? @O? H  H  m4k?ok? k?77E7$7?_7? P4 h8H04H( 4ABH8H h8H(_ h(H 8@`?H@ 8``HH0 ?H( a  xh( <`h(H(h H8K?K?JK?4K>K?K? @O?@0@H8k?74_40ˀKK?Y@7?CW 07\ *7C?@4@k?ok?k?4?KwhKxpKyQKs>Y k?k?ok?4$k``Kyk>k>k>k>k>k>k>k>k>k>k>k>k>k>K>4'k`7$7k? 6 4%KtYK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ko<9 :7?Ka? H#04:@ZM7@^aKz`Kn` kl`@0tt4~4k``4k`K?!K?K?K? @O?k?ok?k?7$KY ! 7C K=@xPK%(Hv@HzH 7 @wP7: 7@wP`wP (4$w@xPK:D_@xP J d dK3hs yK?YK?K?@O??K?Y_a@K?Y@P@K?@ @Ku>Ks> k?k?7Ka?#049@_7Z 5Kz@O?@P@K?@ @Ku`u@ (04<PH|ˀK>ˀK>ˀK>ˀK>KehH jK_4`H@HH (@K_4_@H x H|K>K?!K?K?K? @O? _ : W ]  SV@ \CT x4@ӿ< 77Z<  @?@@Ku>1Ks>9 k?Ku=!Ks=) k?k?o7hd>he>hf>hg>hh>hi>hj>hk>hl>hm>hn>Ka?H&7$7H7 %4%0KhE@  ˀ84~4 !0M5Ph44~Hb>YHn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>˄}hmhk?ok? k?k?k?!k?)KG7C k?1@4zHc`#Hh( H0"jHf$4HsHw d Hg$XH: G_K?1DRĄX@H}7G? ܋ #D!HHt( Hu0 刀 6# @#*Hx7G? Ջ#D?Ht(Hh  Hh#Jz H_K?1?-HHa Hy' Hc "Hx C HwH Hh!J H_K?1>HHb H}G Hc!H C ]UK?1K?1_7Hs(76ymHt76y?Hb0E7 E 7@=Hyˀ8K>Hx Hc!H CK>K?)K?!K?K?K? @O?ˀK>_@\E@_@\@_@\ H _@\E@_@\Hˀ K>_m@\H_M@\ H _-@\@_ @\ G @4ś7 Ş'H| ˀMK>_@\% C L҇L HzH ZD:D  "0@6#0@7 #(0@7< 0#H0@7\ P#0@7 p"h0@6| #0@7 "0@6 k?o h0k?_ 4z  C @_ 4z  C `@_ iK? C 0@_ 94z  C04|K?Y@O?C8X7? (7W6 ?7@6?k?ok? k?k?@ 7E@ 8Kc<(04$4_94 @(04$`kd<]47_-k?! 7K?!4^y4kf< ^a4zK|K?K?K? @O?k?ok>k>k>7#7]k>k?K>4k?7z7k>k?k?k?yk?qk?ik?ak?Y@k?Q!7@ @4z X7]47_4"`74z4^4k?Y7?7? k?7?7?!k?7?7>k?7>7>k?y4z@k?K>]7K>k?47k?QK>4k?K?k?K? k?K>k?yK?k?qK?k?iK?!k?aK>@K>! 7Ƞ4H @@4H H 4 `4 KX @@ J 4c ? ``4@44K>YK>K>K>@O>H @@4H jH  X4 K_ @x@ K:@  ?4?4]4z4 _ : W ]  SV@ \Ku=Ks= k?Ku>qKs>y k?Ku=Ks= k?Ku?Ks?  k?k?ok> k>k>k>!7D4@KZ@" _4"p77>_4 K>48bb@_K>7" K>4g44_4!@ _ _4H B4% # 7 *!_U48 !H7 H(4 !hHz"H!hHz H!hHzH C   !`Hz H C h !XHz(h(H!XHz0 Ch0Kg<40kw<_4K=_4K=K>!K>K>K> @O>]54zK=_@\}@_u@\ _U@\H_5@\H_@\h(_@\ C ]U4z]E4 Ku=Ks= k?k?ok? k?k?k?!Kd;4%7C4&4tk?qKx<!:4Kk?q4K>K?!K?K?K? @O?k?Ky7?q_4>K<KKu=Ks= k?Ku>Ks> k?Ku>Ks>  k?k?o 7hd6he6hf6hg6hh6hi6hj6hk6hl6hm6hn6ho6757$K?K?~`4`  ~k?k?7Y77^y4#0 7 ^Q4 (049 P\4#P7DvF04Ka?4&4'4(4 4 F44z7q_4%H@u7q4k7q"Һ ߀ H@H5kA}"Ӻ |ߋ?5kA _85l5kAbZ zH"B ߈ RH5kA|Ӛ@ *"@ \߃?5kAa ` 5kHAx! Ѽ߀ BH5kAv! <ߋ?5kA|#25m5kAw rH!b <߈ JH5kAw@ "!: Ҽ߃?5kA!* `5k0 iȀ04_@-@_@UH_@@_@H_e@%@_E@EH_%@@_@H ` 5kKy!Ks>) k?k?7KZ_K9K?Y@7?k?ok?k?7#7D 84] 47  `?44K?YK?K?@O?k?ok?k?7#7D h74 44] I@7 `? ?4K?YK?K?@O?k?o X7\ x4_77x7K?Y 04K?Y@O?"}6vT"6*  " < 6"6&g?  Y p _ 4  @k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=64 k>4K=ak>K=i]k>K>K=q K=yK=K=CCK=4xk>cC 4yk>ǃC 4 `_#ª]57J (@^%5!e6 J?@R4K=Y ]a56O _ 7#7K>K>5^14^K>K>4t_%566? 6@ 4CC*cCZǃCq> #ǣCr@$"K>7@ 5J>M@$jK=Q`$ZK>_K>7_4z@7>p֟t&a&i8G&qFq _ !4:(#7P64ǣ@ 4@ `4 @47`4 4eK=Y]5zM7]5ZU7]5:]7]i4%7]I457])45746K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>47@5ycܥ@4\7@`5Yǃq>4\7@(59Eq>z?@ V47@5ǣr4V7@4r4X77@X4`47@ 4eK=Q]56K>_K> 4 @K> @K> (K>J I K>K>_]4 0o4oAj6 o!:4  40 ! Ǐ@K>K>_=4 7k?\6Zk?K>76Yk?5k?k?yk?qk?ik?ak?Y_k?Q - K>6X_uK>5?575?~@6 M k?ok? k?k?k?!k?)k?17$7C4 4Ka?H?4'4h " <߀ : 4! \ 4"?5 4 _5!7!4 Ka?4'H `Ӻ! \ 0@ `]!Ӛ `@H `!2 < `  4?%4c 4K>K?1K?)K?!K?K?K? @O?\@H\@H!(059 `@H4ܞ=@\@m@Y@C8X7? (7W6 ?7@6?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK>76K>7I4K>4 K> K>y ` @ :C_ 4 4 r4V_ b4X R5)A? 8 (@ ( _8 ?5)K:: _4K?IK?AK?9K?1K?)K?!K?K?K? @O?? crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)? crt0: errno: tsd????;;J@J J@J8J@J@J@J0J@J@J@J@J@J@J@J@J(J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J J@J8J@J@J@J0J@J@J@J@J@J@J@J@J(L`L L`L8L`L`L`LLL`L`L`L`L`L`L`L`L$L`L`L`L`L`L`L`L`L`L`L`L`L`L`L`L`L L`L8L`L`L`LLL`L`L`L`L`L`L`L`L$?;;?;;&0 05'0(001 -#0+000 0 73/")%0,0*000000 0 006420.$!D<DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDPDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD@DDDHstrings size %8d : %d redefinition not allowed the %c operator cannot take non-absolute arguments. string where expression expected. can't find primary in expression. misplaced closing parens. attempt to divide by zero. can't add two relocatable expressions %d%sunreasonable nesting. %s:%d %4d.%d End of file not at start of line. Illegal base character %c. %s radix is %c must be one of b, q, d or hsize must be one of b, w or l, is %c. %s , datab repeat must be constant. datab data must be absolute. .fill %d,%d,%d align needs absolute expression. .align needs absolute fill value. .align %d,%dres needs absolute expression for fill count. .space %d .global %s LIST.list NOLIST.nolist .title "%s" .eject LIN=form LIN= needs absolute expresssion. COL=form COL= needs absolute expresssion. .psize %d,%d % operator needs absolute expressionmisplaced ( . misplaced ). .instr needs absolute expresson. need absolute position. need absolute length. EQUASSIGN%s: %s: END missing from end of file. .ASSIGNA needs constant expression argument. .ASSIGNA without label. .ASSIGNS without label. Can't find preprocessor variable %s. 0Comparison operator must be one of EQ, NE, LT, LE, GT or GE. Comparison operator for strings must be EQ or NE Conditional operator must have absolute operands. String compared against expression. AIF nesting unreasonable. Multiple AELSEs in AIF. AENDI without AIF. IF nesting unreasonable. Bad format for IF or IFNC. AENDR without a AREPEAT. ENDR without a REPT. AWHILEAENDWAWHILE without a AENDW at %d. .AENDW AENDW without a AENDW. AREPEAT must have absolute operand. AREPEATAENDRREPTENDRAREPEAT without a AENDR at %d. .AREPEAT %d REPT %d .AENDR ENDR .ENDM without a matching .MACRO. LOCAL outside of MACROmacro at line %d: %s macro expansionCharacter code in string must be absolute expression. Missing > for character code. .byte string for SDATAC longer than 255 characters (%d). illegal character in SDATA line (0x%x). Must have absolute SDATAB repeat count. Must have positive SDATAB repeat count (%d). rUnreasonable include depth (%ld). Can't open include file `%s'. Unreasonable expansion (-u turns off check). %sORG command not allowed. Invalid expression on command line. alternateincludecommentcharcopysourcedebughelpmrioutputprintunreasonableversiondefineUsage: %s [-a] [--alternate] enter alternate macro mode [-c char] [--commentchar char] change the comment character from ! [-d] [--debug] print some debugging info [-h] [--help] print this message [-M] [--mri] enter MRI compatibility mode [-o out] [--output out] set the output file [-p] [--print] print line numbers [-s] [--copysource] copy source through as comments [-u] [--unreasonable] allow unreasonable nesting [-v] [--version] print the program version [-Dname=value] create preprocessor variable called name, with value [-Ipath] add to include path list [in-file] Report bugs to %s %s: Gnu Assembler Macro Preprocessor gas/opt/binutils/share/localeI:sdhavc:upo:D:MGNU assembler pre-processor %s Copyright 1996 Free Software Foundation, Inc. This program is free software; you may redistribute it under the terms of the GNU General Public License. This program has absolutely no warranty. w%s: Can't open output file `%s'. %s: Can't open input file `%s'. Internal error, aborting at %s line %d in %s Please report this bug. % operator needs absolute expression%d$NARGNARGMACROENDMunexpected end of file in macro definitionmissing ) after formalsmissplaced )LOCALLL%04x-1confusion in formal parametersmacro formal argument does not existcan't mix positional and keyword argumentstoo many positional argumentsIRPCIRPENDRunexpected end of file in irp or irpcmissing model parameter,%d<\hLT|ňŐŤDLŐxpxpxxxxDx,,Dx,, x x xxxxhh\ Ǭ8ǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬǬƬǬ ǬTdǬǬǬ|njǬǬǬǬǬǬǬǬǬǤ./../bfd/libhppa.hexistshash.c--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument memory exhausted %s%sCannot allocate %lu bytes after allocating %lu bytes /opt/binutils/share/localemessages/.moCPOSIXLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_ALLLC_XXXLANGUAGELANG/locale.alias/opt/binutils/share/locale:.riso !@!!P""X"" "$"8"<"H"$$ $ $$$$$$$$4$8$8$<$<$@% %%% %<%@'|'+h8+p+++++++,,, ,<,@,\,`,|,,,,,,,,--- ---... 0\0`00010112|23(3D4$4(444455567X+7\779999::;)<<4)<8= =>|>????@@ADAHAAAABxB|BBC@CDCD EEFFGhGlK(K,KhKlKKL L$L4L8LHLLL\L`LLMMMMMMOOPPQ\Q`Q|QRRRRSSSSTT U4U8WWXlXpXXYlYpZZZZ\\ \,\H`0`4``bt bxd dddeeflfpg8g<ghglhhiij jk$k(llm,m0n,n0nnnno<o@oPoTppqqqqrrsxs|ttuuu\u`uuvvwwx<x@xxy8y<yyyyzz}4 }8} }8<`|PT $$@"" @D04`d8<TXLh4h<@ $D$(hl    x| (D   $ @Pl$(@DhlX\`dX\X\hlŒ¼Üàôø(,LPĄĈ (,@DX\dhlptx|ƀ04@\@Dptdhtxˠˤ͸PT04<@`d(\܈ܤL݀ (,DH8   $(04<@|x    04HLT X 48dh "P "h 1 3, 6 ? @ C C R \0 d  (  P 8 P  , ( T  D ͼ , D ܌ P h       @$Revision: 92453-07 linker linker crt0.o B.11.06 981204 $/usr/lib/dld.slERROR: mmap failed for dldERROR: mmap failed for TSD1.2.yikes!.long.short.byteEQUALTERNATEASSIGNREGORGRADIXDATADBDWDLDATABSDATASDATABSDATAZSDATACRESSRESSRESCSRESZEXPORTGLOBALPRINTFORMHEADINGPAGEPROGRAMENDINCLUDEASSIGNAASSIGNCAIFAELSEAENDIAREPEATAENDREXITMMACROENDMAWHILEALIGNAENDWALTERNATELOCALIFEQIFNEIFLTIFLEIFGEIFGTIFCIFNCELSECENDCMEXITREPTIRPIRPCENDRbug-binutils@gnu.org@@@@@@@.@/@0@1@2@3@4@5@@ @%@!@6@7@ "@H@P)@`@h@p@x@0@0*@0+@0,@0@0@0 @0 @0 @0 @0 @0@0@0@0@0@0@0@0@@ @(@0@8@@@H@P @X!@`"@h%@p&@x'@#@0(@$@)@-aIcsdhMopu(v0d$NARGNARG@@POSIXLY_CORRECT: @ @ !@ ?@Hhd?DH "hR6113,(ͼP0CPD\0,,`܌T("PC@P,@@ @@101Hbinutils/binutils-RUN/opt/binutils/bin/gprof010075500000000000003000005000000732753203500200060ustar000300000000000000@';@,Xdd(Gp(N @`8'8  92453-07B11.17;^ 92453-07B11.046g0@ X"LX tX!''X iiX 8@@X H]]X I^^X X^^(>(`@`>(`@<>( `@P>(`@h>(x4@(4t>(&y@) >('|h@,h>((|@,>(P@,L@>(R@-(Y N? ` @>8@0 $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$yZ /# X T hT<p(Ohů;A8v˚v)8XDg'VL/v'6!xyu(!xD!xry 4X'51Pנu R`aDRg6mTLL''̃!xT/} H(24!x݌/"j)!xXkk/X\T !x/P )'6YY//] &hŒ! '/!x/Bj+ 4gyh!xng@tfAU)qV\lGɘ 0&h ƿp"BY 3d˱lv<8ƊM:?f˪ƥ?A˚v8vhů;An bRY;tltD8rP.Y;2Y;Y;'FNU_fkry!(/9AGPW_hou{.AYcn!*4=KYbk  $("0*42l:pBtJRZbb/tmp/libtool-18374/gprof/opt/binutils/lib/opt/binutils/lib/libbfd-2.11.2.sl/usr/lib/libc.2_tepv_ktepverrno__ismt__dld_loc_hex_valueoptopt_SYSTEM_ID_CPU_REVISIONopterroptindoptarg_FPU_MODEL_end_environ$RECOVER_END$RECOVER_START$UNWIND_END$UNWIND_START$ARGV__text_startfreadmemcmpmallocfopenstrrchrsprintfstrcpysetitimerstrcmpreadstrchr_startfseekcallocsysconftolower_isdigitfclosefgetsbsearchfgetcfprintfexitopenrealloc_isalphastrcatstrncpyfwriteqsortstrtolstrncmprewindstrdupstrcasecmpgetcwdgetenvsetlocalestrtoulfstat_isspacestrlenstrncat__flsbufprintffputsfputcstrpbrkatoifscanfperrorsscanf_isalnumfreestrstrstrcspnclosesbrkabortmemcpystrerrorstrspnmemsetbfd_get_section_contentsbfd_get_errorbfd_get_archbfd_check_formatbfd_printable_namebfd_get_section_by_namebfd_openrbfd_errmsgbfd_perrorxstrerrorxexitobjalloc_create_objalloc_allocobjalloc_freemainhex_initobjalloc_free_blockfnmatchdcgettextconcat__d_trapcmp_bbannotate_with_countcmp_ncallscmp_topocmp_totalcmp_namecmp_arc_countcmp_fun_nusescmp_timecmp_addralias_compareerrno__ismt_ktepv_tepv__iob__SB_masks7!?9" 7]!9ӽ9Y4!:ӽ9Y4T ;|ӽd Y"ӽ9"ӽ@>B! @ Z A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  a@@@ @7]]@]2@@ @] @@ @@ @ @*@ :7!?9" : B*= @ Z ]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]` =@ :7]@ k? k?k?XZ]XZ]XZ]XZ]d@"Z]> ZZ]> ZZ]9 Z8 =@Y :Z @Z@ ZZZ] ZZ @"ZY :ZZ@= ZZZ@= Z ZY :Z]ya: =]: =]  : =@4ZBu ZZZZ ZZ]ya: =]: =]  : = @4ZB ZZZM ZZY :}@4Be]yZZ5@*Z@ya AZ@ya AZ]ya A @Z@] Z]: =] y a: =4Y(ZYY8Z@] Z]: =] y a: =4Y(Z YY8Z]Y Z @*Z@YA AZ@YA AZ]YA A @ ZZmZ@@K?@ @Ku;!Ks;) k?#a7{ 7 kckx'y 4yEe'y7D7%767+4># 744445 bנZRkeke (4Ц @Ц D(43 H?(ਃ 43 ` 7+4>7D7%7744z#(p74444@H@7D7%7# *p7444Kx7D7%77Kv 2474444#.@7@@@@ 7K?@ @@@@k?7k?#N k? 7Y Pk?4@4 @@K?K?7@4K? *@K? K? 7@4K? rKa?H:@7?!# 7 `4@(4@x7?!7?!7@4#. 79 p4@4Ka?@ H:K>@7? 44@B7?@B?7?B?@k?ok?7?" 'E' 86 00.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?ok)4`@44` G>- "" 46 _4K>9K>Qk<+H<K>i *K>y4ߟ444K>IKa_k? k?54@h44? 7+ N 4Y 4:`_4h4k?4K>a5k?4@44?"p74@4K+k>44k>Kxk>v k>+H3k>+4'k>y 4 c?+K?4=k>Ka?43k? Ka?44k?֠ k?Ka?45k?7vk?1+~4<!0k?!(k?)# 7 4_47=)" 6 4_4G=-+" 6 `4:`_M4_+"n 6y p4:`_4 . 49 +4:`_4] k?)Kk?9k?A k?Ik?Q@k?QKqK>AkfP k?q( k?4?k?(0k?47 k?k>  k>7u Pk?y7>7>444?}7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4!4! <4?@@k?7k?#N k? 7Y k?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?!# 7 4_-4@x7?!7?!7_4#. 79 4_4Ka?_H:K>@7? 44@B7?@B?7?B?@k?ok?7?" 'E' 86 0.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?7Kvx+~ H4?44477K?Y@7?K?Yk?4?k?474_4$4?7 k|_M@eK?Y# +7 4:_M4%K?Y@P@K?@ @Ku:Ks: k?k?ok?KDH PK#Hw :K_uJ JH Hw (@HHw2ϟK?Y K?YK?@O? 4K?Y@ @K?@ @K_ K7@4 @4?K0J0 @4 @4?K J @ Ku;Ks; k?k?7_k? * @_K??@K?Y@7?Ku;Ks; k?Ku:qKs:y k?Ku=Ks= k?Ku=1Ks=9 k?/'0/'0/'0ok?ok? k?k?k?!k?)k?1k?Ak?IB7?Q b" 46K4 KxKa?K?I4:@_%7C \4KuJ7?QKP!7k?QKs8q` 4#_EK?AK?Q Ch44%4&4'! Ki8q K?A7?i4_u4 @K?A7?a4_=4 X@_}K?A_mK?AK?A7?y4_4 @_K?IC4xK8K?AB7?a (@K?AB7?i @_uK?ICL4K8!0@K?aD7z`!p7Ku8ƕBI6 k?5PK?ik?K?aI8_I7K?a457@ 8 "7@K?QK?a X5< K=K?i h!Kw8! R4kx8!45K,4 KxKa?4:@_U7K?Q4|@K>K?1K?)K?!K?K?K? @O?k?ok? k?k?k?!Kh4k?1Kwp4#hk?9K@4 07@7`@8 @?77  K?1B4 (@K?1B 4 @_K?9C4KdhKupKp4H@ 4@4 BK?1 (@ BK?1 @_eK?9C<44` `?w Kp4/4K>K?!K?K?K? @O?KuK?9K?1K?)K?!K?K?K? @O?" _6@+`44K 4 Hx744K 4 7@@K?@ @Ku:Ks: k?Ku=Ks=  k?Ku:Ks: k?KuQKs>Y k?Ku;Ks; k?k?/,opk>k>k>k>k>k>k>k>k>k>k>Kdh4#KnpĀ@4%H H KV@rHD7z@ :Kl@ @@HDp7zX @H HKhp4E@Kd9A bH`:IX h(H4 _7H?@KdhKmp@4%H!zK !jHDP7z@ :Ki@ !8@HD7zX!@HH0HK i hSHH 7_?I( $" dI474  H0K0 k0HH 5?H( <Kgp4U@Kc9A`$@4$Ka?4% 4&+" 4'6/ 4(!. 7?a7kHt$Ks8 Hu#k``H (4 4zk`hC4w#7K}8`459KH4 Kx87_}5+Hz(Hy4_ H7 0Km8H h7 ``4H( BK0 2K 59@_55H(_ mHz(h`(459`K04 7_m5459K4 Kxh7_-5459K4 Kx`7_5459Kx4 Kxh 7%a%i100N 1&nH@H;@H0H0 Uh01H_5459`K4 Hx7_5459Kh4 Kwh P7k?AHzk?I-A%i000n@0H_5 @_}5Hc`;@K>YK>K>K>K>K>K>K>K>K>K>K>O>@/0,k?ok? k?7s`k?)7Y7k?!DH6zK?!K?)D(7"E0b+`KhJ@(@*4>Q(@@(4>Q7z4D4 @@Kt @7z4D4 H0 h0Ku8uJ#047K4 HH7_E4w44@x4xK>K?K? @O?k?7k?k? B7? BK?Bx7? @K?B7? b"046Kp4 KxKa?K? 4:@_7C 4Kx88*#0K?K?7_K?K?K?_K?K>@7?k?ok? k?k?k?!Kdh4#k?1K}pxk?9Kp4% 0H!24B@K?1 @HK9BK?1 X@HKYBK?1 (@HBK?1 @_!K?9C4Kx882HH40JK_HHH>4Kp4䞥@K>K?!K?K?K? @O?k?ok?k?k?7#@ `087EK|8(4$"0HHx_6`H HwK8 0:HH4J_KK8HwHKwHyK4HH?u@44K?YK?K?K?@O? .0_4:Ƞ4Ku>!Ks>) k?k?ok? k?k?K|87D7#|07"n0HHw6z_)44_4y X7Kd8d" n0H4zP_4H hhH4`744`_7  d 4?Kw81Kz  4kv81Ku81 Tkt81H k?!KwKy _7_KzK?!k}KKx7ky  %HhHhHwh@heK>K?K?K? @O?@ @K?@ @K_K7K8J8@ 8k?/,opk>k>k>k>k>k>k>k>k>k>k>7D`,7C0 0$ #He#4&Ka?4'7?!4i 4jp!n0HH l8r5`/10 0$ JI#H|I#"Ha8I8.@4@_5yII0"k?1H54 k?9-5 40k?-k?-k?0 k?10 1*n 0N/Hk?I0k?9---30@1n0N/-  0 1- ,-@ 1N0-@/,0N/,. 0N . H B7 /1/Hv6p.`0.`Kt8ƴ_ 5zD5Hk?7?5z-.I0k?_-_5z D4z1H_5zP@HHHb8I8}7I04@_5yHHYK>K>K>K>K>K>K>K>K>K>K>O>@/0,Kw4?Kv \  6 66P4?K@ j67S`.q0 0$ "7T./0/KZ@?7S`//60N/Kt UKz 7@k?ok? k?k?k?!Kh4#KwpXk`K *K Kx7 ky7@Kz7] S H\ k|Kgp7Kfh4 0H!H!4C 4h844h@hhhKa8ǡ8@_4D 44_y4 (4kkK?k 4K J ZK8HJ8 XH0( h(h0J@?}@K?U@Kup4-@K>K?!K?K?K? @O?7K__!"k@@0H7V`.K_"7?a7XPK: K!@K]@ SkS@K]0 zk?aK7<`k?i. k?A/k?I.1 /00n 0N 1e/K@?-@@7?k@0H7`.K!7?a7PK KJt J|@K@<Uk@K0 zk?AK6v`k?I/! k?a.k?i/ 1 /@00n 0N 1e/@K@?%@K>@ @7K@k@7`..K?@@7?k?/,/-o`k>k>k>k>k>k>k>k>k>k>k>Kv`6?cX47e80H "06. 4&4' D !.07?4  I 7_5Ky8ƹH@_ 5:D55`/I@_ 15:I@I `7zC@ 0@Kz rIC7z RHi@C@ (@IC7z i@5`-7zI0 0$ RC<@ *Kx jIC 7z( J@- C @ "IC 7z( - 5--0N-,Kw80Ʒx,_5:D5-I@_ 5:`--Q5:,-A_-]5?K>YK>K>K>K>K>K>K>K>K>K>K>O>/0-@/0,@ @K?@ @k?7KW6`K?7`//..000 0$ 0 0$ J J K K @ C]4 C3  C4 J0K0 ϟbςXK?YςHK?Yϟ8K?Yϟ(K?YςK?Yן4K?Y@7?ϟK?YςK?Y_@K?Yk?/,ok?k?!k?)k?1k?9k?AKdh4#Kp@Kdh2_@Ka`H Ky`7 #@4+H7 @4_ 4Kv8CZ4_M4_@Kt`#4_ @Ks`Ku 4$H  Kw`7#4Ky"4Kb`+H7 H " 4_ 4K|`Ka<  $44K>K?AK?9K?1K?)K?!K?O?@/0,0H 4%44`4P4 @, 4_]4 BK 2KH?! h?!K @ , , , h0h(hphxhK8 HH>Ax4Kp44KdhKpH8 @ 4Kp4@w4Kgh  Ky`76u+ 0_)4 Kx`^5 `^5 K|8I=HK8:"0^M6 CD4#0^%7 K>K?9K?1K?)K?!K?K?K? @O?k?ok?4$Kw8I6kt8IK8Q@07CKz8Y7kx8QH k|8YK}8YKs8I Ky8Y4?Kz8I : ha8K|8J N0Ky8I4Z ^@C4z n0^4z K?YK?@O?k?ok?k?K}8H7C#N0Ky8I^-7Z C$4z"0^6 Hss @Kx8A7ky8A` 4$ 0Kw8Ahw8K82^4 PC4zKy8A^e4 Hc`?@(+K|8 .0^4: Kt8I6?ku8IK?YK?K?@O?k?ok?K8@7C"0^6 C4z#0^e7 _4z @_54z @_=4zhK?Y_%4zHd (@_HHH?@_%4zK?YK?@O?k?ok>k>k>k>k>k>k>k>k>Kb8@ rk`8Kh8ى @Kg8 j 044 J 4 ^7h4!.0^5: m+ 044 PJ t4 ^E74 n04y pJ <4 7yp/!7>70'^ Y7d8,0 0$ 44y J 4 7z9'A,"06 P.77?10n0n ^u/ H+4y J 4 ^7"06 P.`,Kd8ـ#Z4yPk>4J4 4y`k>7k?4J|4 7k?44ypJL4 k?4z+k>47 4$k?49 P48 `^47 p4h44 J5744yJ4 4k744 Jt5y744y JL4 7k?K>4J4 7k?45yJ4 7k?44y@J4 7k?45J4 k?y4zP44^=57K>4J<4 7k?K>4J 4 7k?44yJ4 k?4 K>4 k?4 ^}4 ^m4z8K>Y44yJ\4 ^-7K>YK>K>K>K>K>K>K>K>K>@O>k?o k7 7C 0KX04`^M77qKx8ـ +4: 4: 7y9'!H}0k?y4w`."0.6 .a 1 7t8.0 7?0n/0n/1jN77q2n^ @Hy @^ m4p(4+4^ =49 P44J<4 HyHx0^ 7K6K7 @O77X`7=`////0K_0KS  0K70K4 0 0$ @40 0$ @4? @4 4@k?ok?k?k?KD7C k@H Hy H4f4_@ @HH ?4Hhh 4H?oHyK?YK?K?K?@O?k?ok? k?k?k?!k?)_7CHc`!z+4$4 k?94 `k?17e94&7?!0Kx8ـ @K?1@K?9$4w`4 ..4 H0k?y00n,0n ^u, Hy @^M5p5^-4 ^5C4z^5Hc`>Kx8K>K?)K?!K?K?K? @O?k?ok>k>k>k>k>k>Kv87DKHKG7#K&V`K%!.05:^k>C55:^k>C4Hk?5:4 k>H07?k?/.q^/^]K>CT4^=K>C44Huk?4w 7?./H0k?.^%K>^5: € I H H @H !R4 4| , ,0//000 0$  ϟK>YϟK>YςK>YH @H (@HHw ϟ 4K>YK>K>K>K>K>K>@O>ϟK>YςK>Y0 0$ ς}K>YHHw ϟUK>Y 4-K>Yk?ok? k?k?7Ck?qKD K?qH@ H7?1H@_]4 @H@H@?H@H@h@h@?u4K?qhyK>K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>7CKD04dHm BKx8ـ!#047@J4 +_4zHe"+4&4 k>4 k>4 pk>7g94(4 pk>4 P4 `!n07?Hm H"ZI"JKv8ـ!K>$4 .`4 .pH4 0k?yH0k?q00n-0n ^- C5^5zH@?HK>Y"046J4 +4* @k?4+ Pk?4, `k?49 48 47 0^I7K>YK>K>K>K>K>K>K>K>K>K>@O>K>k?H4 4 0k?4 @^k?C5^y5z}H@Ku8ق=K>K>k?ok? k?k?7Ck?yKD K?yHH H7?1HH_%4 @HHHH?HHHHhHhH?u4K?yhyK>K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>_7CHd"*+4%4 k>4 @k>4k>7f94'4@k>4 40!N07?Hl I Hu K|8ـ K>@K>k?4 4k?Hk?^4C5^y5ZHHKv8ـ K>@K>$4 4..4IK0k?q0Hk?y0n-q0n ^-a C5^5ZHH>_HK>YK>K>K>K>K>K>K>K>K>@O>k?o k7 7C 0KX04`^77Kx8+ 4:04:P7y9'!4w`.."06 / 1 0 7s8.a7?0n/0n/1jN772n^i@Hy0Ht  p@^40Hy @^4@P@+4P^i49"+4`49^948C04z^4K6K7 @O7k?ok? k?k?k?!k?)k?1k?9k?AKy8 07CKz8ك@ @Ka?C4: _44%K`Kw !4&4'4(4)!N0Kw8 p d Iz0 ZI} J5`/0 0$ @/0 0$ *Is@! Ky8 At(@ K`Iv :I| *_E5z_ E5z8Kk8_}5z_5z_5zKk8ـ @^5Z^5ZKb8ـ @^Y5ZK`Kx  47Kw8^I4zK}8 0@Ks8ي` @Ka?D4: K>K?AK?9K?1K?)K?!K?K?K? @O?@ @K?@ @k?7K_K7K^JK?Y@7?Ku:Ks: k?Ku=!Ks=) k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>Kw86?7?!#.078 /4&Kp`Kq 0 4' 4&00N8E&EGTKn`47 Kyh44Ku8 :  K]0 "7V.0 0$ "  Kyh46Ks`7m7+H744^i4Km4X4 4Kb  7K|476 0^4 44J4 ^747?! *!05 -`4$1F0@00N0$9 9 #B4*Ka?4+4,4 @44Ȃ5 J@ 4`040J0^i7?qK8ـ *J4@^i7?q8 ^A7?q 5 2`RIv 6?bit Iw(6iy(61Q_Iv 4`^7?qCx6K}8!p B(!ZJ!JKz8"PK6Z_U4^" 7^7?q 5 2`RIu 6?`bis I(7ix(61Q_Iu 4`^ 7?q44J4 J7^!7?q4^ A7?q^)7?q  - ^ 45(<4^ 4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>5y _m4@=61JJ4p^ 6Y^6Z72 =@4^ 7?q44J4 J7^17?q4^ Q7?q% 5y _e4@]61@ @K?@ @K_K7KJ @4? 4@@ @K?@ @K_K7K8J8` @4? X4@k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yKs`4$k?! 4G4k?1K}`7G Ky`7G Kr74#G Kq7G Kp7G k>Ko`444 #4 +H/KzKy4.4^)5Ky4 % 44 %X45^ 4+H745^57> H .04< /4$AF0@00N0$I I%4K?1@&'5z7?!k?595^4K>5z59@@4k?Kz4K>@Ky7?1k?K?!5WK>@4''jKe`G  Kb`7 G@Ka`7G 7K|G Kv7G Ku7Gd 7^ 4^ 4^ q4^ a4^ Q5^ A4zK=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>!0444Kth T K0 K^5!Kxh X KZ^5 Kwh W 94Kh _ B(_(b(Ksh S 5C(֠ c(6K}h ] kKzh Z jKyh Y j8K`56R+Kt 6h PKyH!7? 4"n06} /7>k>Ktk> k>KBW k>/0/ 000n 1$ 0$ :@KZKP867kV8K|Gk> 4 K08 :W4K: ZKSKA3 "K?16k?1 U :kXPKZH@?@K: ZK]K\ "K?16k?1 T ZkXPKZ@@?@C:(77_>c:(54K?15w _ KCS(ǓrKB(ǖZK5)6B}(נ b}(KC(@ c(K?17U@85z"0 C(ǕK]M6 ?5%5z!.0 C(Ǘ@K]5: ?48Ke` 0 J4 ]4?@EKe`k?ok>k>k>k>k>k>7K>7C7% 84 (4 y K79% _ %4 N04A ,!47?!7>4tJPJ$Y J `Jk?k? /k>k>.p000n 1$ 0$ C(ǂ@ @'(LJK4)  8 HF"r4H?4PKH"r4H?4H@H" ZH& JK :K *K7 H  H) K44 75I?4BK 5I?4X4H&K!ZK!JH(44 4'5I?4BH 5I?4FX4H&=4" 4H?4K=7 4H?4 8&(bK5 ( 6K 5' 6;@! 04g KA7(Ǘ@KBt(ǔ@I6 I< I? 7K?7 H@A?(a?(4 ]UI9I) ?@?4 0 `JC(Dž@JJA (lj@2C(c(#0K]7 ?4cK>YK>K>K>K>K>K>@O>H6 :K@=6h<khZPH) PK0h<0k00h:PE6 "h<k kPh<kjPk?ok? k?k?k?!k?)k?1Ku4#k?aG Ky7 p44Ky? K"@D(dK&@(g@k8PKy7@7?ak?Kz_4Kt`4 4#Kw`Kh 04 C(  ߟ(@K]4 KhKw`4䟕4K}44!X4%K4&8 0 * K]5 KK|` 44 Kth 4 C(y*Kw K]MK Ks`5h5)KKv` " KY]4 K I(Ku4@K>K?1K?)K?!K?K?K? @O?Ku:Ks: k?Ku=Ks= k?KuKs> k?Ku>Ks> k?Ku>Ks> k?Ku>Ks> k?Ku>qKs>y k?Ku>Ks> k?k?ok? 4_k?k|!@4#Kz_4!J Kz_4p!k|KzKXK7ak|G KzKzk|7KWJ7bk|4kyKz_%k`4:|"R "R4@kt] =K?A4Kz#470ID4 KxKa?K?4:@] e7A4E Kz_4>Ek|44I4 KxKa?K?4:@]7A4Kz_@_7k?KxKa?K?4:@]U4A4+`_U@_u7k?KxKa?K?4:@]4A4u+`4kuKz@ _E@K>K? @O?Ku:Ks: k?Ku>aKs>i k?Ku>Ks> k?k?7Kuk?_EJH pk|"46I 4 KwKxKa?JH4:@]=7Ap4KyK=Hk?Kx4_K? *#_7`]Kzk`Kv J"o46yI04 KxKa?4:@]]7K?Y@7?Ku>Ks> k?k?7k?Kzk?_k?4: ⇔! !: "46I04 k?_-KzKxKa?K?4:@]=7k`8K?Y@7?K?K?BK?K?Y@7?K?K?BK?K?Y@7?K?K?BK?K?Y@7?K?K?CPK?K?Y@7?K?K?BK?K?Y@7?k?oKX !7CHǟAKy8 KzK_7?aK4y7C?i84!R4!4苘!Kb8@!Hz@!C_!CX J4\4H7] ( 88!@?7KwJC0 !j"o6y_4!B#Hz7_4!Kw8 H}}47K>@O?7K8#OHy]57Z074Kz8"Hy]6M7=7-77 77k?ok? k?k?7CKzk?a7&Kyk?i7?i7k?q7?aK_k?7?qK306k?K ck?Kx]7 8@K?a @K?i K?q +Ke8p@K?a+K?i048+K?q04?k? 4`]4y4K>K?K?K? @O?Kt8"k?"6]a4yK?a 4K?i K?q] k?/,opk>k>k>k>k>k>k>k>k>k>k>k>k>k?k? 4#k``Kk444&`A4?4(4)4*K|_ !RKs4 !4 K}  KrU]J:"@Kz5LK}Ka`Ks44`$4KyK} ' ]K"x@K6RKyKzp Ka`4"kb`Kv4^m@Ky` b#47I4 KxKw9Ka?4:@]7A4Kx`7 s T F k|hKh4Ek|p4(4)"4*60.  4+4 4 !K|_ =7Kb8RKv 5 HYHX]@Kt>@Kw5? K9 ]J=@bKv BKw6A? HY ])K0"R6PKzpA@Kt K K0KKvp KuЀ Ksg  Ku]qJ jKv KKbp ]KxpC(7(h ?Kzp@KtKx KZKppKyp7?(C7( Kwp7?7?J_-6  @A tK?Kap <KqpB?(b?(KppB(_ b(KrpB_(b_(KpKKCS66 *Ky8ɀ ]y5 p0k`8Ka8x@KypK|h 7?1vK85 K7&a00N8D&iD] iKop5kppKt4[U@AKzpKgp 4 Kpp4?Kop Kzp7ZA4kzpKmp4 4Kap 64?7?1K|p 40KnpKih5 %,7u`7z`kep'00N8EA&EK>YK? K?K>K>K>K>K>K>K>K>K>K>K>K>K>O>@/0,k?/,opk4@O?KwJ7?KPE7 |K>4@O?k?o7#7W44]7? @K?Y4@O?KwJ7?KPy7 |K?Y4@O?k?o7W7:7] 4|(4K?Y@O?Ku<1Ks<9 k?k?7Kwk?J7:7?K`i7K?7?4_]4 4K?Y@7?k?7Kk?K7:7?J`7K?7?4_4 4K?Y@7?k?77Wc?7?4_E4 4K?Y@7?k?o7W7:7_4|(4K?Y@O?k?77_KKP7:Q7K?Y@7?k?77_K7:K`77K?Y@7?Ku;1Ks;9 k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Y 4 ]Ak>a44$p4Ka?4' Z44 H44 KxKa?K>a4:@]Q7@444_4@ @]aK>a@<44 Kz99 @KvV K}= Kzz R44 H44 Ka?K>a4:@]Y7@ 4K?iK?q7ji]K?y4?iIiSKy:Kxkx99ky Kwkz  ku(K}84)zkz91=p4*] 4 Ky Kx99]4`KyKx(]4Kx914@]5y @@KuKn(ՠZ44H4 KxKa?K>a4:@\7@ 4K91Kv9) 4(04+Ku91Hh4 447?\U4)r4]a@Ka8 *h@Kb8B:44Hl4 Kx8qK>a\-744H,4 *7+ 48K>a_ 14  7\}K>a@ T44(47>\4 R44 Hl4 Ka?K>a4:@\7@ 4K8 04,#b4 4_ 7>#:Kv8 4 7>_ a4 Z44 H4 KxKa?K>a4:@\7@4K|K7>JvP7 0pk|8q44 pH4 Ku8qk?KxKa?K>a7\4:@@,4447>\4<+Ka?4(4)4*C>ʇ  :Kw8ykw8y4@ lK>a4Kx8y?kx8y4]K>a4Ky8y?_ky8y4\K>ah4c44 H<4 C>k?5@7K>a\UKx@4447>\M4>C>+K8 %4k8y44_4@ @\K>a@444@7?\44@ R44 H4 Ka?K>a4:@\7@44Kz4(_}7?k?iKz7_U7?!k?qKw77?)JKP!@507k?yKt77?1JHVPQ75_Kl8KmI7?9KP7Ks99 +hk|8Kt8 R44 0H,4 Ka?K>a4:@\U7@4M4 @F k|9)Ka914 ] !7Ku91Ka?4-4.447?a\4 j44H,4 Kv91k?5?5@Kx7\=5@t4KwJ7?aJh97Ka9), J | K915^4e4Kz_=7?Kz7_7? KaH?77?KP q7Ky849(74p5Y5x\}55Z5y]A5447?\4>@u4@T@5}k|84kt844H 4 Ka?4:@\7+44 H 4 KxKa?Kw84:@\7@4++48 \444H 4 7+480+48@\444@H 4 b 7+48P+48`\54yk`8K=K>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>k?ok>k>k>k>k>k> 4^k> 7\ K>@4K8 0 044 H4 KxKw8Ka?4:@\7@H4K>YK>K>K>K>K>K>@O>44@]7?EKy Kz4%_ }7?EKy99Kz_ ]7?MK|Kg91 XKHV`4&7?U7@A7Kt8 @@@Ky8<""KvJ"i@6z0K`7?]7KuJ7?eKz8Jv`77?E4@4_4w!@\mK>@@4Kz914 4]7>KbHA7?H6`477>4(4_4w @\K>@4Ke8yK>@4zKd8y@K>]4zKf8yǦ@K>\4zK>Y7?E44_4w @\ K>@4Kz91`44(KwJ7?AKx9)Kx )77?A44_4w @\ K>@4Ki914'_M@KghK}p4&Kp4(H !JI<K7?!_KzI5J7?)_KzKtJ7?1KV`I:77?!44_4w @\ K>@4Kv868@I7I?4JK\ I7I)H >@Kp4瞍@]4zK>Yk?o7#k?"46 H4 KxK?\ E7` J#47`H4 +K?480\ 7@ 4zK?Y@O?@@K?@ @Kuk>k>k>k>k>k>k>k>k>k>k>k>k>k> 7Fk?7'4 P_U4 44H5H5HkzF44k?+47pk?4E4$ 4%MKp8ǰN04(_4@.(7K9n04)K9n@@+4*pIZ@.@5KKk8`.x@^Kz9Kn8.@Kt8.Kz_@kv97ku9Kz9_@K9 7_ku9K8.Kv8ǶO@Ku8y @Kt8yO*K}8郠:Kz8O`0"Kd8退b`0zKk8NjPKj8jPKi8)PKl8 P4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Kz9@"4?ky8\4p xk?Kz9@#K|8׀k|8 8ԿKz9@&"Ku8֠ku8 ԿKz9@)@Kz8@kz8 Կkq8Kz9)B$@(7B7 pk?Ka?4(4)4*4+4,4-4."o4/6p447?S4? +kq8Kz9 A 4Kv8kv8xԿhk`8Kw8?kw8@Կ?0kq8Kz9 A (4Ku8ֿku8Կ_e@Kw8 Y?ky8kq8Kz9A 4Kz9A 4hk?Kz9A `4 Kz9A H4(k?Kz9A 4 k?Kz9A4k?4_5 Kb8_kb8ԿKy9@,7z9Qpk?Ap4Ka8?ka8Kz9A84k?kq8kq8Kz94_4k|8 Kz9A4 k?Kz9A4xk?Kb9@__ 4ڃ 4ă? 4ƒ_ r4h 44H`4 Kx9Kw5@\7@ 4k?k`8kq84xkx84`k}84Hkz8Kz9 A@4Kt8֟kt8ԿA4 Kv8kv8Kz9 2_4^ 4AKz9Ks8?ks8`Կ?Ka8?ka88ԿK9kԿK8k8Kz9 R_4^ 4AKz9Ks8?ks8Kt8ր?kt8pԿ?K|8ן_k|8HԿ__Kz9k|8`k`8k?kq844HH4 +49`\ 744H4 \744H4 \7@P4_Kz9k|8ᓀ`kq8 k?kq8kq9ak`8A4K}8׿k}8k?44PH4 K?Kw95@k?Kx\7K?k?E|4K?k`85@_4k?K?44EK?67?%7+%@44H4 KxKa?4:@\7@H4+4 ki8@7z9Q+7km9 k|97kl9 kb9A4 `A4 h@?5ku+IZ1u@5JAH4 @@?5J5+^Kz=+^@A@Ko8 b44`H4 KxKa?4:@\)7@`4=K8AKz9Kw8y 4Yky84kx87ka8_e4+@@+]9@|K}8Ks8yKz844H 4 KxKa?4:@\7@4MKz8K|8yP=@44@H 04 KxKa?4:@\Y7@4`/Kd8Ke8Kd8Kg8ـ/Kd8]4zKd8@@`/Kk8Kb8wKk8Kf8و @]%4z^q@-Kk8\I@Kj8\ @ Ki8^ @Kl8^Y@4Ku;Ks; k?k?7_@K?Y@7?Ku:Ks: k?Ku;QKs;Y k?k?74k?44k?7?k?_Mk?44_-7?K?7?`&" 6/ 0"z6w7?!0n '01N 1! ' J K>@7?_4K>k?ok>k>k>k>k>k>k>k>k>_7?Q K>_7?Y @K>_ I7?i @K>_ !7?q Z+K>49_ 4 (@K>7y9!_ 4 b#/ 479H4 KxKa?K>4:@\97_u4Kz99 ZK?Yky99K?Qkt ҕkuK?i%ke(K?qk|91kb8Kx88x4# K?QK?Y4\K?iKy Kw91Kx99\4@KyKx(\4Kv K?Q X@K?YKh99 8@Ka91K?i) @Kd8K?qD b" 46 H84 KxKa?K>4:@\Y7_4K9) H4$Kg91E  k|9)Ks914 \7K}914A4&4'Ka?4(4)!O 4K>4\ 7? jk?45YH4 Kx91k?5@7K>\ Kx_M4KwJ7?Kh7Ka9)% KU BKx887>K?YK?Q yKt9)K?i ''8G'F@ \ 5ZK914^O4K>YK>K>K>K>K>K>K>@O>k?ok? k?k?k?!k?)_!4!Ky _K?! @Ky99_K?! @Ky91_ K?! @Ky8_K?! h@+K?!49_4 0@K?!7y9!_4 @\ K?)_e4Kz914@@4$4%4&KyK77?K9)Jx 7K?!7?4_4 @\ K?)_4Kx914c_WKyK>K?K?K? @O?k?ok? k?k?k?!k?)k?1Kdh4#Kyp$p@7ep4&4'4(7?aHk?ahKw k?i- ,Kx Y  01n 1! -1 K?Yk?Qk?Y-100n0 -  K?iJKt84" \6 0KH hKbp4HK>K?1K?)K?!K?K?K? @O?k?/,/-ok>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yk>k>k>k>Kh(k>Kj H k>7i9Q7>,k?I%!4#7ep40400n_,Kg91CKx9)K917g4(4)4*!o 7? #X' 7?a&E4,7>Ks0 Ky880N&0,K> S 0 0N 1A , K>903  Y X\5z Kx9)K91,K}`5?1ݢ@, A B Kwh  K66  J/555 7 -7= !jKu85jk>, X5z 0k>,k?K01N0n\-k>K|h7zk>,,501N0n @@ *K R7z@5 2Kth T 7.1.,0.,Ks`q6.Kx9)K914\}k?IKl8,(@7m-! \y5 K=K>K>K>K>K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)O>!/0-@/0,k?ok>k>k>7D o 44y GT4 Ct9!Иҗ7\ 7?Kt8ـ!@44y G4 7vp.7>70&\ Y7d,0 0$ 44y Gd4 7a9$!,#O 7_0/+4"k?17?0n7@0n \ .q +`4y G4 7x9'# 70.+4$k?070n[}@7d,0 0$ P44y G4 [7#/ 7&0,,44y 0G4 4f P744 G4744G\4 7k?44y `G,4 k?+43k?4?49k?4z p4[444y G4 744y G4 7k?44y G\4 k?7?+k?484z k?4[7K>YK>K>K>@O>k?/,ok?k?!k?)k?1Kv80H  @7CH|0 *4a,00 0$ #P@7/4e,Kx8 0 //4 `0 0$ :" 6`/,1N 1%n+0H7f9$,7?10n , 0n [m, Hy0/4 0 0$ :"o 6y`/1,1N 1%n+0H7f9$,7?10n , 0n [, Hy0 k?I4w ,7?ak?A.4 k?i$ 1Nk?a3 // 1@1N02n0n1`@3:n,2n[@0++4948 470[-4 Ku8ـ @@ 4z@@4z[4 K>K?1K?)K?!K?O?@/0,@ @K?@ @k?7K76K_7//00 0$ 24K?Y@7?8bϟK?Y0 0$ ϟK?YJ0K08@ςK?YK[5J]K?Yk?/,opk>k>k>k>k>k>Kt8(k`8Kg80H 7s(.q Ka8 (" 46@G 4 [7Ka?A4: X+`0H44#(48P78?7?! Jt0 bk?!6v6u .k?)./ 00 1 n0 0$ (b_u7Zbh@ 7ZYK0 rk?!77 -0k?),/ 00 1 n0 0$ 0H7@K0 rk?!77 -k?),@/ 00 1 n0 0$ 0H7HK0 rk?!77 ,k?), / 00 1 n0 0$ 0H7PK0 rk?!77 ,k?)// 00 1 n0 0$ 0H7}7Z "J0 "0 0$ "7w9&# 7Կ. 14,Q0n0N 1% 0$ "ZR64?.440N4`4@4 0 4?4?0$ !7.70N0 0$ !@.70N0 0$ !p@.70N0 0$ !8@.70N0 0$ !@.70N0 0$ @.70N0 0$ @.70N0 0$ X@.70N0 0$ @.76@0N#/ 7<Կ_MKa` 4" 4'6 K 7z@59 *K 27z@59 -_u Kw`4w [-4K|8 0@Kb8و@ @Ka?A@4: K>YK>K>K>K>K>K>O>@/0, o [M4z0M+" 46pG44 [7K}`4#E  Ky`7 H44Kvh  Ky`76+H7@4[U4Kz8ك@6Ky`5#/ 0Hk?oKc9A` @k?Hy[ K? @Hc`?@` h@E x407440\ 7E K? |K9A kc9AK?Y4|@O?k?oKc9A` `k?Hz]4^ Hy[K? Hc`?@K?Y4|@O?Ku<Ks< k?Ku=QKs=Y k?Ku=AKs=I k?k?o7?(a4> hdhehfhg hh(hi0hj8hk@hlHhmP7FKg9Qhx`7$KY77q[UhwhHB`0^4! 4 H_u77qHK}8]"# 7H[ 77q! 5]77q"70@ 2H]I4^ 7Kg9Q5J b4[-77q5_}77q@>@77q_U5YHKa?H6!45G4 KxKa?H4:@[704H[M77q5P_77q5`]]77q 7!P@Ky9q k`9q4_]4Kz8@ k`8[=H@Kw9aKa?4) ?U5'H]!4^>@7[77q45p[5445G4 H7[4EX4+4(7q745[44 `4 +4*7q5K RHwhHv`5844m74_45) `M04 _-4_e5k45[4_'5K[ E44Hb?HmPHlHHk@Hj8Hi0Hh(Hg HfHeHd4~@O?k?ok? k?k?k?!k?)7C7$?44t^5 7 E47754\ 4  H *([5ܟm@ e? eK>K?)K?!K?K?K? @O?k?o7C4[40H4w.K?Y4`4x ////@O?@ @K?@ @K_K7 @4 @4?C_(C7( @ ??@ k?ok>k>k>k>k>k>k>k>k>k>k>KY7C &b+H7PHz[ -4HdHj4H74&4!! 4 H# @(8@?@>y9@7?@>y7?!z<\!@HC]= H>aBt4 2!`@CT4!JH>aBu5!2K}8  H>ak? 4 k?= 4 k?H 4 ̓ 4 55X[5wH[5 444>QHvKz8 G!zHk? 4 k?6H>a@ 4 k? 4 4 55[5H[5 HvHsH>Y7?0h>YH HJ444H4Hv4Ŝ/HHg :H>Y *KvJ0JH 5*?h>YKt84!  Hy $ 7? +"o 6z/@Hh! 5@$!00N8E$)E )[  dHx 7? _ 4, $Q00N8E$`EKd8$YE Y p4 4Hi  &4HH4[4HnğHiK>YK>K>K>K>K>K>K>K>K>K>K>@O>k?oKX7?4!84?7?KW4 7Ks8 ] RC4ct A B `79߀*6 B c ᠢ 6?U@6 B c @ W Ha?`44|K?Y@O? Hvߠ `4|߷4|#O [7Zp4|K8w4|" [Q6M4|`=4|k?ok?7$[k?D7744[ m74z z[K? dK8 kc8K?YK?@O?Ku;qKs;y k?k?ok? k?7D7#_7:4t]4 78 _ 4 |+4? 0 4[mk?!!@Ka?H? @ _@ K?!@ z[4!"4\^ m4 H@_ 4 |+49 0 yK>Ka?H? 8@ 0^ mK?!`h| _@ @^ -4 h| [4 dK>K?K? @O?k?ok?Kx87Cx"0Hy[A6Hz^ 4^ 074_4y 4 zHz_4y@Ky8yHX K0+ 0049[q4HyP @[I4 PHHy` @[40H[4@H @H( K0+049[4PHy  @[i4 P4`Hy0 @[1404`[4@4`[@K?YK?@O?k?7K_ K8 84 K_ KZ Kw8ɒ 4 K?Cx04[  04PK?Y4K_ ?_4K= 8474K?Y@7?KT7=>Q!  KK U 7=4qKTKK s \ K\ v j|KK _ \K6 :KW _K K8! @Yk?/,opk>k>k>k>k>k>k>k>k>k>k>Kc8`!4%KchKp 4&7c7d(4gK "4'KhhK|pKe8#4eK>YK>K>K>K>K>K>K>K>K>K>K>O>@/0,_4zHc`?@+`7gKpKd84( 4@_E4y 2H N4 4 _=4yH B4_4y "447x _4yH?G4@Kd8Kp4c @+`H Z J D k H s T  Z 4}@E+` M D d k|(Ka ! B k`  kl0KpKi8 5:@_-5 2I+ k Ww 5: 4_%5I* B5:_5 "5:7x 4_5I) ?G5:@Ki8Kp5 @Ke8+4&4'4( 4) +4*`4+!0H!rH0 !bH!:Kv8vI 5pK@4Ik?II04 IK@5k?Ik?yI05?k?HIk? ] [k?q45[ 5I>Kv8HI>@H>e@4e+#04&`7 . 4'!0K}8}`@e7? "5$!00N8D$)D )[q _44e@=K>Yk?ok? k?KE7C7$k?!KZEjHH2H"K?![ %4 P@Hy4%@4K>K?K? @O?ςK>k?o k7 k7k7KF7C4!(4Ku8و @4 0@@ @Kv8ɒ 4K|8р *4A@47 4 04@k7![!4[ 4Ks8` p7!@@Kf8AH@K8ƿAj4K6K7K7K7 @O7H?}@Kw8 8K\U4^ 7HtJHyk?#07XHw 7P[77K7![77[77> [ 4+ O0Hy84Zp[a@+#07P.4y`/1#O07Z[Y0NE4k?o_7CHx :#047F4 Hy[7Hy0 JHw@ "#O0[Q7Z K?Y#0[)7K?Y@O?C_1д4@k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?YKk7C7(`"p7 K 4$ 蘀74%K99Kg8 騀704& O0Hy4Z5[57KjI\0Ka   (@4*4+!05_U@!RKu8[15 KvJ5K6P7K 6m K}997z`_=5 x7I bKw8 @I5PZ]544z[505Kt8@Z55(5K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?iK97C7)7 4%KbKtHU0 kn97g@4&_a4!045F4 kg"06-k|P7x/Kw#@K 4& 阀74'K99Kj8 䨀7P4( /0449F4 Hy758Zm4Kv9 i+4< `k?y4, Pk?q4*4+4 h!044A=ӿ ډ"bA3 "BKy8r450F4 7A<K}9ӓb  K?q@K?yZ5@47y@[m4zKw9Kz8:45F4 Kp9 Z7I!K9859Kw 8 Kb99O7z`_5Kt8(7JJ5Z 5J 5? JKo8 Z5 44z[60Kw9Kx8@Zu5 Kw9 5)_A=K>K?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?Ku>Ks> k?k?7C_4?#O07Y H7 |ˀK?YςK?YτxK?YφhK?YψXK?Y  40K?Y  4K?Y 4K?Y 4 K?Y 4"K?Y 4$hK?Y 4&@K?Y 4(K?Y_@K?Y@7?k?7@4?"06  +4< +4< +4< +4< +4< +x4< +`4< 0+H4< `+04< +4< +4< +4< +4< P+4< +4< +4< +p4< +X4< +@4< P+(4< +4< _}@K?Y@7?k?o_u7C4?"06  ςhK?YτXK?YφHK?Yϊ8K?Y_e4zK?Y_@K?Y@O?k?o_7C4&< 4"\ b "@tҟ4sx Ka?#04:@Z-7 HK?YDv4u Hx4|  K?Y4|@O?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?yKq97C7) X77e4 km9_I4"06 -ke (7r .QKn#4%K 4& 阀74'K99Kl8 䨀704(!o0Hy5z 58Z4K I4* O04+4L 04 !0A4"4Kv8 Z5 P5/_e57  "_57 _6Ky8P7_6:5 Zu7_6Z5 ZM76S?`4? 47y[Y4z_68 _6KwK ?K}99=7z`_69Kx8H75 Z]69JYZE5 JYZ-5 0JZ: :44z[Q6Y_60 Ka8@Z 5 `4K 5@K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?k?7C_d4?#O07Y 7 ˀK?YςK?YτxK?YφhK?YψXK?Y  40K?Y  4K?Y 4K?Y 4 K?Y 4"K?Y 4$hK?Y 4&@K?Y 4(K?Y_5@K?Y@7?k?7@4?"060 +4< +4< +4< +4< +4< P+x4< p+`4< +H4< +04< +4<0+4<P+4<+4<+4<+4<+4<@+p4<`+X4<+@4<+(4<+4<_@K?Y@7?k?o_u7C4?"06 ςhK?YτXK?YφHK?Yϊ8K?Y_e4zK?Y_@K?Y@O?k?o_7C4&4\ 44" b "CӔ7 Ka?"4:@Zu60K?Y74?  "?777 4 7 w 44  S  6 6  y  b  77W K?Y4|@O?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?yKq97C7) X77e4 km9_4"6@-ke (7r .QKn#4%K 4& 阀74'K99Kl8 䨀704(!pHy5zp58ZE4K I4* O04+4L4 !A4"4Kv8 Z55/_57  "_57 _e6Ky8P7_M6:5Z7_%6Z5Z76S?`4? 47y[4z_68 _6KwK ?K}99=7z`_69Kx8H75@Z69JYZ5pJYZ5JZ: :44z[6Y_ 60 Ka8@ZU54K 5@K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?QKkKjIb07C7(7 @"JK 4% 蘀74&K994'Ka8 騀7*#Hy75Zi57 5 (`@4*!pI`!Ku85z@ZIK    Kz997z`_5Kw8(7II5zZQ5I *44z[y5(5Kt8 Z5z5(@K>K?QK?IK?AK?9K?1K?)K?!K?K?K? @O?k?o7Yk? p4z^%k?K?^ 4zK?^4zK?^K?K?^4zK?^4zpK?^K?K?^}4zK?^e4z`K?^M4zK?^5K?K?^4zK?^4zK?^4zK?^4zK?^4zK?^4zK?^K?K?^u4z@K?^]4zK?^E4z @K?^-K?K?^4z K?^4z K?^4z K?^4z K?^4z pK?Y@O?k?o7Yk?! p4z ^]k?K?^EK?!K?^-K?!K?!^4z K?!^4z K?!^4z K?^K?!K?!^4z K?^K?!4z k?^}K?!K?!^e4z K?^MK?!K?!^54zK?!^4zK?!^4zK?^ K?!K?!^ 4z0K?!^ 4zK?^ K?!K?!^ 4zK?!^ u4zK?!^ ]4zpK?^ EK?!K?!^ -4zK?!^ 4z`K?^ K?!K?!^ 4zK?!^ 4z0K?^ K?!K?!^ 4z`K?!^ 4zK?^ mK?!K?^ UK?!K?!^ =4z@K?^ %K?!K?^ K?!K?^ K?!K?!^ 4zK?^ K?!K?!^ 4zK?!^ 4z`K?^ }K?!K?!^ e4zK?!^ M4zK?!^ 54z`K?!^ 4zK?^ K?!K?!^ 4zK?!^ 4zK?!^ 4zK?!^ 4zK?^ K?!K?!^ u4zK?!^ ]4z0K?!^ E4zK?^ -K?!K?!^ 4zK?!^ 4zK?^ K?!K?!^ 4zK?!^ 4z`K?^ K?!K?^ K?!K?^ mK?!K?!^ U4zK?^ =K?!K?!^ %4zK?!^ 4zK?^K?!K?!^4zK?!^4z K?!^4zK?!^4zK?^}K?!K?!^e4z@K?!^M4zK?!^54z0K?^K?!K?!^4zK?!^4zK?!^4zK?^K?!K?!^4zK?!^4z PK?^uK?!K?!^]4z K?!^E4z!0K?^-K?!K?^K?!K?^K?!K?!^4z!K?!^4z!K?!^4z"pK?!^4z"K?!^4z#pK?!^m4z#K?^UK?!K?!^=4z$0K?!^%4z$K?^ K?!K?^K?!K?^K?!K?!^4z%K?!^4z%@K?!^4z%K?!^}4z&0K?!^e4z&K?!^M4z' K>@O?k?o7Yk?! p 4z0^k?K?!^4z@K?!^4zK?^K?!K?!^4z`K?!^}4z K?!^e4z K?!^M4z K?!^54z K?!^4z K?!^4z PK?!^4z K?!^4z 0K?^K?!K?!^4z K?!^4z @K?!^u4z K?!^]4z0K?^EK?!K?!^-4zK?^K?!K?!^4z K?!^4zK?^K?!K?!^4zK?!^4zK?!^4zK?!^m4zK?^UK?!K?!^=4zK?!^%4zpK?!^ 4zK?!^4zPK?^K?!K?^K?!K?!^4zK?^K?!4z@k?^uK?!K?!^]4zK?^EK?!K?!^-4z K?!^4zK?^K?!K?!^4zK?!^4zK?!^4zK?!^4zpK?^K?!K?!^m4zK?!^U4zPK?!^=4zK?!^%4z@K?^ K?!K?!^4zK?!^4zK?!^4zK?^K?!K?!^4zK?^yK?!K?^aK?!K?!^I4z`K?^1K?!K?!^4zK?!^4z@K?^K?!K?!^4zK?!^4zK?!^4zK?!^4zK?^qK?!K?!^Y4z@K?!^A4zK?!^)4z0K?!^4zK?^K?!K?!^4z K?!^4z K?!^4z! K?!^4z!K?!^4z"@K?!^i4z"K?!^Q4z#pK?^9K?!K>@O?@ @K?@ @k?ok?k?7?1k?1k?)k?!!0k?944C|@ K?9 7B *7?6`Hw bB *7`?64c?`Hw?@K?YK?K?@O?Zi4eԠH>7Z94?ԠH@? u4k?ok?7#k?Z7:k?@w]QK? X7K?4\I4y 2@]4?744K?YK?@O?7KYC773 WǷ@44?@7?Ƿ#7.& U KYC87?'00N9F8G'I  J79YC3 X6?Ǹ_M w @7? ]ǽ2KA4<\C XǸ_@4?@7?k?oK_4C7Cx x7 b@Y7v3 _ǿ@_4zHC4] 2ϟ@K?Y4``J4r@:6?7 aK?Y@O?ϟK?YϟK?Yk?74_ 24 4X 2ςK?Yׄ4K?Y@7?_ @K?Yk?7N:N!JJ ‡FF BbB B@ "_@K?Y@7?#7"6#7#Q7\#1u7<#]70"qE6|`"-6k?7_ @_7K?Y@7?7w AJ 07\6 (@?6@4@k|9k?ok?7c AHw :HyYMK? :4cH?Hy4K?Y@O?H|k?ok>7#4k>4Zy7>k>#7>  Kw9  #Zk>K>^?*E,K> p7K>?@Z"K>@P4yȜ84K>@P7>7@ H7>4K>YK>@O>k?oK?7Cr Z:7? 87='Hz'8G'FC |K?Y@O?Ku=Ks= k?k?ok? k?k?k?!k?) 7Ck?404 \ 1k? 44c 4@4#4x#4@_4z! @Z4z0 _ w 67B7 @ R4@4 Z@_ 8"@?7044K>K?)K?!K?K?K? @O?C48"Z|4_77?7?_45? b K?73 VǶ5?@J w  TǴ26?` @ w  Yǹ_6?@2 w  "6? x ' (4 w 0H64`4@| S4 y X@ w 6  <]m7 w  Z Y? w }? 5?4\ 7\ w  w < w 6 u < w 4ZI4z77?7?_m4@y4x: (K?4Z4y44P4Z4x4k?ok? k?k?k?!44k>k>KEXk@XKFPKD`KCpK>kPK>k@pK>k xK>!C`!BT7?QK>K_^7>A7?Q7 (@K>7>A7?Q7 @@K>C "K>7>@ (7?Q7K>KP 2#7`B7?QK>jPKX 2"6B|7?QK>@jXKxB *#7B47?QK>jxK>7?Q@`4K>hPK>k%XK>kD`K>kpK>K?!K?K?K? @O?k?oBx7CHz@ @Y@Hz@ @Ye@K?Y@O?k?ok?k?k?7C@7$44zZ4HH @H@@4H0!jH Ax4H8" H(B4H"H B4H@#RK?YK?K?K?@O?C  |HY 7Ch4Ha% \4HsHe  ZY4H@e_m@H0C u |HY % 7C4H 4HtH  Z4H _wHH8C  |H E Y@7C4Hx  <4HuH % Z4H(_e@EHCH -h|HY5 7C4Hz E 4HvH  Z4H_wHHC4h|B7HzBHeK?Yk?ok?B h7CHz@ @Y=@ `h`HHw H`X4HHw  Y@HwH4_@YHzh`Hz@ (@BH@Y]Hzh`K?YK?@O?k?7_k?_5K?K?Y@7?k?ok?k?7#_-7 4Bp4z84#74Bh4zHd4K?YK?K?@O?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK27D7%B_744444)4 7l!ak>7k!Qk>7j!Ak>7n!1k>!57j3!4 4?47W?u4? w ǚ6\ C(b _ AǡRH6V B((@ _ VǶ_@k?444A4x (7H Y4A6YH^4 rk?444A@4xH7^4 6S  06Qh`_]@Hp Thp 0HH7 Hy@ 82H6 @? ?@HC0 7  bhh44@|4x 06Q (7H ?4A69H@ ^_HC (4 244A7?Y P7Hǡ K>@K>BP7?Y4zB7?Y 46B H4^ޟ4^_ BP444B4x$7H^_HC#7 7?A4AX47B7?Ak?B7?)k?B7?A 0H447?A@7?) (7H "4AL69Hǹ@K>@K>B87?A4zB7?AHXB5B07?)4zB7?)HX7?hXHP HX*4zB`7?)HP6?hPB7?)B7?A 4H@ @9 @B7?qH52 44A7?qK?qK?y] 75B7?q4zB87?qB7?q P@H^rk?44k?4@h4xHPH4ZҠ_4 H7H^r44A4x47 ! bHƿ@4^_ A444Ad4x74 !*HB_@67W? :H^"44A4x7 H H` #7 B@4zHp@ ZHoHp "6B4z_Hp7B4z5<K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O> %@k?ok? k?k?k?!k?)k?1k?97& k?A740B77?iA44 !x4K?i A`44x4 7 7 K?A4_4x!7K?i@ 4B 4zHC?m@7 4PB 4z`K?iK?A4Ax7? 74zB7?B 7?K?i4_4 HsBz?4| 4B 4z4`B 4z4K>K?9K?1K?)K?!K?K?K? @O?B 7??GHsK?iKu:Ks: k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Y77#k?i 4pk?a47B k?qHz7_ 4C4(0x47h"7i"4 4K?aK?i4y@PK?q 7HwB( H}Cf!44K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O??4Y Hz474 LY (7 Hy_=5x :5? L@>H}UK?a4K?i4B 4 , BK?iK?i4B H4Hx  yK?i4B 4Ht6 uk?ok>k>k>k>K747#k>B!j4!4!r444!4#K>7 PB 4Hy7: z_94z7 "67?QYE4K>B7?Q@ * "HC7 0 g44K>YK>K>K>K>@O>4y_}4ܟ44k?K>4A4yܟe44? jB J K>4 PBh4Hx7 } 4̂5@>%@_4z@k?ok?K!7#4k?@?? "4y_4 K?Y4ڋ_ :#K?7 PBX4Hu6 vHtB7d3 YǹX@HyK?B4Ha45 uB Sdz_HyH|C4\ "qK?6yBp4Hv6 yC? XǸX@HyK?B4H|7 tB ]ǽ_HyHuB4ʊ #K?7B4Ht6 xC WǷRHyK?BH4Hv6 sBb ZǺ_Hy4K?YK?@O?k?ok? k?k?k?!6K77$k?1B47E!46 _4 87H H`_Y4 4|!4ڊ :#7 PK?1B4H4 "6K?14Bp4_ 4@`4|!r`4|H " BxK?14|K?1BX4h4|>@K?14_4|(4|\ @ g?aK?17?aBX4K?14B844| _ 4>@#Q7YK?1B4 `4|#1K?179B4(4| *K?14_m4|4| !4? B4k?K?144@4|4|_ 477R 2#K?17A4HB$4k?9H7Yi4K?9 F _H (k?A"K?16A4K?A 0K?1AK?!K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>K>77)K87 97CK>6444 $4 A44z7I?C40#7 ,_ 15:$7Hy @HzLD_5:$H$ A4 $Hx A5z"4z@597A7?1'r'44z595_5'7 II B 46Hx <6Hw Y5IHu 4AT5A5K? 5kxd4J>7?17 ?4z59_ 4&7_!5:_m7YI:WK? 5A4I94A5 p@B5Ha+ \5Hv YI9Hu I4 u /_ 5:Ak? YI:K? aHpǰ8 !I:5[y404  @I9K? A4 @I9K? A5zI5K?  ? "6 A47? @5:!"5A7?1YK>K>K>K>K>K>K>K>K>K>K>K>K>@O> zK? B| h|K? 4haK? `2Hs  7K? @K? a4 4 4 ! 5A4I?C;@7 74z59@T7?1=74A7?1=@K?9K?1 YB 5Hs k 5H} Y K?1H} o 7?1 @A@K? 7?qA7O4z @Ad54 *"6A4`@HBz?4|] "6A4"6 Ad4 0]@HH ? 8484zAh4 5k?ok? k?k?k?!K_7G7$K>76^"q6y ^4  b7 }^e4z""H   C4X!@H^_ 40^4 P 4@^4 ( 4 ^4 H4" b^]4z!BH   @C4 7ς z4P^4 ` 7 f^4z H   C4 4K>K?!K?K?K? @O?ˀK>7ς }ˀK>ˀK>7ςm yk?ok? k?k?k?!k?)k?1k?9KH7#7EK976h 8 & 4#7?Ik?7?A4_4%@A t7?YHyK?A *A4Hh_ HH hh!5 A 44K?I4 4 7?YA @K?IC7#R!47?I@7?Y$*4 t44y@7?Y 4A ,7?YHsB 8 4`A 4A 7?YHCR" 777! *44yA 87?Y?/44 A |4A 7?YHC70 w0K>7k?I7?IA 7?Y"z847:\4x @Hy <@ @A 44(HyHy4A 4Hy4  hA 7?YHh HH hh 4 A 4444 4 44yA7?Y>4 %47k?I47?I@ |7?y 5pA <7?Y7?YA 7?y5A 7?YK?IC j7k?I7?IA H7?Y :4A |7?Y5`A4K?Iu7?YA@K?IH4"?h5 A$4Hj@ Hz4p[4 zHwB4V ZBB B7z9\y "4Al4@HjHh7hh4HyA4Hj F  K>K?9K?1K?)K?!K?K?K? @O?k?ok? k?7#4k?!7:^k?)77ȠJYHz@0@K?!K?)4y_u444K>K?K? @O?k?ok? 7C7?k?4ATk?A4zk?!K?4z_7?!@HxPK?HsXrHh K? 'k?K?A7?H}X0@HyP76?hvPk?K? $848A 4zK?K? ? 848K?!A4zHb@߿7y!q@_7y!AK?K?A7?4A7?4K>K? @O?#K?A7HzX7U?huXk?ok>k>k>k>k>B67#k>K%7D4"H^޿^_"6^ 5"h@A$7>K>A7>44Y7>7>^E4A!z44K>4yA 5K>4_ 4y! 7 eAlK>K>A<7>4^7>5C @C :7C b?7C?7 ("7C ?77?A@>4_7>A7>4K>YK>K>K>K>K>@O>4K>44yA05Ÿ}4Ku>AKs>I k?k?ok? k?k?k?!7#7DK:Xk?14Z"Hz6Z%4  2#Hz7Z4  @Hy7: z4hx#@7s3 VǶH"4(ȠhHPHƟ@ ^_b QHz4YZ%4"2H}7 |4hPX HzZ Hz4pZ4!*HtB7z9Y\I@!HCC!bC4 R7 v4K?1hX4@4y!@44 7 u4K?1hP4@4y 4H^ _@ Hz4Z4=HHs6a a4hXHf44\47 7C?7 4? 2#7_u4@ 7? <H`ȠHPHz!J@7u3 WǷ@:4 *4_ 4? 4 Hƿ@ ^jǷb4 f^4zHyA0K?1XmHzHt x wƿ@:^"^_HP7^_hP4 bHƟr@4v Z@4< BX@K?174_ 4y4_@4 @4ڂ *4 b@4 }( BX@K?174_ 4y4!@7t3 VǶ@4 ^޿ ^_K?1@4z!@ 4@?4#Q7Y^4 7B0ȠzK?14_ 4yȼ4@ 2K?144y_4ȼx44HP HX BHyK?1A4XHzHa  b4K>K?!K?K?K? @O??4EHPKu=aKs=i k?Ku=Ks= k?k?ok>k>k>k>k>k>k>k>k>k>k>K?47#k>C7D4 P4C7z9Y[@ HC#@HC C :C4 + "C4 C"4 7 :C4 "C7z9[ ҙ"HC `@C!ә[50 *7i9Hz_}59$x7 Hz4PZ4'HHz4Z]4 *HC4҃'4̂'44K>YK>K>K>K>K>K>K>K>K>K>K>@O>_7y97HyK>A5Hw  }7_7y9Ɉ""Ƞ4Ha49 y^ 4&7Ƞ47 sHX6hXHC: 7 jJ A_7 iA?5:!7h!7i!7j34+4 4 J ( k?K>44@ 04yȼ}Hzk?K>44k?_4yȼ5Hz _ XǸ@^q4zHzXm7}HyHz_7y94 ZH=@H`߿95AK>Hy7: zHzC_>m@ qA(4y%4Hy78 x4 C R4 4 k?K>44@ 4yȼ:k?K>44k?_4y7!rȠE4^a4z@7X UHz@ Ƞ4@@Hz5pZ 4 HC46 CC r[]5: P@K>A @5HbF  z_59@HHyK>Ax4Hh   H>u@7 yH߿7y!K>_7y!A h@X HzHyK>7A 7H}  b7W w^)4z97Ƞ44pX 7?!K>A 7?!K>A 4X4X HzHz \ E a7 nA 87g!4 (7g! R4 4 zk?K>44@ 4yȼjk?K>44k?_ 4yȼ(@K>4@ X4y7 "HtB Ƞ 4K>ᐠ A 44k?ok? k?k?7F6k?!7#A6Hy77X4 H^Y4 87K?!A 4Xu4 @HyK?!A P4X54Hw  xK>K?K?K? @O?k?ok? k?k?k?! 7CKZk?14Z4" 4H}7k?C 47?^@!K? k?C C 7k?K?Bv?7?Hx7 wB@ 44z^)@!7XHz`HyK?1A 4Hw  C H@CF 0@K?1A4Ht6 gHuB ?4zK?1A4(4Ƞ4Ԡ44K>K?!K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>67D7&@7k>4 4 4 0@HPӀ_HXӇӀ_'AP7?9A@7?QHB4H#z6 ^4 H |@r44K>YK>K>K>K>K>K>K>K>K>K>@O>H A7?9 c5I?7m"1k>7z"!k>4 4 5,A7?QHCW 4 7 HCw"k?44k?47?9_ 7?Q#7K?9< Ap7?9"4 @ZJ^q4"744_=7?9PK?944@7?Q"877?9A7?QK?9K?A ? 848@ 4 `2Hǵ K>@K>A07?9}5)?K?9 ^4 7Ƞ4B4?67?0 Ƞ4 ` g?1[7?1HC74 7 H7 <@4=H7 ^ 4 H }'HȠ-@4K?9K?A ? 848K>@ 4 zH߿7y"A_7y"Q@ 7?9HX!159@7?97?9@7?QK> "4z@l7?9h@HbHfF 2HЀ߿7y"aЀ_7y"q@<7?94zA7?9@t7?Q@d7?94KA@773 S`_ˀ7?5KT6WB ]ǽK=46B S \6? dz_60V0=4@k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7D7&k>@7?1@7? @K>7b"k>7m"k>!Q44447i35J!q4 4 44T4LHB?7? 4? Q 4*?HHC6?QB4 w)4 )4)K>4@ 47`04@? @|K>K? K? R#Q7Y@DK>K>@7? @|7? @@\7? )`04 4|6 HǴ@5y @7? `04?6 5y@7? `046 K? K? H@C ( *5yp@7? 5y@7? 5y@7? HCM *444^7? 7HC 7 5y@,7? 6 7>_ 4 K>H@@"4=WK? hK>H 7?!Mk?!6 K? K?_ H@C ( *5yp@d7? 5y@7? 44@ \7?  (@HC (0 Ƞ@&J;U@7E 6 045y@D7? HCS 84HǼ K>@K>@$7? HC? ? ]ǽ@^4 k>XHK>@ Ƞ@H@l7? HK> X 4 4! 7?Y4_47?Y@7? 5yp@7? @HC4 4 4? *^aH6 7H7 4CS!Ƞ5@ k?@7?qk?444^7?q8e7K?qK?y 8@7? @T7?q5yp Bk?444_ 7? >=7Ƞ-@"44@<7?  HC Ƞ@7 HӠߒ 0/K? K?_ 5y@D7? ^6:7@7? 6 HbK? K?Q 5y@7? HB^q:7@7? H6% k?K>44_ 4ȼU@7 7>_ 4 K>H(vGHȠxK>7 ]}4 87H H`]=4 4K>@@@7? 44|K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>H " @dK>@K>@D4̢K? Ku=Ks= k?k?ok>k>k>k>k>k>k>k>k>k>k>k>7G7&k?977?A44@ 44 !Q4 4 4 44HC ( 8""#B#Hh@HHz_ 5Y@4zHB]5Ӛ7@|4zH6 4X 4c?%X 9H4H   4@7?9_}4K?94PX 4HhHo 4@ T4z4z@ <44K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>4k?4k?44^7?A74z@ ,7?A?47 HyHt 5Y@ 4z5Y @ 4z7 HxHsx 5Y@ 4z5Y@@ 4zb7 HwH} 5Y@ D4z5YP@ ,4z@4< HC:@4? 14< @47 HuHi5 "6@ t4z"q6yp@ T4z47 HtHh #7@4z#Q7Y@4z47 H|Hk| #179@4z#7@d4z%47 HaHl, "6@ 4z#7@4z47 HvHjV !5@4z!5@t4z547 HuHf !q5y@4z!Q5Y@4z̨47 HtHe !159@4z!5@4z̪E47 HyHv  4@,4z 4@ 4z̪47 HzH|\  4@4z Q4Y@4z̬U47 HsHbS  149@<4z#7 @4z̬47 H}Ha= "6@4z"60@4z̬e47 Bt73 X_ȀH4 4C.77?!7" @X 8p47?!HB  6yH6` C9 ?HHA 4Ƞ47?!  H6M XIHH@ p47@7?q44^7?q @K?qK?y ? 8484@ 5H}Hb] !5@4z4z@7?q@4@D7?qȀu@k?ok? k?k?K747#k?!B 4 6 a@7404 *4 K?!@4 PHb4_ C7e3 _ǿ@׀4K>K?K?K? @O?4 ˀK>"K?!@D6`Hf4ςu ǿp@4&HzC_7y9c9@K?!Hy78 xC Sdz_@ #K?!@x7ςK>k?ok? k?K?7#4k?!C7D *4K>K?K? @O?7 s] 4z`7ˀK>#Q7Y@K?!A4k?)Hy7X4K?) E ]UH 8k?1K?!@7WmK?1(H}HyK?!@H4H}  tWK?)ςK>k?ok? k?KW4Z7Ck?!B jc9K?!@7y9Hv6 aHuB7d3 _ǿ@:ˀK>4V?Hu6 |ǿp@4%HzC_7y9c9@HK?!Hy78 xC Sdz_@4K>K?K? @O?k?ok? k?k?k?!k?)44HC!7 ]4A8h|@"HC!Z7 444z7CK(7%7@7H_-@Hy7? ph}ˀK>A 4h|@(7Hx4z_a4 ˀ(K>@44K>K?)K?!K?K?K? @O?ˀK>Hz@?@@x@-HxHy@84H 4z@5ς5K>k?ok? k?7CKZ7@ k?!Hx@HH`b *4htHA40 | WhwHHzA ` |A4K?!77X4 `H@7hy@H} K>K?K? @O?k?ok? k?K_077Ck?!KX @b *4 hs0A4(0 | Whw0HzA |A84K?!77X Q4 H 7hy Hz _ K>K?K? @O?k?o7CKZ(H8@b *4 h}8AP4(0 | Yhy8HzA |H|(7h(Hx  K?Y@O?k?ok? k?k?7D7k?!6Ap7K?!77X 4f H K>K?K?K? @O?k?ok?KW 7C@jH6?hd   *W @Hw HHw _6?Hw(@jH6?hd(  *W U@H  HHw(_6?K?YK?@O?k?ok?KW@7C@jH6?hd@  *W @H HHw@_6?K?YK?@O?k?ok? k?k?k?!k?)k?1k?9k?AKG7C7$k?Q4X4!q5yp@7HA !QK?Q@5YpHC4(0 4ʊ HvcZ4!14 4 ("B7 C *7?_14 ˀK>k?H@ ^_Hy@4c]4k?CH^ޟ ^_K?7?k?K?cHs@czHx`K?4A?Ak?HyK?:  0k?Hs@K?Q@597?4z_7?a"H}@K?Q@87?a@7?aHt_-4K?7? k?H "HuK?Q@594z4_7?a" HtK?Q@`7?a@ 7?a4HC(0 <@Hx\@HC4ʈ" b7 HwB #1K?Q@ 79`#K?Q@ 7Hz#K?Q@ p74K>K?AK?9K?1K?)K?!K?K?K? @O?ˀK>7?_4<7HˀmK>ˀ]K>ˀMK>ˀ=K>k?ok? k?KD7Ck@H7hwHe_}h`k?!Hz@ @@ `@hdHy78?hxK?!heK>K?K? @O?k?ok? k?k?k?!k?)k?17%K977D6 7@ 4z4@ 84zHz@4 Hs:@4 "444^ 4wH^ޟ ^_J HzWq4&0@HzWI4&zHeH `ZC4ދ BC49 *C7z9Z!@HbHz B *`R 4 ]=4 *HhA 7z9Z%9#HC4%@C%C4ފ C4$8$C7x3 UǕĪC ZǚĐ@C"J447g" DW 0@Hb 4Y]4%Z4?@K>HsH ` 74]e4 +447h"HxHz X E  Wu6?< *H  7]58#4?}@K>447g"H|Hh D  W6? *Hy 79]%5#B4?}@8K>4‹"C " 447g" DW 0@Ha 49]m4#J4?@K>Hg4 k?7?4_I7?i!0@@4z4@4z4z@7?i@(7?iK>7k?7?4_7?i @@P4z#7@H4z4z@7?i@7?i0K>HP7hP@4zK>K?1K?)K?!K?K?K? @O?HX4EhX@`4zK>@@4z4@@4z7f" @ 4z4 @4zK>@4z#7@4z7v" @4zK>@p4z!159@h4z7u" @H4z]K>@4z!5@4z7t" @4zK>k?ok?7CKZ `7$`@4@@4 |  | dK?YK?@O?HwH _K?Y _k? $  Y@k? |K? 7 aK? | E bk?o7CKZ@ "W@ ` ` `K?Y@O?@@@@K_@_k?ok?7$ 7C@ jW4k?4z_7HzK?W4HwK? hyK?YK?@O?k?ok?K?7$7CK7 Z k?_4zHzHW-K?HK? hxK?YK?@O?k?ok?77C Pk?4z_M4HzK?W}4H hwK?YK?@O?k?o7# @k?@ *W4zK?7@p4yK?Y@O?k?77?K9K @ ?K?Y@7?k?ok?77C k?4z_4HyHz7??_2C 7?Hz@K?W4Hz D h}K?YK?@O?k?778k?#7W7?QK?_7?QK>@7?@ @K?@ @k?ok? k?k?k?!k?)CB77$#7W7x1444Z44^4\` _#Z J4~V#4T%jc@ V#"ςpK>@%`߿ ($% @?%B60B4 6046B64A`_ (@B6` @%4%Bc6 `$] jB ZB`_ (6B6 $` B6cĂ B6 ( r4~4^4T @!# @#B6 ( E84!4ˀK>قb :@$B@6 86b?@ ZςK>@ @Bc6 c@ "B4@<]6@#Zǃ 4^#R4K>K?)K?!K?K?K? @O?@!R`!R`߿ (7$ "`/B@??BςUK>6?k?1`_ (@B@7y1`&  @7g14 `  *4xK?1__%4 4@?@ςeK>ςUK>ςEK>ς5K>ǣoB@4\ςK>ˀK>ςK>ς}K>ςmK>ς]K>ςMK>7@*c  @7%|@b:/4AςK>ˀK>ˀK>CW 07\ *7C?@4@k?ok?k?4?KwKxKy9 h x W W  araX4 P6? D X Ҥ `6 e4c_7`@ V   ֠ 476 m7 ` aH4P6? X ҃7 @67 D_4B`@ X  v 7ր 4\6 m7 7@ } Ku9Ka5kuK| kbK?YK?K?@O?k?ok?4$k`Ky9ky77z*Zakyk|@4Z 4bHkz4V b(k`0k`0k}4|K?YK?@O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K>4'k`9K97Hk?K>7$7k? 6 4%Kt9 J4 0kj945_474k|9K 4#C!0@K9Km hkKn hkKo%KbKwW%% @_54K9 8kkhkh9K9& B4ZU&B&6 (4 0Z4 kv #*K}9 4 ZB :K?"B _4"KmA4 44 84 ?4z "5A ?5I:4!51KyY - BKJ:W !Z@0 6*61 J:@?}6*ku9 6 kp9kjAW 24z "5JAW ?5JI:* 4 KyY * BKwI:W )`05+5) I:@?}5 6 46* #:@#K?@&Kq9 B &rKrB__4&BKa49ky4@+j_5YKC@0Ka94,@0kl9郀&4 t&C4= C4vS'"C,C+C+k9Ku96 kj9 (kK9@z C4Z C J7`8k9 C?7C ?7k:K9" V6 Ћ:WK9Ks96k9KwKx ( 8_4khKKw (k9̟4Km0̟7kr9 4hkq9Kh9ـ BK|9Ka? Q H4:@4Y V@WyKzKd k}k`9Kd944~kp9Kv96k9A! IW 50kf9Km9ـ !7? CKa?щl 84:@#HIWV7 @@IWk? 149CHVWKzKb ksICkc9h4~ "@7kb9 kh9WKzKeK? k}K? I_ID  44Kz9ـ :7?Ka? H"4:@VU6WKzKx kxIZkz9@0tt4~4Kq9ـ Kl9 Ka?4:@C 2"HKwV60@+Krk?"6pCHV5k`9K97kz97e*1ke4~Kg9ـ zKqKa?р 84:@!H5V5W(+!H5Ve5Wkj9X4~C4 44 04 k9K|97kj9_=kjK957Kp9ـ 8@Ka?"H4:@60V5Wkj9@ 8t4~`4545+ +Kf9ـ :Kv9Ka?"q H4:@V6yV=KzKa ku4~Kr96Yky9 "AS I 5Iki9Ke9ـ 8@Ka?#1HIw4:@V79V]KzKx ki4~ 0@K9A*7ka9 kj9VKzKd ksK? K? @ -IId  44K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ko9ـ :7?Ka? H#4:@V 7VKzKn kl@0tt4~4k`4k`9k` "k9Kt96ki9K9 Ky9ـ 8@Ka?!H4:@50V 5Wkj9@ 8 t4 ~k`d7kn9 km9k?7K?k?_ Ek?K?Y@7?@ @K?@ @7V44_774666x77Y7!4=74 44477w4474 b6b:b8b<b>b@@6 @ @K?@ @k?oY4 (744|K?Y@O?YI4 | 274  wV4z`u4|@ @K?@ @k?ok?k?k?4@4744z  | f7C 04Hw7$Ԁ2X4?gHy@7HsHz d  thu7K?YK?K?K?@O?XE4 7Hv7H}m |@ @K?@ @k?ok?7CKZ@ VKD?4V4zK?YK?@O?@ @K?@ @k?ok? k?k?k?!k?)KE7C7$ 4H 44H?H H!2Hz 4KH r F84V 5@54?}@]H[ @]HK_V @507G5?/KH d04 g4 sHHz V KE?4 dH @HH@?@ g4 vK>K?)K?!K?K?K? @O?@ @K?@ @k?7Kv@ k?7ZIK?K?Y@7?Ku>Ks>  k?k?7K: kz: _4k|:K?Y@7?k?oKs: (7C_E4Kz:( \_4+4= k?Kx: Ka?k?C4:@ 7w*A#1 2@7w*QV79@_-4K>@O?k?ok?7C@04X4z 7_4z4K?YK?@O?Ku;Ks; k?k?ok?7# 04 X%4zȜ@_m4y7 @_4z4K?YK?@O?k?7V k?7_]k?k?K?7WqK?K?YK?@7?@P@K?@ @Ku>1Ks>9 k?k?o_k? 077cK?# 7V 54zK?Y4|@O?k?/,/-/.ok?97C4@"(k?@"K?BP4Z":cr@x4" 6.`7?a \ &00N8E&E_7?aa"#Q 7T. . 7?aK? ''001n0N 1A 'I9 @B7`!7?a$'('(08G'0G0N9E'8E0 8_7?a4K>K?9O?1/0./0-@/0,7:B04` K|:ˀK>}K|:mK|:k?ok?XU4(70`"K?B4z04K?Y4|@O?k?o@ VKC `?4zK?Y@O?k?ok?7DKZ7#K]KS } `@K_77? ҕu B 4@ P4HK_4xKVB `  H4ˀ K?YK|:?HK?YK?@O?K|:?@k?o7C_4 7 K|:Hwk 4 K?Y@O?K\K @_K_@KK_@K_K @kK_KK  P4@ K6? \0@4@KWJJ@  k?ok? k?7DH7k?!4Bk?)!@7HK4KK?) B pK?!!@H H? J@@ _h H(7_- h( HH(6 h4H( @Dԃ DK>K?K? @O?K|:A4K|:H(4h 7A4eK|: `BKW7`2KZ( Y CӳK@ˀ@k?7X 54 0K?Y@7?k?o7CKZ@ _@V4zK?Y@O?K_ KW0Y j Y@k 0K\K ??@@4@K_0?@kY0k?ok?7CKZ0Y 07$K__h0Hz0D?@K?YK?@O?@K\0k?ok?7DX 4@ 0744|K?YK?@O? d44h d ` `Ah`0 h|8`}4|Hw X U ڋ?Mh|(A,Hz8`54|k?ok?7CKZ0@ _KD?4Hx7?`2H( A4?@VHz(_}HzALHz8Vi4zK?YK?@O?KuAX4z 4z_K?4K>@O?7?a@4z?@H|C?4z4?w4zK?a??47?iA4z?M@%4zk?ok? k?7D_7#k?!H44@_ Pk?I4 b4"4@4y"K>A 4"x `HC@0C4!(@H76hK_KW" 6`A "47?I@4!4H@94  0@K?!4_=4!X@A4!:K?I04 }4A4y?GHK> `7?I@4 @HC<4 p@K?!4_54 P@A4 2K?Iz04 z@ `4K>K?K? @O?K|:?@7?Ik?ok? k?7Ck?!_%4!7Hd@4䃟 4? 4_!:AD40!74z@4HzKW4@KTA  z4HzK_4KSA  !*H_m4zA4P4Ke:?HzH_4zA4 jK?!@4z H74z_U47044Ke:4K>K?K? @O?Ke:k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>7C_=7$k?aHt4k?B4&44`4 4 4 4 ! 444p4r@4z"B HsBu "HK?_}4z!HtB@!:_(k?a HQ@* ?H@R @ (K!" HzK_5KYA ?  ˀJG!A 4z!"K?a04 4K>7?a4zA`4 ‚K>HtuHs 1 4<pK|:?@pK>YO?@AT4z?u@0K>Y@0# @ 7K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>k?7KB4`@_ @4r`@`@ bhK>4 4! 8?@@04K>@7?4Š44_g44Ƌ :K_C0C4074@7??E@54# 7@k?o7C47?@4 @K? #1 p7<Hx8@4z H@HzK_KWHx8A  44K>@O?K|:?@4KuK? @O?K?K?4@HK?!HK?_ 4 |A4ˀ}K>k?ok? k?k?k?!k?)k?177D k?A4H! JHC4܋: *7hK?AAd4Z!4`4H444 rHCH @" @H h 7hCAK?A?HK|:" 6K>K?1K?)K?!K?K?K? @O?K|:ˀK>k?ok? k?7D77%A74zA4!r@ZHC!b7hC9Ad4z!BHKvЈ 1 4:Pk?!V HdK?!74X 97 r C4\ 4 4Hw 2C4 # 7pA4z4K>K?K? @O?K|: Q 4\K|:k?ok? k?KW67kVB6kBB47D7w*aи"H64`xB24rb"HKA# 7pKSA a "4_40 `K>ق#@#"ӽc4 7?A \$A00N8E$IE IR\7Ӆ ] HB3Bց ?-֝ ӵ?@ Hg?HKA" 6K_At !4HKVKYHA4 6 !p4Hˀ a4 8 B" 6].K|:=@K>HK\" 6pK]At  `44@\@0 `K>K?K? @O?K|:?@4K|:?@]HK|:?u@uHg? Q E4\ k?ok?k?7DAX44 87Ke:4K?YK?K?@O?444_4yKa؀!@HK_" 6KYA\ ? 0Ke: HKW4xKTA  4HKS4K\A  (@AP4z4Ƞ4Ke:4zA@?@e4Ke:?4z=Hk?ok? k?7CA044 x7Ke:4K>K?K? @O?Ke:! A(4?4(4444z_=4K؃?@HzKW 1 48KTA 0Ke:?=@HzK]4K\A >+4HzK_4XKSA  A44_4z ȼM4A@4 k?!Ke:444z_7Kx؀ @HzKVKDK?!A  4HzKC4KWAt  (@AK?!4Ƞ54Ke:K?!A@?@4Ke:?K?!=Hzk?oK_4C h7C4Ћ7 7hz_4z z4z_4 RXK?Y7h}_4z "4z_q404K?Y@O?"q 6| k?ok> k>K_47CC"7hz4_4z%7HzKY# 7`K]A %r47>i_=4z%74K}Ћ,7hsHz# KTKE A 7,44z_I@$x7@4z$X7_4zk>!A4#(7444z_e44_ 4z 7@@4z7"@Hz"q K_6x@KSA  "4HzKYK]K>!A *Ƞ`K>!47*7hCҕ6?{4?#Q 7U( Ke:"RA4"z4Ke:"b4zKe:"B4zKe:""4zKe:"4zKe:!4zKe:!x4zKe:!4zKe:!h4zKe:!b4zKe:!BX4zKe:!"4zKe:!@4zAK>!Ke:Ke:=oHzK>!A@Kt؂=@HzKV4@KUA =+4HzKU4KTA A444K=K>K> @O>Ke:?4u7>i7hbHz 1 KUK_ A48<@44z@@?%747hdHz Q KVKW 4XA0@<_+44z@@>7u4Hz7hw# KBK] A7Ѓ;+44z@x@=747hxHz" KDKS d A6;o+44z@@=U7E4Hz7he K\KX  Ah4 :+44z@H@<747hHz KAKY ! A4P:}@44z@@<%74Hz7h| KAKX  A84p:@44z_@;74_4z;e7HzKT4K_A 9+44z_i@:747hvHz K\KW A49+44z_@:]74_i4z:57HzKS4KEAp 8+44z_9@9747haHz KBKY " A4Ѓ8'+44z_@9-7_4z9 7HzK]4KDAH 7+44z_@874Ke:844zKe:# =7P"q %6ek?ok?K_47CC!7hvB?4bcz4fCh@HzK\KAHx8A H< #@4H7hyKxCЗ"6?HzKW# 7pK]AP "4HzK]7a/KT $ A "4HzKU4KVA "ˀ44#7huBӟ4`b4dBrHzKU4KBU A`@"H4HzKVK\Hx8A X "04Hd4hxKw@_ 7?HzK_" 6KYA ` ? !4HzKY7b.KS D A  y !4HzKT4KUA !44K?YK?@O? 40K|:?@HK|:?@HzK|:?e@%HzK|:?=@-4 Q 4\K|:>@HzK|:>@HdK|:>@HzK|:>@5HzK|:>]@M4 q 54|k?ok? k?k?k?!KW47Ck?1B7%"44?!4_#:4%4! @@4z 87HyK34K=  44K>K?!K?K?K? @O?Kg:?4HKg:?4 HKg:?g44z4z@H4?%7?44Kg:#@HH4X   A84?@46h|4z_e4>]7HzHA X4T>o+4H4 4K?1_4z=746ha4z_4=7HzHA 4L=+4H45 6hv^U4z= 7@4z<7^4zHzC_4 (7K?14z_44 "4z@x4@@84z h7^U4z H@HzK_4@KUA  Kg:HaH4H?  <@# HzHAP7Ѓ<_+4HzHA4 H@HH4X   @t44Kg:HvJ# 7 @J  HzK]KWAP :+44z@ 4:-7H4_ k?ok> k>k>^m7Ck>!Hx4z4C_k>k>)4``з4r@4 4"j7>@4z"(74@$407^4z"k>14z@ P4HzK_4KU@ $H9^u4z@44HzKY4@KBY A8@$44?^4z_4z#7K>1^4zK>K>!^]4z#P7(4zHzKT" 6@K_A( $4H|7h_4z"7??K>4z4‚@J4`:4䀶 *@4z"P7Ȁ(4z6?4? 4 +Kf:#Q 7F4@4z>74@04z!7Hb@Z4U>@K>K>!^54z!(7@4z>M74He@@0@` 4r@ 4!7>@4z x7Ha@94 *@4z=}70444z^K>)44K=K>K>K> @O>Kf:?4HvKf:?4X4zKf:H9^4z@4??4HzKf:?454?@ 4z>7H|4;@Ȁ4zK>!7>_4z>}7ȀU4zKf:>_4UH|HzKS# 7`KF@, >7+4Hv6hf_4z=7@He4hw_ Y4z=u7HzK]4@KE@ =+44z_E@=77#1 7&k?oKW7CB4X x4‚@ 4@ Q 4\0K?Y@O?K|: @K?Y@O?6h|_ 4z04K?Y@O?7},  " 1 K?Y4<@O?HzK_KY@ ? ?+4HsK?Y6tˀhtk?ok? k?k?k?!k?)k?1KT7C7$B4 4@4H4 44@4!Hs6aha@?! b HaH6? !4@@<4!hK|:Ha"H7? !4@@4 K|:@4K>K?1K?)K?!K?K?K? @O?H^4H7? >_44@@4>?4EK|:5K|:44@4>HsK|:44@4=HsK|:k?o7Ck?^4!HtB4: rK}؀ H@HzK_# 7KW@  p4Hs6uhuK?@p4z J4z^404 K?YK|:?HsK?Y@O?k?ok? k?k?k?!k?)k?1k?9k?Ak?I7DKZ(4?KAKF7% @4P!z4 HC"4" 4'4!1 4 @!^ 54 4 _4!@^ u4Ka7I7? U!4@@l50Kk:75|K>K?IK?AK?9K?1K?)K?!K?K?K? @O?Kk:`?5|mH|m5|IH 5@   H!"7hHC 4c>@HKB4RKH  @ @!J4 !b!Q u5K4 8@HH@5>@Kk:@ 5`?H5|`:HK_58K]@  :4 4_ @>}7}5|Kk:`?4U5|Kk:`>@-5|` !1 `05+@5|k?7^@04K?Y@7?k?ok?k?k?7%7D^E44!4HC]Ӻ4 pӿ4`A4ra @ L4!7444_4y7! !j!"`# 044K?YK?K?K?@O?Kf:?@@Kf:?u@(H^U4 @@4 p@^474^]4ܞ@ܞ4Kf:ܞ4ܞ4_ U4>}7 P@HK_" 6KS@   Kf:HH=H? 6?= HKY4KE@ =+4`>@HKW4xKBW @ |@=+4HK\4KS@ |  @`K? @O?HzK_KY@d ?  4ˀK>K|:?@}K>k?ok? k?k?k?!k?)k?1^7C4 7K|:K>K?1K?)K?!K?K?K? @O? @HzKW4KT@ "ˀ4zH|8k?A@4 h|8%K|:4^4z>@4x^)4z>@4& 444z^%@>@@H4z>m@^e4zHzK_77K]@  44^M59HuB>%@4|^ 4z=@Hb4AhaK?A@\Hz8he84z^M4ˀ]K>K|:>4z5K>K|:?4 K>k?ok? k?Kt7CK_ C4€@b4`RKe:!6?? 4!z4ăD!4҃"4؂"HzKU4PK]@| #44z_-@"7HzKT4RKY@ 4 #Z44@@#Xk?)Ke:Ke: 4Ke: h4Ke:@K?!!:Ƞ84 47hb@_4` p@HzKS#1 78KW@ ?+4Hu6Ƞxhv4b? RHzK]# 7K_@$ >+ȠHu q 4e4K>K?K? @O?7h|@4k?!444z^m7 H7HzK_KVK?!@  ȠKe:4 d8 HzKWИKU@ =o+@HK?!m4Ke:>4M4zKe:>w44444z^7 x7HzKAKBK?)A @H@ (@@XK?)4Ƞ4Ke:@(K?)?@4k?oK_4C!7C4 Z7hC4 j7h}^4z b(K?Y_4z04K?Y@O?_E4z?@4z^ 4?@47hs@H4z?e@4z^4?=@-4k?ok? K_47CC 4"@4z!744^q4z"7?94^4z"h@^4zk?K?9BP@HzK_4PKV@ 0Kd:"@_4z7!@HzK]4RKY@H = !4HzKYKWK?@@ #@@PK?h44>_4@4z2D44K>K? @O?Kd:?404zKd:?4xK?9Kd:?44z4=4?C4Ȝ%4Ȝ4Kd:>]@@K?>4HzKT4PKU@@ >+44z_@>e7HzKS4RKT@ >w+4K?9&>4HzKU 4K]@0 >7+44z_=@=7HzK_4RKC@  ȀE4EKd:Kd:='4 4k?o7C^4拀 4^4z @_4z p@HzK_# 7KW@  @44z^@04K?Y@O?K|:?@4zk?oK_4C 7C_ 4z BHK?Y_4z "4z^q404K?Y@O?47 Z7hsBz4?m@^4z?@]4z" e6k?ok>k>7$7C^4!He@4 Z4?k?K?4Y4z^Y4'(7#1 7<4`` 4r@4b"4B47?4H^4z?5@K>YK>K>@O>K|:?@4K|:?@4K|:?u@ 4K|:?M@04K|:?%@4K|:>@4K|:>@04PK|:>@@4K|:>@4K|:>]@4K|:>5@Hd7??4?#Q 7_h `4HzKU# 7KA@`5 ?U@ˀHHdHzKT 4 KU@ =o+44 4@HzKS 4`KT@ ='+44 `4HzK KVKW 8 @4<+44*@4<+44 HzKx KAKY @ ! @h4pYHzK\KW@ p  844z^404 K>YK|:?4zK>Yk?o7C^!4!@^A4z!b4^4z!@@HzKY" 6K]@ !4HC4V HzK_" 6PKS@ x   44H|7ha@4z JPK>7?^4z "4z@x404K>@O?K|:?@HK|:?@4k?oK_4C!7C7haKt؀ BHzKW# 7pKV@ "4HuB4`?@4r_`47?i4^4z!K}؀ "K?iHy]6!ZK|؀!@@HzK]4KC@ (}  jˀ4Ks؂`?@HzK_4bKU@  ˀE+`K|: K>و jKv؀ ZHzKS# 7KBS @ @ ˀ K|:04K>@O?K|:?@HuK|:?@=+`k?ok?7CTk?A2@4!@w4!^a4z 7Kd:^4z 7^14z4^ 4z X7^94zk?K?@@7 hKd:@K?^4z@4K?@4y Kd:@44K?YK?@O?k?7" k?6V4 P4K?Y@7?H?  @@K?ˀK?Y@04k?K?_m7?+@K?]K?YKa?# 4:@T7YI@K?Yk?ok?7$ 047C]4 d74  `K?YK?@O?k?7k?]-4k?K?_%7K?YK?@7?k?o7CT KZT4zK?Y@O?k?7K_k?T@K?YK?@7?k?oK_777C`7 Y7@  y]Hz |K?Y4|@O?K_@@k?ok?7CY H7$H_4z B4K?YK?@O?YY@HHzT%HHς k?ok?7C7:Tk?74z_-7 "4K?YK?@O?HzTmK?ς dk?ok?k?7C7X @7%HH  _m4z *ˀK?YY@HHwA`@ "_P4_?HvH 7   _6?` H|H w <  6?7?HtH    U7?77?HzH  z X HsH S y  4HwH TIHHHt 4hsK?YK?K?@O?k?ok? k?7C7%k?!TQ7Hu7 _4z0ˀHwA2 }P7?Hb W   B  9_6?` Hsw   VHt6?   !7?H}   Hs6? D z   \=7W?HvK?! T 4H| ha4K>K?K? @O?k?ok?k?KU7$7C7_60ˀzHwA2 }P7?Hb W 6 B  9_6?` Hsw 6 VHt6?7  !7?H} 6 Hs6?7Tz   \=7W?Hv  4Ha4"hbK?YK?K?@O?k?ok?7C7:T!k?Hx7  _4z "4K?YK?@O?HHw TK?Hy $ ςhzk?ok?KT7$7C_60ˀbHwHy 4Hs6Hz _ H}7huK?YK?@O?k?ok?k?k?77C7&` H x` Yq@4z_40ˀ4?AZY?P7??HHz  W  Y \_6?` HH}  t 6? HHv 7?  " E 7X?HHa:   } 7?HH|  Hs d 4 dK?YK?K?K?@O?k?7@@K?Y@7?@ @K?@ @k?7@@K?Y@7?k?7@0@K?Y@7?k?ok? k?k?k?!7D@"7%@"KcH @4&HyT4 bHc`?Hy" ZHyTi4#j(04$ 4T94 āHzVI4"@7T47V4 |"74T 4(04' 4T4 gT47Vy4!`744T m4Hz @TI@ fT47V4 | 74T 4KH (@KTQ4@@KH 0kcHˀ0K>`u@ (04< H|ˀK>ˀK>ˀK>ˀK>KeHH jKTa4`H@HH (@KT4_@H x H|K>K?!K?K?K? @O? _ : W ]  SV@ \CT x4@ӿ< 77Z<  @?@@Kuhe>hf>hg>hh>hi>hj>hk>hl>hm>hn>Ka?H&7$7H7 %4%0Kh:1KjH %IYS5 eIJ@?IY@%zIG@4^"!@Tq475s4 K?K?g~4` k?k?77h_5 @H4 D 4`5@ K?K?~  k?k?77h_]5 H?w5@$4W4!q05y@@ 07IY@ 7@ 5:75:@ 77T 5z7T i5 5 K?K?~4`  k?k?5y7@ @7!q05y@@ 77@ 55yP@ 7T 5:7K?K?~4`  k?k?A774 tp4 `55775)76 7,?5y`Se5!5ypSE5!45@ H5X 75@4!I  @5 @x4!X@ ?5!2A7 ("5)A7 ?5)>E@  ˀ84~4 !0M5 h44~Hb>YHn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>˄}hmhk?ok? k?k?k?!k?)KG7C k?1@4zHc`#Hh( H0"jHf$4HsHw d Hg$XH: GS=K?1DRĄX@H}7G? ܋ #D!HHt( Hu0 刀 6# @#*Hx7G? Ջ#D?Ht(Hh  Hh#Jz HS%K?1?-HHa Hy' Hc "Hx C HwH Hh!J HSK?1>HHb H}G Hc!H C TQK?1K?1_7Hs(76y Ht76y?Hb0 7 E 7@=Hyˀ8K>Hx Hc!H CK>K?)K?!K?K?K? @O?ˀK>_M@\E@_-@\@_ @\ H _@\E@_@\Hˀ K>_@\H_}@\ H _]@\@_=@\ G @4ś7 Ş'H| ˀMK>_@\% C L҇L HzH ZD:D  "0@6#0@7#10@7<#Q0@7\#0@7"q0@6|#0@70"0@6@k?o q0k?W 4zP C @W a4z0 C `@W 1K? C 0@W 4zp C04|`K?Y@O?C8X7? (7W6 ?7@6?k?ok? k?k?@ 7E@ 8Kc:1(04$ 4S4 @(04$ `kd:1S47V k?! 7K?!4T4kf:1 Sm4zK|:1K>K?K?K? @O?k?ok>k>k>7#7Sk>k?K>4k?7z7k>k?k?k?yk?qk?ik?ak?Y@pk?Q!7@ @4z X7S47V4"`74z4T4k?Y7?7? k?7?7?!k?7?7>k?7>7>k?y4z@4k?K>S7K>k?47k?QK>4k?K?k?K? k?K>k?yK?k?qK?k?iK?!k?aK>@K>! 7Ƞ4H @@4H H 4 `4 KX @@ J 4c ? ``4@44K>YK>K>K>@O>H @@4H jH  X4 K_ @x@ K:@  ?4?4S4z4 _ : W ]  SV@ \Ku;Ks; k?Ku k>k>k>!7D4@KZ@" _4"p77>_4 K>48bb@VyK>7" K>4g44_4!@ _ _4H B4% # 7 *!V48 !H7 H(4 !hHz"H!hHz H!hHzH C   !`Hz H C h !XHz(h(H!XHz0 Ch0Kg:A40kw:A_4K=_4K=K>!K>K>K> @O>S=4zK=_@\}@_u@\ _U@\H_5@\H_@\h(_@\ C S]4zSM4 Ku;Ks; k?k?ok? k?k?k?!Kd74%7C4&4tk?qKx:Y!:4K:aC 4 "7k:aC?7 8077k:aC ?7_ @( _?'k?qK:aC?=@>k?q4K>K?!K?K?K? @O?k?Ky7?q_4>K:aKKu;Ks; k?Ku k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=64 k>4K=ak>K=iSk>K>K=q K=yK=K=CCK=4xk>cC 4yk>ǃC 4 `_#ªS-57J (@S5!e6 J?@R4K=Y S56O U7#7K>K>5Sm4^K>K>4t_%566? 6@ 4CC*cCZǃCq> #ǣCr@$"K>7@ 5J>M@$jK=Q`$ZK>_K>7_4z@7>p֟t&a&i8G&qFq U 4:(#7P64ǣ@ 4@ `4 @47`4 4eK=YS5zM7S5ZU7S5:]7S4%7S}457S]45746K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>47@(5ycܥ@4\7@5Yǃq>4\7@59Eq>z?@ V47@h5ǣr4V7@04r4X77@4`47@4eK=QS56K>_K> 4 @K> @K> (K>J I K>K>_]4 0o4oAj6 o!:4  40 ! Ǐ@K>K>_=4 7k?S16Zk?K>76Yk?5k?k?yk?qk?ik?ak?Y_k?Q - K>6X_uK>5?575?~@6 M Ku;aKs;i k?Ku=Ks= k?Ku<Ks<  k?k?ok? k?k?k?!k?)k?17$7C4 4Ka?H?4'4h " <߀ : 4! \ 4"?5 4 U5!7!4 Ka?4'H `Ӻ! \ 0@ `_Ӛ `@H `!2 < `  4?%4c 4K>K?1K?)K?!K?K?K? @O?_@H_@H!1059@H4ܞ=@_@m@W@C8X7? (7W6 ?7@6?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK>76K>7I4K>4 K> K>y ` @ :C_ 4 4 r4V_ b4X R5)A? 8 (@ ( _8 ?5)K:: V4K?IK?AK?9K?1K?)K?!K?K?K? @O?? crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)? crt0: errno: tsd@Y%s: %s: unexpected end of file [bb_read_rec] 0x%lx->0x%lx (%s:%d) cnt=%lu %s: warning: ignoring basic-block exec counts (use -l or --line) %s:%d: (%s:0x%lx) %lu executions %lu##### -> Top %d Lines: Line Count %9d %10lu Execution Summary: %9ld Executable lines in this file %9ld Lines executed %9.2f Percent of the file executed %9lu Total number of line executions %9.2f Average executions per line [cg_tally] arc from %s to %s traversed %lu times %s: %s: unexpected end of file [cg_read_rec] frompc 0x%lx selfpc 0x%lx count %lu [cg_write_arcs] frompc 0x%lx selfpc 0x%lx count %lu ?[arc_lookup] parent == 0 || child == 0 [arc_lookup] parent %s child %s [arc_lookup] parent %s child %s [arc_add] %lu arcs from %s to %s [tally] hit %lu += %lu [propagate] toporder botches [prop_time] child with %f %f %lu/%lu [prop_time] parent [prop_time] share %f [cycle_link] is the head of cycle %d [prop_flags] inherits print-flag %d and prop-fract %f ends up with printflag %d and prop-fract %f [prop_flags] time %f propself %f print_time %f [cg_assemble] topological sort listing [cg_assemble] %d: [find_cycle] couldn't find head of cycle [find_cycle] dfn_depth %d cycle_top %d [find_cycle] [find_cycle] tail [find_cycle] new cyclehead [find_cycle] glomming onto [find_cycle] and its tail [find_cycle] glommed, but not to head [pre_visit] %d:[post_visit] %d: [post_visit] member -> cg.top_order = %d [post_visit] is part of a cycle [dfn] dfn( ) @Y?@Y@Y?UUUUU\???zG Call graph (explanation follows) Call graph granularity: each sample hit covers %ld byte(s) for %.2f%% of %.2f seconds no time propagated calledtotalparents%6.6s %5.5s %7.7s %11.11s %7.7s/%-7.7s %-8.8s index%timeselfdescendentsname%-6.6s %5.5s %7.7s %11.11s %7.7s+%-7.7s %-8.8s %5.5s children index %% time self children called name [%d]+%-7lu %7.7s [%d] [cmp_arc] calls %f + %f %lu/%lu %6.6s %5.5s %7.7s %11.11s %7.7s %7.7s %6.6s %5.5s %7.7s %7.7s %7.7s %7.7s %7lu+%-7lu %7.7s %7.7s %7.7s ----------------------------------------------- Index by function name (%d)%6.6s %-19.19s %s (%s)%6.6s %-19.19s%s%s ?r/n?r/nr%s: could not open %s. %[^ :]%s: unable to parse mapping file %s. No symbols in %[^ ] %s: %s: not in a.out format .text$CODE$%s: can't find .text section in %s %s: %s: %s %s: ran out room for %lu bytes of text space bfd_get_section_contents%s: can't do -c %s: -c not supported on architecture %s [core_sym_class] %s: not a function [core_sym_class] %s is of class %c __gnu_compiled___gnu_compiled[get_src_info] 0x%lx -> %s:%d (%s) [get_src_info] no info for 0x%lx (%s:%d,%s) %s: file `%s' has no symbols [core_create_function_syms] rejecting: 0x%lx %s main[core_create_function_syms] %ld %s 0x%lx [core_create_line_syms] %lu %s 0x%lx %s: somebody miscounted: ltab.len=%d instead of %ld %s: GMON_PTR_SIZE has unexpected value of %u %s: bfd_vma has unexpected size of %ld bytes -r%s: file too short to be a gmon file gmon%s: file `%s' has bad magic cookie %s: file `%s' has unsupported version %d %s: %s: found bad tag %d (file corrupted?) %s: profiling rate incompatible with first gmon file %s: incompatible with first gmon file [gmon_out_read] lowpc 0x%lx highpc 0x%lx ncnt %d [gmon_out_read] s_lowpc 0x%lx s_highpc 0x%lx [gmon_out_read] lowpc 0x%lx highpc 0x%lx [gmon_out_read] samp_bytes %d hist_num_bins %d %s: file '%s' does not appear to be in gmon.out format %s: unexpected EOF after reading %d/%d bins [gmon_out_read] frompc 0x%lx selfpc 0x%lx count %lu time is in ticks, not seconds %s: don't know how to deal with file format %d File `%s' (version %d) contains: %d histogram record%s %d call-graph record%s %d basic-block count record%s w[dumpsum] frompc 0x%lx selfpc 0x%lx count %lu \4P\ 0\h\L\`\\\\\h\\\\\\,H \L`p\D0D\h\\\\\\\\\\\\\\\\\\\\\\\\\\\Ta.outlineno-staticignore-non-functionsannotated-sourceno-annotated-sourceflat-profileno-flat-profilegraphno-graphexec-countsno-exec-countsfunction-orderingfile-orderingfile-infosumall-linesdemangleno-demangledirectory-pathdisplay-unused-functionsmin-countprint-pathseparate-filesstatic-call-graphtable-lengthtimeno-timewidthbriefdebughelpfile-formattraditionalversionUsage: %s [-[abcDhilLsTvwxyz]] [-[ACeEfFJnNOpPqQZ][name]] [-I dirs] [-d[num]] [-k from/to] [-m min-count] [-t table-length] [--[no-]annotated-source[=name]] [--[no-]exec-counts[=name]] [--[no-]flat-profile[=name]] [--[no-]graph[=name]] [--[no-]time=name] [--all-lines] [--brief] [--debug[=level]] [--function-ordering] [--file-ordering] [--directory-path=dirs] [--display-unused-functions] [--file-format=name] [--file-info] [--help] [--line] [--min-count=n] [--no-static] [--print-path] [--separate-files] [--static-call-graph] [--sum] [--table-length=len] [--traditional] [--version] [--width=n] [--ignore-non-functions] [--demangle[=STYLE]] [--no-demangle] [image-file] [profile-file...] Report bugs to %s gprof/opt/binutils/share/localeaA::bBcCd::De:E:f:F:hiI:J::k:lLm:n::N::O:p::P::q::Q::st:Tvw:xyzZ::[main] debug-level=0x%x %s: unknown file format %s GNU gprof %s Based on BSD gprof, copyright 1983 Regents of the University of California. This program is free software. This program has absolutely no warranty. %s: unknown demangling style `%s' %s: Only one of --function-ordering and --file-ordering may be specified. GPROF_PATH%s: sorry, file format `prof' is not yet supported gmon.sum%s: gmon.out file is missing histogram %s: gmon.out file is missing call-graph data ?T=q-G>. &֕M>K?PbM ?m@@uA.nAepBmfC k&4aCmgN@Y?@Y@@%s: %s: unexpected end of file [hist_read_rec] n_lowpc 0x%lx n_highpc 0x%lx ncnt %d [hist_read_rec] s_lowpc 0x%lx s_highpc 0x%lx nsamples %d [hist_read_rec] lowpc 0x%lx highpc 0x%lx %s: `%s' is incompatible with first gmon file %s: %s: unexpected EOF after reading %d of %d samples [hist_read_rec] 0x%lx: %u [scale_and_align_entries] pushing 0x%lx to 0x%lx [assign_samples] bin_low_pc=0x%lx, bin_high_pc=0x%lx, bin_count=%d [assign_samples] [0x%lx,0x%lx) %s gets %f ticks %ld overlap [assign_samples] total_time %f %c%c/call granularity: each sample hit covers %ld byte(s) for %.2f%% of %.2f %s Each sample counts as %g %s. no time accumulated cumulativeself total %5.5s %10.10s %8.8s %8.8s %8.8s %8.8s %-8.8s timecallsname%5.5s %9.9s %8.8s %8.8s %8.8s %8.8s %-8.8s %5.1f %10.2f %8.2f%6.2f %9.2f %8.2f %8lu %8.2f %8.2f %8.8s %8.8s %8.8s flat profile: Flat profile: [annotate_source]: looking for %s, trying %s r/%s: could not locate `%s' -annw *** File %s: ?r/n[symtab_finalize] favor %s@%c%c over %s@%c%c (addr=%lx) [symtab_finalize]: removed %d duplicate entries [symtab_finalize] 0x%lx-0x%lx %s [dbg_sym_lookup] address 0x%lx [dbg_sym_lookup] low=0x%lx, mid=0x%lx, high=0x%lx [dbg_sym_lookup] sym[m]=0x%lx sym[m + 1]=0x%lx [dbg_sym_lookup] binary search fails??? [sym_lookup] %d probes (symtab->len=%u) [sym_lookup] %d (%u) probes, fall off ?UUUUU\INCL_GRAPHEXCL_GRAPHINCL_ARCSEXCL_ARCSINCL_FLATEXCL_FLATINCL_TIMEEXCL_TIMEINCL_ANNOEXCL_ANNOINCL_EXECEXCL_EXEC[parse_id] %s -> %s:%s%d*/%s: [sym_id_parse]: arc %s:%s(%lx-%lx) -> %s:%s(%lx-%lx) to %s [sym_id_parse] syms[%s]: @Y%s (%s:%d @ %lx){%d} %4.0f%% [%d] (%d)[findcall] %s: 0x%lx to 0x%lx [findcall] 0x%lx:call destpc 0x%lx (%s) but it's a botch ?[find_call] %s: 0x%lx to 0x%lx [find_call] 0x%lx: jsr%s [find_call] 0x%lx: bsr 0x%lx ; name=%s, addr=0x%lx but it's a botch 4llllt|ۄی۔ۨۼ dht܀܌ܘܤܼܰ4@(LXݠݠݠݠݠݠݨݨݰݰݸݸݸݸݨݨݰݰݸݸ?[reladdr] not relative address [findcall] %s: 0x%lx to 0x%lx [findcall] 0x%lx:calls first operand is %s second operand is %s [findcall] destpc 0x%lx child->name %s child->addr 0x%lx [findcall] but it's a botch @@@@HPX`h|8<HT`lx ,tttttt||||,,,,L,L,L,?[reladdr] not relative address [findcall] %s: 0x%lx to 0x%lx [findcall] 0x%lx:callf first operand is %s second operand is %s [findcall] destpc 0x%lx child->name %s child->addr 0x%lx [findcall] but it's a botch [find_call] %s: 0x%lx to 0x%lx [find_call] 0x%lx: callf dest_pc=0x%lx, (name=%s, addr=0x%lx) but it's a botch % the percentage of the total running time of the time program used by this function. cumulative a running sum of the number of seconds accounted seconds for by this function and those listed above it. self the number of seconds accounted for by this seconds function alone. This is the major sort for this listing. calls the number of times this function was invoked, if this function is profiled, else blank. self the average number of milliseconds spent in this ms/call function per call, if this function is profiled, else blank. total the average number of milliseconds spent in this ms/call function and its descendents per call, if this function is profiled, else blank. name the name of the function. This is the minor sort for this listing. The index shows the location of the function in the gprof listing. If the index is in parenthesis it shows where it would appear in the gprof listing if it were to be printed. call graph profile: The sum of self and descendents is the major sort for this listing. function entries: index the index of the function in the call graph listing, as an aid to locating it (see below). %time the percentage of the total time of the program accounted for by this function and its descendents. self the number of seconds spent in this function itself. descendents the number of seconds spent in the descendents of this function on behalf of this function. called the number of times this function is called (other than recursive calls). self the number of times this function calls itself recursively. name the name of the function, with an indication of its membership in a cycle, if any. listing, as an aid to locating it. parent listings: self* the number of seconds of this function's self time which is due to calls from this parent. descendents* the number of seconds of this function's descendent time which is due to calls from this parent. called** the number of times this function is called by this parent. This is the numerator of the fraction which divides up the function's time to its parents. total* the number of times this function was called by all of its parents. This is the denominator of the propagation fraction. parents the name of this parent, with an indication of the parent's membership in a cycle, if any. index the index of this parent in the call graph listing, as an aid in locating it. children listings: self* the number of seconds of this child's self time which is due to being called by this function. descendent* the number of seconds of this child's descendent's time which is due to being called by this function. called** the number of times this child is called by this function. This is the numerator of the propagation fraction for this child. total* the number of times this child is called by all functions. This is the denominator of the propagation fraction. children the name of this child, and an indication of its membership in a cycle, if any. index the index of this child in the call graph listing, as an aid to locating it. * these fields are omitted for parents (or children) in the same cycle as the function. If the function (or child) is a member of a cycle, the propagated times and propagation denominator represent the self time and descendent time of the cycle as a whole. ** static-only parents and children are indicated by a call count of 0. cycle listings: the cycle as a whole is listed with the same fields as a function entry. Below it are listed the members of the cycle, and their contributions to the time and call counts of the cycle. This table describes the call tree of the program, and was sorted by the total amount of time spent in each function and its children. Each entry in this table consists of several lines. The line with the index number at the left hand margin lists the current function. The lines above it list the functions that called this function, and the lines below it list the functions this one called. This line lists: index A unique number given to each element of the table. Index numbers are sorted numerically. The index number is printed next to every function name so it is easier to look up where the function in the table. % time This is the percentage of the `total' time that was spent in this function and its children. Note that due to different viewpoints, functions excluded by options, etc, these numbers will NOT add up to 100%. self This is the total amount of time spent in this function. children This is the total amount of time propagated into this function by its children. called This is the number of times the function was called. If the function called itself recursively, the number only includes non-recursive calls, and is followed by a `+' and the number of recursive calls. name The name of the current function. The index number is printed after it. If the function is a member of a cycle, the cycle number is printed between the function's name and the index number. For the function's parents, the fields have the following meanings: self This is the amount of time that was propagated directly from the function into this parent. children This is the amount of time that was propagated from the function's children into this parent. called This is the number of times this parent called the function `/' the total number of times the function was called. Recursive calls to the function are not included in the number after the `/'. name This is the name of the parent. The parent's index number is printed after it. If the parent is a member of a cycle, the cycle number is printed between the name and the index number. If the parents of the function cannot be determined, the word `' is printed in the `name' field, and all the other fields are blank. For the function's children, the fields have the following meanings: from the child into the function. children This is the amount of time that was propagated from the child's children to the function. called This is the number of times the function called this child `/' the total number of times the child was called. Recursive calls by the child are not listed in the number after the `/'. name This is the name of the child. The child's index number is printed after it. If the child is a member of a cycle, the cycle number is printed between the name and the index number. If there are any cycles (circles) in the call graph, there is an entry for the cycle-as-a-whole. This entry shows who called the cycle (as parents) and the members of the cycle (as children.) The `+' recursive calls entry shows the number of function calls that were internal to the cycle, and the calls entry for each member shows, for that member, how many times it was called from other members of the cycle. ? ,,,,,,,,,,h @X1@2D1@51@1@3 51@1@1@1@1@31@311@2$1@21@51@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@11@1@1@1@5=:================================================l=l=l=l=l=l=l=l=l=l=============<=<=====================:==;4;p<$=<`==:==:=====;:9=:;:Dnw newdl deletenewdeletevn new []vd delete []as=ne!=eq==ge>=gt>le<=lt<plus+plapl+=minus-miami-=mult*mlamu*=amlconvertnegatetrunc_mod%mdamd%=trunc_div/dvadv/=truth_andif&&aatruth_orif||ootruth_not!ntpostincrement++pppostdecrement--mmbit_ior|oraor|=bit_xor^eraer^=bit_and&adaad&=bit_not~cocall()clalshift<<lsals<<=arshift>>rsars>>=component->ptrfindirectmethod_call->()addrarray[]vccompound, cmcond?:cnmax>?mxmin*szsizeof autoAutomatic selection based on executablegnuGNU (g++) style demanglinglucidLucid (lcc) style demanglingarmARM style demanglinghpHP (aCC) style demanglingedgEDG style demanglinggnu-v3GNU (g++) V3 ABI-style demanglingjavaJava style demanglinggnatGNAT style demanglingconstvolatile__restrictconst volatileconst __restrictvolatile __restrictconst volatile __restrictoperator operatorassign_type_ada____<%s>global constructors keyed to global destructors keyed to import stub for statictemplate <class> class()%d.e'falsetrue0JArray1Z__pt____tm____ps____S,_GLOBAL_{anonymous}___imp____imp___std____sti___ virtual table0123456789Qt__thunk_virtual function thunk (delta:%d) for __t__vtbl__::[]unsignedsigned__complexvoidlong longlongintshortboolcharwchar_tlong doubledoublefloat%xint%u_t-2147483648U...__ct__dtT%d--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument %s%sCannot allocate %lu bytes after allocating %lu bytes undocumented error #%d???UUUUU\\\\\\L0\\\\\\\\\\\\\\\\\\\\\\\\\|\\\\\\\\\\\\\00 00000@0X00X0X0@000000000000000000000000000@TdAllocation failed.Expected ?std::Unexpected end of name in .::Unexpected character in .Unexpected character in .Zero length in .Internal error.Unexpected end of name in ._GLOBAL_(anonymous namespace)aN&=aS=aa&&ad&ancl()cm,co~dV/=da delete[]de*dl deletedv/eO^=eo^eq==ge>=gt>ix[]lS<<=le<=ls<<lt<mI-=mL*=mi-mlmm--na new[]ne!=ngnt!nw newoR|=oo||or|pL+=pl+pm->*pp++pspt->qu?rM%=rS>>=rm%rs>>sz sizeofoperator operatorUnknown code in . [nv: [v:Unrecognized .guard variable for vtable for VTT for typeinfo for typeinfo fn for typeinfo name for java Class for non-virtual thunk to virtual thunkcovariant return thunkconstruction vtable for -in-Unrecognized .Error.in-chargenot-in-chargeallocatingin-charge deletingUnrecognized constructor.[Unrecognized destructor. [::*Non-pointer or -reference function type.complex imaginary Unexpected character in .signed charboolchardoublelong doublefloat__float128unsigned charintunsignedlongunsigned long__int128unsigned __int128shortunsigned shortvoidwchar_tlong longunsigned long long...Unrecognized code.Non-alphabetic code.restrictvolatileconst [extern "C"] , Missing function return type.Missing function parameter. () Template parameter outside of template.Template parameter number out of bounds.ibi iii ll ii i Unimplemented.falsetrueUnrecognized bool constant.:(stdstd::allocatorallocatorstd::basic_stringbasic_stringstd::stringstringstd::basic_string, std::allocator >std::istreamistreamstd::basic_istream >basic_istreamstd::ostreamostreamstd::basic_ostream >basic_ostreamstd::iostreamiostreamstd::basic_iostream >basic_iostreamUnrecognized .Substitution number out of range.string literal [# [#0]_ZMemory allocation failed. /opt/binutils/share/localemessages/.moCPOSIXLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_ALLLC_XXXLANGUAGELANG/locale.alias/opt/binutils/share/locale:.riso!X"#,@#0#P?@ 8?DA 8B F|,FGGH<H@IDIHJJ JJ8KKKKN<,N@NNPtPxQQQQT LT<UUU8U<Vp'VtXl'XpXXXX[ [$[[\\]H]L` `aaaaabbb bbbbcceeeefXf\h hhh hlhhjx j|kkmL mhmmqdqhqrr0r4r@r\rtrxrruH uLxP xT{{|p|t~<~48PTlpHL<@x|0+8+8(,TXX\DHt,  0` LhHLX\x|P ,0@%\X'\'|<  @<XhltxƐƔƠƤL Ppt@DΜΠ8<,,dhlpDH րք֔֘L P$@DHtxdhHL@D 48hlpHL$(PT`dLPpt  8<| $D HL P         ( ,  04dh <@###$% %) )**,, -  -/ /0p0t7 7 7L 7h9 9= >>>?,?0?p?t@ @$@@ABBHBLBCCCDDDDE$E(EEHX H\H HI IMMMMN@NDNNNNNNNNOHOLOOOPP<P@PhPlPPQQ8SSUU ULUPW4W8WW``a|aaabbbbcc8ccdd0dldeff4fPfxf|fgg@g\gggh(hdhhibiibijjj@jDjjjjk k$k0k4k<k@kHkLk\k`kkkklxl|llllllmmmDmHmlmpmmmmmmmmmmn$n(n|nnoolopoop0p4pprPrTrdrhssssuuv,v0vvwww$w@w|wwwxxxxyyyy{{| ||P|T} }$}d}h~~pt| p thl@D 8 <|  <@T X @DX\TX48ptX\ 04X\\`pt $DH48PT,   $(04ptl Ä àtxĘ hɜɸɼ tx$(0 4d аX\҈Ҍ ' ' 5 5 6 6 7D 777; = = A J K T$ mP m r rD ~@  $   x d | P  D  @  ( t    # 7P Q a b c d dp e f8 gD g h o w(    È Ĝ l Ʉ h @, $Revision: 92453-07 linker linker crt0.o B.11.06 981204 $/usr/lib/dld.slERROR: mmap failed for dldERROR: mmap failed for TSD@,@,@,"@,*@,2%-6.6s %5.1f %7.2f %11.2f %7lu%-6.6s %5.1f %7.2f %7.2f %7lu%6.6s %5.5s %7.2f %11.2f %7lu%6.6s %5.5s %7.2f %7.2f %7lu%6.6s %5.5s %7.7s %11.11s %7lu %7.7s %6.6s %5.5s %7.7s %7.7s %7lu %7.7s %6.6s %5.5s %7.2f %11.2f %7lu/%-7lu %6.6s %5.5s %7.2f %7.2f %7lu/%-7lu %6.6s %5.5s %7.7s %11.11s %7lu %7.7s %6.6s %5.5s %7.7s %7.7s %7lu %7.7s %6.6s %5.5s %7.2f %11.2f %7lu/%-7lu %6.6s %5.5s %7.2f %7.2f %7lu/%-7lu %-6.6s %5.1f %7.2f %11.2f%-6.6s %5.1f %7.2f %7.2f@,:@,B@,Jsss@(#) Copyright (c) 1983 Regents of the University of California. All rights reserved. gmon.out_gprof_mcountmcount_mcount__mcount__mcount_internal__mcleanupbug-binutils@gnu.org2.11.2laDA(J@pPP`qhQxCZrRisxIz8mHLXyhctnNweEfFkbdhOTv@0@@@H@P@`@x@@seconds% @,R@,Z(8H******X_coroutineliteralindexedregisterregister deferredautodecrementautoincrementautoincrement deferredbyte displacementbyte displacement deferredbyte relativebyte relative deferredword displacementword displacement deferredword relativeword relative deferredimmediateabsolutelong displacementlong displacement deferredlong relativelong relative deferredliteralindexedregisterregister deferredautodecrementautoincrementautoincrement deferredbyte displacementbyte displacement deferredbyte relativebyte relative deferredword displacementword displacement deferredword relativeword relative deferredimmediateabsolutelong displacementlong displacement deferredlong relativelong relative deferred***8*@*`*h***** **@*+ +(+@+H.::.::.::.::.:: type_info node type_info function.::.::.::.::%%%%%%%%%%%%&&&& &(&0&8&@&H&P&X&`&h&p&x&&&&&&&&&&&&&&&&&&&&&'&''' ''('0'8'H'P'H'X'`'h'x''x''''''''''''''('((((( (((0(8(@(8(H(P(X(`(h(`(p(x(((((((((((((((((((())))) ))(&)8)H)P(`)X)`)h)`)p))))))))))))))))))))*POSIXLY_CORRECT: 4P4X4`4h4p4x444444444444444455555 5(50585@5H5P5X5`5h5p5x5555555555555554566666 6(560686@6H6P6X6`6h6p6x6666666666666666677777 7(70988888999:::: :0:@:H:X:`:p::::::::  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000@,b@,b P@ s$.$?03< ??7\~@m=> 5<' xhAĜÈ67DP gDИ>8;w(~p~oɄ|$Ĵ>m7#~X7t7PЀ;#Tf8(J hA\D,t'5=6KT$mPrrDD@l@/@@/<@/D@/H6ˈbinutils/binutils-RUN/opt/binutils/bin/nm010075500000000000003000003300000732753201300173000ustar000300000000000000@+@#XPP(G(~d@+  92453-07B11.17;^  92453-07B11.046g0@ X"LX ##tX!*|*|X Eh/\Eh/\X 8tPtPX HHHX I``X X``(>(@`>(@<>( @P>(@h>(@t>(&@ >('$@"$>((@#>(P@#@\@>(R@#dY ~d? @ $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$y\g|/8#  , ^<p(O4hů;A8v˚v)bR b [8g'VL /v'6!xy!xD!xry 4'PנuR `aDg6mTLL''̃!xT/}(24!x݌/!xg6OXkkX\T !x/P )'6Y//]! '/!x/Bj+ 4gyh!xng@M5]AZAaxqV{׷ɘ 0| ),vҸ>>a9 ƿ&%&%"k6tK/km2znp9[uqZef{{/->MwL,e=WӨ䌺_P?A˚v8vhů;An bRY;tltD8rP.Y;2Y;Y;'s,v 2>j>a%,O_  "  o@$u@$|@$@$@$@#@U@U@U@U@U@U@ U@%U@U@U`U`UU tU"@U(UULUU|UtU;UU$U8LU@"UJbUQ*U!Q@"U `fmtz5<CIOW_fmry'-6=ENU\bjov*4?YpzQZhv6Pk 2BRP"T*X2:BJRZbjrz /tmp/libtool-17864/nm-new/opt/binutils/lib/opt/binutils/lib/libbfd-2.11.2.sl/usr/lib/libm.2/usr/lib/libc.2_tepv_ktepverrno__ismt__dld_loc_hex_valueoptopt_SYSTEM_ID_CPU_REVISIONopterroptindoptarg_FPU_MODEL_end_environ$RECOVER_END$RECOVER_START$UNWIND_END$UNWIND_START$ARGV__text_startmemcmpmallocfopenctimestrrchrsprintfstrcpystrcmpreadstrchr_startcalloctolower_isdigitfgetsfclosebsearchfprintfexitopenrealloc_isalphastrcatstrncpyqsortstrtolstrncmpstrdupvfprintfstrcasecmpgetcwdgetenvsetlocalefstat_isspacestrlenstrncat__flsbufprintfmktempfputcstrpbrkatoisscanf_isalnumfreestrstrstrcspnclosesbrkabortmemcpystrerrorstrspnmemsetbfd_initbfd_get_errorbfd_scan_vmabfd_check_format_matchesbfd_check_formatbfd_is_undefined_symclassbfd_openrbfd_errmsgbfd_get_reloc_upper_boundbfd_canonicalize_relocbfd_closebfd_get_next_mapentbfd_openr_next_archived_filebfd_set_default_targetbfd_map_over_sectionsxstrerrorxexitobjalloc_create_objalloc_allocobjalloc_freemainhex_initobjalloc_free_blockfnmatchdcgettextconcat__d_trapsize_forward1size_forward2get_relocsprint_object_filename_bsdprint_archive_filename_bsdprint_archive_member_bsdprint_symbol_filename_bsdprint_symbol_info_bsdprint_object_filename_sysvprint_archive_filename_sysvprint_archive_member_sysvprint_symbol_filename_sysvprint_symbol_info_sysvprint_object_filename_posixprint_archive_filename_posixprint_archive_member_posixprint_symbol_filename_posixprint_symbol_info_posixnon_numeric_forwardnon_numeric_reversenumeric_forwardnumeric_reversealias_compareerrno__ismt_ktepv_tepv__iobbfd_und_sectionbfd_abs_sectionbfd_target_vector__SB_masks7!?9" 7]!9ӽ9Y4!:ӽ9Y4T ;|ӽd Y"ӽ9"ӽ@>B! @ Z A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  a@@@ @7]]@]2@@ @] @@ @@ @ @*@ :7!?9" : B*= @ Z ]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]` =@ :7]@ k? k?k?XZ]XZ]XZ]XZ]d@"Z]> ZZ]> ZZ]9 Z8 =@Y :Z @Z@ ZZZ] ZZ @"ZY :ZZ@= ZZZ@= Z ZY :Z]ya: =]: =]  : =@4ZBu ZZZZ ZZ]ya: =]: =]  : = @4ZB ZZZM ZZY :}@4Be]yZZ5@*Z@ya AZ@ya AZ]ya A @Z@] Z]: =] y a: =4Y(ZYY8Z@] Z]: =] y a: =4Y(Z YY8Z]Y Z @*Z@YA AZ@YA AZ]YA A @ ZZmZ@@K?@ @Ku:QKs:Y k?#a7{ 7 kckx'y 4yEe'y7D7%767+4># (P744445 bנZRkeke (4Ц @Ц D(43 H?(ਃ 43 ` 7+4>7D7%7744z# 074444@H@7D7%7#0"07444Kx7D7%77KvȆ 2474444#&7@@@@ 7K?@ @@@@k?7k?#Jk? 7Y k?4@4 @@K?K?7@4K? *@K? K? 7@4K? rKa?H:@7?!# 7 4@(4@x7?!7?!7@4#*79 4@4Ka?@ H:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 86 0.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?ok)4`@44` G>- ""46 _4K>9K>Qk<+H< K>i *K>y4ߟ444K>IKa_k? k?54@h44? 7+ J4Y 4: `_4h4k?4K>a5k?4@44?"p74@4K+k>44 k>Kk>v k>+H3 k>+4' k>y 4 c?+K?4= k>Ka?43k? Ka?44k?֠ k?Ka?45k?7vk?1+~4< !0k?!(k?)# 7 4_47=)"6 P4_4G=-+"6 4: `_M4_+"j6y 4: `_4 *49 +4: `_4] k?)Kk?9k?A k?Ik?Q@k?QKqK>Akf k?q( k?4?k?( k?47 k?k>  k>7uk?y7>7>444?7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4!4! <4?@@k?7k?#Jk? 7Y Pk?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?!# 7 `4_-4@x7?!7?!7_4#*79 p4_4Ka?_H:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 86 00.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?7Kv+~ H4? 44477K?Y@7?K?Yk?4?k?474_4$4?7 k|_M@eK?Y# +7 4: _M4%K?YKu:Ks: k?Ku:Ks: k?k?ok?7# k?44 G4 KxK?_5744pG4 K?_744G4 K?_7KzA K?` B44GH4 +K?48 _]7_}4zK?YK?@O?k?oC_4 `7C4ރ b4ȃ R"46Gx4 7A4yK?Y@O?0ȴk}81 ks81@c8I@ucu8cu8'k?oC_4 7C4 4ă 4 4 4 "46@G @4 7A4y+ K?Y47 kx8@O?+䟥+⟕+@@K?@ @Ku;Ks; k?Ku=!Ks=) k?Ku:!Ks:) k?Kuk>k>k>k>k>k>k>k>k> j7Dk?7%4y_4 4f4yG 4G 04HkzD4g_}@A8@+4& 444D4$@Ka?4(4)4*+# 7 4,4 o4? | km8Kz91#:A@!h7A7k? 4Pky8Y@H47kz9)@ K9)047Kv8i#_44K>YK>K>K>K>K>K>K>K>K>K>@O>km8km8Q_5 Pk?k>44y G@4 K>Ky917Ak>=K>Hkm8y@k?_Kz91 k?km84_=5 km8akm8km8_}5 `k?km8km8_5Kz91hk?Pkm8@km8qK91(k8 k?5@_M4k?444D444yGX4 K>+4! k>5A7Ku=1Ks=9 k?KuK?!K?K?K? @O?@HzKu=Ks= k?Ku=aKs=i k?k?ok? Ky84_mk? 7@,K?`4|@ K?_@ @@DK?_K?44_@ k`hk``4|K>K? @O?4_4 @_4m47?4_}4>@K8KK? 74@44@\K?+`@ @K?@ @k?ok? k?7XKwxk?!Kz4%k?)K]K8Ky7KzK_7K?)K8KyKwp77` Ks@,JzHw Ka?48 H  RϟhK>ك x@J0Hy 7 K0H  JK?!@K?)K>K?K? @O?ςK> 4K>@ @K?@ @k?7_@K?Y@7?@ @K?@ @k?ok? k?K4#k?!KK87XKy7Kwxi7KzKW7J8K?!KyKwp!77 Ky@K:H 8H(4?K>K?K? @O? ςK>_ @K>@ @K?@ @k?7_=@K?Y@7?@@K?@ @Ku;Ks; k?KuK?1K?)K?!K?K?K? @O?67_u7557<46_=7霝5 45K> 4 K>ϟK>ςK>ϟK>ςK>@ @K?@ @k?7K_K72Ky8 4?K?Y@7?0+Kx8 4K?YK8+KZ47 K97eK?YKu;1Ks;9 k?k?/,ok?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?iK>7C7>k?+6& 77H7 4_4D 7?'K> Khx7Kip'!8G')E) d DH}K84z4K?5%7"7D* KHzKV84z5xK?577!7@ DHzI C("BK0KHI J0 I     55( 45d5j5H FRV6+H7 4_4y4|K>K?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?O?@/0,@Hz4 I K  Ij7C(I >C(J0I K0I a % _@I k?ok? k?k?k?!7$Ky8y7C 4%HwpwHxK07?y7?4z7a7!@K?k?4z7Ky8y@PK?yk?Kg8"87Kx8ykc4'kxH}4zK7k|xHy4zK67k|pKtx @$HzK8!*Kw8K8+4: W  K?y4_=K?(Ks8#47 F 4 Hy@l7hK>Hz@L74>@#*479 F 4 Hy@7K>K?k?7?4k?Ky8y4z_EK?y7Ks8 @Ky8yk?K?4z4k?@K?y"k?K?4z@4_%K?yK>K?!K?K?K? @O?Ku%@K>44$A8G$IF I $ $zKa?4*Ka?4+4,HaH684z4K?q4}7 7Ks8 K U84!@@4Kx8!Kǝ 4!rKz8!2K V!"P @\Hze7?Hz@4k?QK?QKt8?G4K_@K X84_K _ӗ jKy8 >@K x >@4 "54_e4  'Ha }47K>K?IK?AK?9K?1K?)K?!K?K?K? @O?Ku<Ks< k?k?ok?K87# Xk?@ BKB0 84c4@d4z 87K?_-4yK?YK?@O?K?_4_4K?Yk?ok? k?k?k?!K]7C7k?QK6E7!(77?a7>'@K>'8G'F $ 䀒K>k?YHwJ84z4K?Q47 7K?Y4z@7 䟇HwK>K?!K?K?K? @O?@Hz7?aHz@xk?1MK?1k?ok? k?k?K\7C7k?1K6 ]7!7ƈĀ@K>k?9HuJ84z4K?1H 7 7K H4z7J0 4@K?9ğ_HuK>K?K?K? @O?@Hz Hz@k?!-K?!Ku>Ks>  k?Ku<Ks<  k?k?ok>k>k>k>k>k>k>k>7#Ky87DK64%74 7Kf8 RHh Ka?4= "Hy6@_4pKz8aHK67>44y e7Kb8HV 7>4 57Kz8a@%H@Khh (4%Kz _@k`Kg HK4 7eh7Dx7k|H47H M7e8k|kdhHy Ka?4::#zKw` Kj Ks X4KKw  _q@KwK4柽@_9Kz_)Kz_Kzk`k`k`Ki HkaD k|KD k|KkD k|Kf+7?Ik?IKb4k?QKik?aH9 _mk?Ykd`Hxk>4Kj@"ZKKw7?7?!7?)4  a2Ku  I @KK Hz  KH}= @K_K>ш jk?H4k?Kk?J  KxIw7"@Kv 5J^KuKwK4枧4 Ka?K4芄 7?)k?7?Hk?7?!Iv 4k?KxHw7 :K? (@K?) "j_6zPKa?H5 6?ah4 H<(7h=(4K>YK>K>K>K>K>K>K>K>@O>H@7u@@Hkdh *K?K?)_4:PKߝKw49 _4K>Y@ @K?@ @k?7K8Y (7YKw8Q # _7`K?Y@7?@ @K?@ @k?7Ky8 Pk?#47pF4 K?_m7H"# 74F4 K?_7"46F4 _7K?Y@7?@ @K?@ @k?7K8Y (7YKw8Q # _M7K?Y@7?@ @K?@ @k?7K8Y 7Y"_6`K?Y@7?@ @K?@ @@@ @K?@ @@@ @K?@ @k?7K8Q "_6`K?Y@7?@ @K?@ @k?7k?Ky8 Xk?#47F4 K?K?_7P"# 74Fh4 K?K?_ 7"46F 4 _ 7K?Y@7?@ @K?@ @k?7Kw8Q7_ 78#*7: _ 7K?Y@7?@ @K?@ @k?oK8Q H7# "KY_ U6@# Hy_ 57@K?Y@O?@ @K?@ @k?oK8Q H7# "KY_ 6@# Hy_ }7@K?Y@O?@ @K?@ @k?7Kw8Q `7? 2KY#JK_ 7ZP(K?Y#K_ 7pK?Y@7?k?77Y_ m7z8AK?Y@7?@P@K?@ @Ku=qKs=y k?k?ok?C]7CӺ_k? ""j_ 6z@z_Hz@z Y_ M4@x4Z8 z4_ k?@7z8!__K?Dw7z8_Hy _4HyK?_4K?YK?@O?@ @K?@ @k?ok?7D j78KY_-4z@_Z @_4z@_H@9_4z@4Z X@H _M4zD7z8_-_4z K?Y_4z0K?YK?@O?@ @K?@ @k?ok?7C 78KY_4@w_E4@_  @_ 4K?Y_]HzK?YK?@O?Ku=Ks= k?k?ok? k?k?k?!7C4?_7?4!7  244F 4 _74HwJ4z47 7K?K *4@_4xH_]44z4_u7?? 7K>K?!K?K?K? @O?@h4=K?@@K?@ @Ku=Ks= k?Ku=Ks= k?k?ok? K77$K5 ǵ@k?!Hd HHb4W wH}H77hwhsK>K? @O?_4`7C7Hy<4HxK?!K_HwHvH|K ~@K?!@8KHbK?!KZ@k?-K?Ku=Ks= k?k?o_7C_7Ka?7 @4:@k?# Kx7 ^4w(K>#* Kx^]79 0K>@O?k?7_@C d4K?Y@7?Ku;qKs;y k?k?7Kxk?#J Ka?k?7Y @4:@^uk?K?K?_]K?Ka?H9@78?`Hh8@Ka?H?H7h7H4K?Y@7?K?_4K?Yk?77_k?17?9k?)k?!_k?9C 4K?Y@7?k?77_k?17?9k?)k?!_=k?9K?Y@7?Ku=Ks= k?k?7# 7 P_k? @K?Y@7?" 46 F4 k?^7K?k?_7K?K?_-7eK?YKu<1Ks<9 k?k?ok?7C 44 F 4 KxKa?4:@k?^-7Hw 8@ `K?^4  h?4cK?_4K?YK?@O?k?ok? k?7D j  Hk?!44y F4 K?!^-7HKa?44y PF4 K?!7^4Ka?H?K4 P4% K84y 4^}K?!H ?@K?!^E4y K>K?K? @O?k?oKx87Y j _4z @44y `F4 _744y FX4 _7^4K?Y@O?@ @K?@ @k?ok?k?7?1k?1k?)k?!!0k?944C@ K?9 7B *7?6`Hw bB *7`?64c?`Hw?@K?YK?K?@O?_4eԠH>7_4?ԠH@? u4Ku:AKs:I k?Ku;QKs;Y k?k?ok?7#k?_7:k?@w_EK? X7K?4_E4y 2@_4?744K?YK?@O?7KYC773 WǷ@44?@7?Ƿ# 7 .& U KYC87?'00N9F8G'I  J79YC3 X6?Ǹ_M w @7? ]ǽ2KA4<\C XǸ_@4?@7?k?oK_4C7Cx x7 b@Y7v3 _ǿ@_4zHC4] 2ϟ@K?Y4``J4r@:6?7 aK?Y@O?ϟK?YϟK?Yk?74_ 24 4X 2ςK?Yׄ4K?Y@7?^E@K?Yk?7N:N!JJ ‡FF BbB B@ "^@K?Y@7?#07 P"06P# 07`#J07\#*0u7<#0]7"j0E6|"0-6 k?7_ @_7K?Y@7?7w AJ 07\6 (@?6@4@k|8k?ok?7c AHw :Hy^ K? :4cH?Hy4K?Y@O?H|Ku=Ks= k?k?ok>7#4k>4_7>k>#7>  Kw8  #Zk>K>^?*ElK> p7K>?@Z"K>@4yȜ84K>@7>7@ x7>4K>YK>@O>k?oK?7Cr Z:7? 87='Hz'8G'FC |K?Y@O?Ku:Ks: k?Ku:Ks:  k?k?ok? k?k?k?!k?) 07Ck?44 _k? 44c 4@4#4x#4^4z! @^4z0 _ w 67B7 @ R4@4 Z@_ 8"@?7044K>K?)K?!K?K?K? @O?C48"Z|4_77?7?_45? b K?73 VǶ5?@J w  TǴ26?` @ w  Yǹ_6?@2 w  "6? x ' (4 w 0H64`4@| S4 y X@ w 6  <]m7 w  Z Y? w }? 5?4\ 7\ w  w < w 6 u < w 4^ 4z77?7?_=4@y4x: (K?4_4y444_4x4k?ok? k?k?k?!44k>k>KEXk@XKFPKD`KCpK>kPK>k@pK>k xK>!C`!B7?QK>K_^7>A7?Q7 (@K>7>A7?Q7 @@K>C "K>7>@ (7?Q7K>KP 2# 07B$7?QK>jPKX 2"060B7?QK>@jXKxB *#07pB7?QK>jxK>7?Q@`4K>hPK>k%XK>kD`K>kpK>K?!K?K?K? @O?k?oB7CHz@ @^@Hz@ @^}@K?Y@O?k?ok?k?k?7C@7$44z_4HH @H@@4H0!jH Ax4H8" H(B4H"H B4H@#RK?YK?K?K?@O?C8  |H^U 7C4Ha% \4HsHe  ^4H@e_m@H0Cp u |H^ % 7C04H 4HtH  ^4H _wHH8C  |H E ^ @7C`4Hx  <4HuH % ^4H(_e@EHC -h|H^ 7C4Hz E 4HvH  ^54H_wHHC4h|BX7HzBHHeK?Yk?ok?B 7CHz@ @^U@ `h`HHw H`X4HHw  ^@HwH4_@^Hzh`Hz@ (@B@^uHzh`K?YK?@O?k?7_k?_5K?K?Y@7?k?ok?k?7#_-7 4B4z84#07 P4B4zHd4K?YK?K?@O?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK27D7%B_744444)4 7l!ak>7k!Qk>7j!Ak>7n!1k>! 5 @7j3!04 4?47W?u4? w ǚ6\ C(b _ AǡRH6V B((@ _ VǶ_@k?444A04x (7H Y4BP6YH^4 rk?444A4xH7^4 6S  06Qh`_@Hp Thp 0HH7 Hy@ 82H6 @? ?@HC0 7  bhh44@4x 06Q (7H ?4A469H@ ^_HC (4 244A7?Y P7Hǡ K>@K>B7?Y4zBP7?Y 46B H4^ޟ4^_ B444BP4x$7H^_HC#7 7?A4A47B7?Ak?B(7?)k?B7?A 0H447?A@@7?) (7H "4A69Hǹ@K>@K>B7?A4zB87?AHXB5 B7?)4zB7?)HX7?hXHP HX*4zB7?)HP6?hPB(7?)B7?A 4H@ @9 @B07?qH52 44AP7?qK?qK?y] 75B7?q4zB7?qB07?q P@H^rk?44k?4@4xHPH4ZҠ_4 H7H^r44A<4x47 ! bHƿ@4^_ A$444A4x74 !*HB_@67W? :H^"44A<4x7 H H` # 07B4zHp@ ZHoHp "06BX4z_!Hp7B04z5<K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O> %@k?ok? k?k?k?!k?)k?1k?97& 0k?A74B77?iA44 !x4K?i A`44x4 7 7 K?A4_4x!7K?i@ 4 B04zHC?m@7 4B 4z`K?iK?A4A7? 74zB`7?B 7?K?i4_4 HsBz?4| 4B (4z4B 4z4K>K?9K?1K?)K?!K?K?K? @O?B 7??GHsK?iKu9Ks9 k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Y77#k?i 04k?a47B 0k?qHz7_ 4C4(0x47h"7i"4 4K?aK?i4y@K?q 7HwB( H}Cf!44K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O??4^Hz474 L^ (7 Hy_=5x :5? L@>H}UK?a4K?i4B 4 , B 8K?iK?i4B 4Hx  yK?i4B h4Ht6 uk?ok>k>k>k>K747#k>B!j4!4!r444!4#0K>7B x4Hy7: z_4z7 "06 7?Q_q4K>Bp7?Q@ * "HC7 0 g44K>YK>K>K>K>@O>4y_}4ܟ44k?K>4A4yܟe44? jB J 0K>4B4Hx7 } 4̂5@>%@_Y4z@k?ok?K!7#4k?@?? "4y_4 K?Y4ڋ_ :#0K?7B4Hu6 vHtB7d3 YǹX@HyK?BP4Ha45 uB Sdz_HyH|C4\ "j0K?6y0B4Hv6 yC? XǸX@HyK?Bx4H|7 tB ]ǽ_HyHuB4ʊ #0K?7@B4Ht6 xC WǷRHyK?B4Hv6 sBb ZǺ_Hy4K?YK?@O?Ku;!Ks;) k?k?ok? k?k?k?!6K77$k?1B47E!46 _ 4 87H H`_4 4|!4ڊ :# 07K?1B4H4 "06PK?14B4_ y4@`4|!r`4|H " BK?14|K?1B4h4|>@K?14_4|(4|\ @ g?aK?17?aB4K?14Bh44| _ )4>@#J07Y`K?1B4 `4|#*0K?179pB4(4| *K?14_=4|4| !4? B4k?K?144@4|4|_ 477R 2#0K?17A4HB4k?9H7_=4K?9 F _iH (k?A"0K?16 PA$4K?A 0K?1AlK?A^K?A@AK?!K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>K>77)K87 97CK>6444 $4 Ad4z7I?C40#7 ,_5:$7Hy @HzLD_Y5:$H$ A4 $Hx A5z"04z@597A 7?1'r'44z595_5'7 II B 6Hx <6Hw ^9IHu 4A5A5K? 5kxd4J>7?17 ?4z59_ 4&7_5:_m7^I:WK? 5A4I94AD5 p@B5Ha+ \5Hv ^I9Hu I4 u /_y5:Ak? ^I:K? aHpǰ8 !0I:5_404  @I9K? A4 @I9K? A5zI5K?  ? "06pA47? @5:!"5A7?1YK>K>K>K>K>K>K>K>K>K>K>K>K>@O> zK? B h|K? 4haK? `2Hs  7K? @K? a4 4 4 !0 5 A4I?C;@7 74z59@7?1=74A 7?1=@K?9K?1 YBl5Hs k 5H} ^K?1H} o 7?1 @A@K? 7?qA,7O4z @A54 *"06 PA4`@HBz?4|] "06A4"060A4 0]@HH ? 8484zA4 5k?ok? k?k?k?!K_7G7$K>76^"j06y^ 4  b7 }^4z""H   C4X!@H^_ 04^]4 P 4^54 ( 4^ 4 H4" b^4z!BH   @C4 7ς z4^]4 ` 7 f^%4z H   C4 4K>K?!K?K?K? @O?ˀK>7ς }ˀK>ˀK>7ςm yk?ok? k?k?k?!k?)k?1k?9KH7#7EK976h 8 & 4#7?Ik?7?A4_4%@A 7?YHyK?A *AD4Hh_ HH hh! 05pA d4K?I4 4 7?YA @K?IC7#R!47?I@ 7?Y$*4 t44y@7?Y 4A \7?YHsB 8 4A L4A $7?YHCR" 777! *44yA h7?Y?/440A 4A 7?YHC70 w0K>7k?I7?IA 7?Y"z847:^-4x @Hy <@ @A d4(HyHy4A 44Hy4  hA <7?YHh HH hh 04pA $4444 4 44yA7?Y>40%47k?I47?I@ 7?y 5A l7?Y7?YA $7?y5A <7?YK?IC j7k?I7?IA x7?Y :4A 7?Y5A4K?Iu7?YA@K?IH4"?h50AT4Hj@ 0Hz4^e4 zHwB4V ZBB B7z9 ^ "4 A4@HjHh7hh4HyA4Hj F  K>K?9K?1K?)K?!K?K?K? @O?k?ok? k?7#4k?!7:^k?)77ȠJ]Hz@0@K?!K?)4y_u444K>K?K? @O?k?ok? 7C7?k?4Ak?A84zk?!K?4z_7?!@HxPK?HsXrHh K? 'k?K?A7?H}X0@HyP76?hvPk?K? $848A 4zK?K? ? 848K?!A4zHb@߿7y!q@_7y!ALK?K?A7?4AD7?4K>K? @O?#0K?A7 HzX7U?huXk?ok>k>k>k>k>B67#k>K%7D4"H^޿^_"06@^ -5"h@AT7>K>AD7>44^7>7>^4A!z44K>4yAP5K>4_4y! 7 eAK>K>Al7>4^]7>5C @C :7C b?7C?7 ("7C ?77?A@>4_7>A7>4K>YK>K>K>K>K>@O>4K>44yA`5Ÿ}4Ku=Ks=  k?k?ok? k?k?k?!7#7DK:] k?14Z"0Hz6P^ 4  2#0Hz7`^ ]4  @Hy7: z4hx#@7s3 VǶH"4(ȠhHPHƟ@ ^_b J0Hz4Y^4"2H}7 |4hP] HzZ 0Hz4^4!*HtB7z9 Y^@!HCC!bC4 R7 v4K?1hX4@4y!@44 7 u4K?1hP4@4y 4H^ _@ 0Hz4p^4=HHs6a a4hXHf44^47 7C?7 4? 2# 07_u4@ 7? <H`ȠHPHz!J@7u3 WǷ@:4 *4_ 4? 4 Hƿ@ ^jǷb4 f^4zHyA`K?1]HzHt x wƿ@:^"^_HP7^_hP4 bHƟr@4v Z@4< B]-@K?174_ 4y4_@4 @4ڂ *4 b@4 }( B]}@K?174_ 4y4!@7t3 VǶ@4 ^޿ ^_K?1@4z!@ 4@?4#J07Y@^M4 7B0ȠzK?14_ 4yȼ4@ 2K?144y_4ȼx44HP HX BHyK?1A4]}HzHa  b4K>K?!K?K?K? @O??4EHPKuk>k>k>k>k>k>k>k>k>k>K?47#k>C7D4 P4C7z9 Y^A@ HC#@HC C :C4 + "C4 C"4 7 :C4 "C7z9 ^iҙ"HC `@C! 0ә^5 *7i9 Hz_}59$x7 0Hz4^4'HHz4P^4 *HC4҃'4̂'44K>YK>K>K>K>K>K>K>K>K>K>K>@O>_7y9 7HyK>A5Hw  }7_7y9 ""Ƞ4Ha49 y^ U4&7Ƞ47 sHX6hXHC: 7 jJ A_7 iA?5:!7h!7i!7j34+4 4 J ( k?K>44@ `4yȼ}Hzk?K>44k?_4yȼ5Hz _ XǸ@^4zHz]7}HyHz_7y9 4 ZH=@H`߿95AK>Hy7: zHzC_>m@ j0AX4y%4Hy78 x4 C R4 4 k?K>44@ @4yȼ:k?K>44k?_4y7!rȠE4^4z@7]Hz@ Ƞ4@@Hz5^A4 HC46 CC r^5: P@K>A p5 HbF  z_59@HHyK>A4Hh   H>u@7 yH߿7y!K>_7y!A @]1HzHyK>7A 7H}  b7W w^4z97Ƞ44^7?!K>A 7?!K>A 4]4]9HzHz \ E a7 nA 87g!4 (7g! R4 4 zk?K>44@P4yȼjk?K>44k?_ 4yȼ(@K>4@ 4y7 "HtB Ƞ 4K>ᐠ A 44k?ok? k?k?7F6k?!7#A6Hy77]4 H^4 87K?!A 04] Y4 @HyK?!A 4] 4Hw  xK>K?K?K? @O?k?ok? k?k?k?! 07CKZk?14`^4" 4H}7k?C 47?^Q@!K? k?C C 7k?K?Bv?7?Hx7 wB@ 44z^@!7]Hz`HyK?1A 4Hw  C H@CF 0@K?1A4Ht6 gHuB ?4zK?1A(4(4Ƞ4Ԡ44K>K?!K?K?K? @O?Kuk>k>k>k>k>k>k>k>k>67D7&@7k>4 4 4 0@HPӀ_HXӇӀ_'AP7?9A@7?QHB4H#z6 ^Q4 H |@r44K>YK>K>K>K>K>K>K>K>K>K>@O>H A7?9 c5I?7m"1k>7z"!k>4 4 5,A7?QHCW 4 7 HCw"k?44k?47?9_7?Q#7K?9< Ap7?9"4 @ZJ^ 4"744_ 7?9PK?944@7?Q"877?9A7?QK?9K?A ? 848@ 4 `2Hǵ K>@K>A07?9}5)?K?9 ^4 7Ƞ4B4?67?0 Ƞ4 ` g?1_7?1HC74 7 H7 <@4=H7 ^ 4 H }'HȠ-@4K?9K?A ? 848K>@ 4 zH߿7y"A_7y"Q@ 7?9HX!*059 @7?97?9@7?QK> "4z@l7?9h@HbHfF 2HЀ߿7y"aЀ_7y"q@<7?94zA7?9@t7?Q@d7?94KA@773 S`_ˀ7?5KT6WB ]ǽK=46B S \6? dz_60V0=4@k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7D7&k>@7?1@7? @K>7b"k>7m"k>!J 44447i35Jx!j04 4 44T4LHB?7? 4? Q 4*?HHC6?QB4 w)4 )4)K>4@ 47`04@? @|K>K? K? R#J07Y@DK>K>@7? @|7? @@\7? )`04 4|6 HǴ@5y0@7? `04?6 5y P@7? `046 K? K? H@C ( *5y@7? 5y@7? 5y@7? HCM *444^7? 7HC 7 5y@,7? 6 7>_ 4 K>H@@"4=WK? hK>H 7?!Mk?!6 K? K?_ H@C ( *5y@d7? 5y@7? 44@ \7?  (@HC (0 Ƞ@&J;U@7E 6 045y@D7? HCS 84HǼ K>@K>@$7? HC? ? ]ǽ@^)4 k>]9HK>@ Ƞ@H@l7? HK> X 4 4! 7?Y4_47?Y@7? 5y@7? @HC4 4 4? *^H6 7H7 4CS!Ƞ5@ k?@7?qk?444^7?q8e7K?qK?y 8@7? @T7?q5y Bk?444_ 7? >=7Ƞ-@"44@<7?  HC Ƞ@7 HӠߒ 0/K? K?_ 5y@D7? ^ 6:7@7? 6 HbK? K?Q 5y@7? HB^:7@7? H6% k?K>44_ 4ȼU@7 7>_ 4 K>H(vGHȠxK>7 ]4 87H H`]}4 4K>@@@7? 44|K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>H " @dK>@K>@D4̢K? Kuk>k>k>k>k>k>k>k>k>k>k>7G7&k?977?A44@ 44 !J04 4 4 44HC ( 8""#B#Hh@HHz_ 5Y@4zHB]uӚ7@|4zH6 4^ U4c?%\H4H   047?9_}4K?94^i4HhHo 4@ T4z4z@ <44K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>4k?4k?44^7?A74z@ ,7?A?47 HyHt 5Y@ 4z5Y@ 4z7 HxHsx 5Y@ 4z5Y@ 4zb7 HwH} 5Y@ D4z5Y@ ,4z@4< HC:@4? *04<( @47 HuHi5 "06@ t4z"j06y@ T4z47 HtHh #07@4z#J07Y@4z47 H|Hk| #*079@4z# 070@d4z%47 HaHl, "06@ 4z#07@@4z47 HvHjV !05@4z!05P@t4z547 HuHf !j05y@4z!J05Y`@4z̨47 HtHe !*059@4z! 05p@4z̪E47 HyHv  04@,4z 04@ 4z̪47 HzH|\  04@4z J04Y@4z̬U47 HsHbS  *049@<4z#07@4z̬47 H}Ha= "06@4z"06@4z̬e47 Bt73 X_ȀH4 4C.77?!7" @X 8p47?!HB  6yH6` C9 ?HHA 4Ƞ47?!  H6M \HH@ p47@7?q44^7?q @K?qK?y ? 8484@ 5H}Hb] !05@4z4z@7?q@4@D7?qȀu@k?ok? k?k?K747#k?!B 4 6 a@7404 *4 0K?!@4Hb4_ C7e3 _ǿ@׀4K>K?K?K? @O?4 ˀK>"0K?!@D6Hf4ςu ǿp@4&HzC_7y9c9@K?!Hy78 xC Sdz_@ # 0K?!@x7ςK>k?ok? k?K?7#4k?!C7D *4K>K?K? @O?7 s] =4z`7ˀK>#J07Y P@K?!A4k?)Hy7\4K?) E ]H 8k?1K?!@7\%K?1(H}HyK?!@H4H}  t\K?)ςK>k?ok? k?KW4Z7Ck?!B jc9K?!@7y9Hv6 aHuB7d3 _ǿ@:ˀK>4V?Hu6 |ǿp@4%HzC_7y9c9@HK?!Hy78 xC Sdz_@4K>K?K? @O?k?ok? k?k?k?!k?)44HC!7 ]4A8h|@"HC!Z7 444z7CK(7%7@7H_-@Hy7? ph}ˀK>A 4h|@(7Hx4z_a4 ˀ(K>@44K>K?)K?!K?K?K? @O?ˀK>Hz@?@@x@-HxHy@84H 4z@5ς5K>k?ok? k?7CKZ7@ k?!Hx@HH`b *4htHA 40 | WhwHHzA  |A4K?!77\4 `H@7hy@H} K>K?K? @O?k?ok? k?K_077Ck?!KX @b *4 hs0A4(0 | Whw0HzA8 |Ah4K?!77\-4 H 7hy Hz _ K>K?K? @O?k?o7CKZ(H8@b *4 h}8A4(0 | Yhy8HzA |H|(7h(Hx  K?Y@O?k?ok? k?k?7D7k?!6A7K?!77\e4f H K>K?K?K? @O?k?ok?KW 7C@jH6?hd   *\@Hw HHw _6?Hw(@jH6?hd(  *\ @H  HHw(_6?K?YK?@O?k?ok?KW@7C@jH6?hd@  *\I@H HHw@_6?K?YK?@O?k?ok? k?k?k?!k?)k?1k?9k?AKG7C7$k?Q4X4!j05y@7HA !J0K?Q@5YHC4(0 4ʊ HvcZ4!*04 4 ("B7 C *7?_14 ˀK>k?H@ ^_Hy@4c]94k?CH^ޟ ^_K?7?k?K?cHs@czHx`K?4A?Ak?HyK?:  0k?Hs@K?Q@59 7?4z_7?a"H}@K?Q@87?a@7?aHt_-4K?7? k?H "HuK?Q@59 4z4_7?a" HtK?Q@`7?a@ 7?a4HC(0 <@Hx\@HC4ʈ" b7 HwB #*0K?Q@ 79# 0K?Q@ 7 Hz#0K?Q@ p74K>K?AK?9K?1K?)K?!K?K?K? @O?ˀK>7?_4<7HˀmK>ˀ]K>ˀMK>ˀ=K>k?ok? k?KD7Ck@H7hwHe_}h`k?!Hz@ @@ `@hdHy78?hxK?!heK>K?K? @O?k?ok? k?k?k?!k?)k?17%K977D6 7@ 4z4@ 84zHz@4 Hs:@4 "444^4wH^ޟ ^_J 0Hz\Q40&0@Hz\)4@&zHeH `ZC4ދ BC49 *C7z9 ]!@HbHz B *`R 04]4 *HhA 7z9 ]Q9#HC4%@C%C4ފ C4$8$C7x3 UǕĪC ZǚĐ@C"J447g" D\ 0@Hb 4Y]}4%Z4?@K>HsH ` 074]4 +447h"HxHz X E  \6?< *H  7]u58#4?}@K>447g"H|Hh D  \!6? *Hy 79]5#B4?}@8K>4‹"C " 447g" D\q 0@Ha 49] 4#J4?@K>Hg4 k?7?4_I7?i!0@@4z4`@4z4z@7?i@(7?iK>7k?7?4_7?i @@P4z# 07`@H4z4z@7?i@7?i0K>HP7hP@4zK>K?1K?)K?!K?K?K? @O?HX4EhX@`4zK>@@4z4@@4z7f" @ 4z4@4zK>@4z#07@4z7v" @4zK>@p4z!*059@h4z7u" @H4z]K>@4z! 05@4z7t" @4zK>k?ok?7CKZ `7$`@4@@4 |  | dK?YK?@O?HwH _K?Y _k? $  Y@ k? |K? 7 aK? | E bk?o7CKZ@ "\@ ` ` `K?Y@O?@@@@K_@_k?ok?7$ 7C@ j\ Y4k?4z_7HzK?\4HwK? hyK?YK?@O?k?ok?K?7$7CK7 Z k?_4zHzH\K?HK? hxK?YK?@O?k?ok?77C Pk?4z_M4HzK?\Q4H hwK?YK?@O?k?o7# @k?@ *\ )4zK?7@p4yK?Y@O?k?77?K9K @ ?K?Y@7?k?ok?77C k?4z_4HyHz7??_2C 7?Hz@K?\4Hz D h}K?YK?@O?k?778k?#07P]7?QK?_7?QK>@7?@ @K?@ @k?ok? k?k?k?!k?)CB77$#7W7x1444Z44^4\` _#Z J4~V#4T%jc@ V#"ςpK>@%`߿ ($% @?%B60B4 6046B64A`_ (@B6` @%4%Bc6 `$] jB ZB`_ (6B6 $` B6cĂ B6 ( r4~4^4T @!# @#B6 ( E84!4ˀK>قb :@$B@6 86b?@ ZςK>@ @Bc6 c@ "B4@<]6@#Zǃ 4^#R4K>K?)K?!K?K?K? @O?@!R`!R`߿ (7$ "`/B@??BςUK>6?k?1`_ (@B@7y1`&  @7g14 `  *4xK?1__%4 4@?@ςeK>ςUK>ςEK>ς5K>ǣoB@4\ςK>ˀK>ςK>ς}K>ςmK>ς]K>ςMK>7@*c  @7%|@b:/4AςK>ˀK>ˀK>CW 07\ *7C?@4@k?ok?k?4?KwKxKy9) h x W W  araX4 P6? D X Ҥ `6 e4c_7`@ V   ֠ 476 m7 ` aH4P6? X ҃7 @67 D_4B`@ X  v 7ր 4\6 m7 7@ } Ku9)Ka5kuK| kbK?YK?K?@O?Ku;Ks; k?k?ok?4$k`Ky9)ky77z*_}kyk|@4Z 4bHkz4V b(k`ȓ0k`ȓ0k}4|K?YK?@O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K>4'k`91K9)7Hk?K>7$7k? 6 4%Kt9! J4 0kj9)45_474k|9!KЀ 4#C!0@K9)Km hkKn hkKoȍ%KbKw؀W%% @_4K9) 8kkhkh9)K9)& B4ZU&B&6 (4 0Z4 kvЀ #*K}9) 4 ZB :K?"B _4"KmA4 44 84 ?4z "5A ?5I:4!51Ky\ - BKJ:[ !Z@0 6*61 J:@?}6*ku9) 6 kp91kjAW 24z "5JAW ?5JI:* 4 Ky\ * BKwI:[ )`05+5) I:@?}5 6 46* #:@#K?@&Kq9) B &rKrB__4&BKa49ky4@+j_}5YKC@0Ka9)4,@0kl9)&4 t&C4= C4vS'"C,C+C+k91Ku9)6 kj9) (kK9)@z C4Z C J7`8k9) C?7C ?7k؃:K9)" [U6`:WK9)Ks9)6k9)KwKx ( 8_4khKKw (k9)̟4Kmȑ0̟7kr9) 4hkq91Kh9 BK|9)Ka? K H4:@4Yp[i@[KzKd k}k`9Kd9)44~kp9)Kv9)6k9)A! IW 50kf91Km9 !7? CKa?l 84:@#HIW[Y7@@IWk? +49CH[ [MKzKb ksICkc9h4~ "@7kb9) kh91[KzKeK? k}K? I_ID  44Kz9 :7?Ka? H" 4:@[6p[KzKx kxIZkz9@0tt4~4Kq9 Kl9) Ka?4:@C 2"HKw[6@+Krk?"6 CH[k`9K9)7kz9)7e*1ke4~Kg9 zKqKa? 84:@!H5 @[5W(+!H5 [5Wkj9X4~C4 44 04 k91K|9)7kj9)_=kjK9)57Kp9 8@Ka?"H4:@6 [5Wkj9@ 8t4~`4545+ +Kf9 :Kv9)Ka?"k H4:@[)6y [ mKzKa ku4~Kr9)6Yky9) "AS I 5Iki91Ke9 8@Ka?#+HIw4:@[I79 `[ KzKx ki4~ 0@K9)A*7ka9) kj91[ KzKd ksK? K? @ -IId  44K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ko9 :7?Ka? H#4:@[q7p[ KzKn kl@0tt4~4k`4k`91k`Ѐ "k91Kt9)6ki9)K9) Ky9 8@Ka?!H4:@5 [Y5Wkj9@ 8 t4 ~k`d7kn9) km91k?7K?k?_ Ek?K?Y@7?@ @K?@ @744_774666x77Y7!4=74 44477w 4474 b6b:b8b<b>b@@6 @P@K?@ @Ku9Ks9 k?k?o_4 (744|K?Y@O?_m4 | 274  w[q4z`u4|@ @K?@ @k?ok?k?k?4@4744z  | f7C 04Hw7$Ԁ2_4?gHy@7HsHz d  thu7K?YK?K?K?@O?_e4 7Hv7H}m |@ @K?@ @k?ok?7CKZ@ [KD?4[4zK?YK?@O?@ @K?@ @k?ok? k?k?k?!k?)KE7C7$ 4H 44H?H H!2Hz 4KH r F84[@54?}@]H[@]HK_[@507G5?/KH d04 g4 sHHz [qKE?4 dH @HH@?@ g4 vK>K?)K?!K?K?K? @O?@ @K?@ @k?7Kv؂ k?7[K?K?Y@7?k?7K9A kz9I[ 4k|9AK?Y@7?k?oKs9A (7C[ 4Kz9A( \[ q4+4=  k?Kx9IKa?k?C4:@ 7w*A#+2@7w*Q[79 _]4K>@O?k?ok?7C@04_54z 7_4z4K?YK?@O?Ku:Ks: k?k?ok?7# 04 _u4zȜ@_m4y7 @_4z4K?YK?@O?@P@K?@ @KuK?9O?1/0./0-@/0,7:B04` K|9QˀK>}K|9QmK|9Qk?ok?_%4(70`"K?B4z04K?Y4|@O?k?o@ [ KC `?4zK?Y@O?k?ok?7DKZ7#K]KS } `@K_77? ҕu B 4@ P4HK_4xKVB `  H4ˀ K?YK|9Q?HK?YK?@O?K|9Q?@k?o7C_4 7 K|9QHwk 4 K?Y@O?K\K @_K_@KK_@K_K @kK_KK  P4@ K6? \0@4@KWJJ@  k?ok? k?7DH7k?!4Bk?)!@7HK4KK?) B pK?!!@H H? J@@ _h H(7_ h( HH(6 h4H( @Dԃ DK>K?K? @O?K|9QA4K|9QH(4h 7A4eK|9Q `BKW7`2KZ( Y CӳK@ˀ@k?7_ 4 0K?Y@7?k?o7CKZ@ _@[4zK?Y@O?K_ KW0Y j Y@k 0K\K ??@@4@K_0?@kY0k?ok?7CKZ0Y 07$K__h0Hz0D?@K?YK?@O?@K\0k?ok?7D_ 4@ 0744|K?YK?@O? d44h d ` `Ah`0 h|8`}4|Hw _ % ڋ?Mh|(A,Hz8`54|k?ok?7CKZ0@ _KD?4Hx7?`2H( A4?@[Hz(_}HzALHz8[q4zK?YK?@O?Ku;aKs;i k?k?oK_7#C 7ˀHk]Ks9Y "_]6k|9YKy9Y#K|9YK?Y@O?k?74_-k? BK?_ 4 @@(K?04K?Y@7?k?o_E7Ck?Hw4HzC_JJ 8  k?i4 r@4z "@K>AX4z 4z_K?4K>@O?7?a@4z?@H|C?4z4?w4zK?a??47?iA4z?M@%4zk?ok? k?7D_7#k?!H44@_ Pk?I4 b4"4@4y"K>A 4"x `HC@0C4!(@H76hK_KW"6A "47?I@4!4H@94  0@K?!4_=4!X@A4!:K?I04 }4A4y?GHK> `7?I@4 @HC<4 p@K?!4_54 P@A4 2K?Iz04 z@ `4K>K?K? @O?K|9Q?@7?Ik?ok? k?7Ck?!_%4!7Hd@4䃟 4? 4_!:AD40!74z@4HzKW4@KTA  z4HzK_4KSA  !*H_m4zA4P4Ke9Q?HzH_4zA4 jK?!@4z H74z_U47044Ke9Q4K>K?K? @O?Ke9Qk?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>7C_=7$k?aHt4k?B4&44`4 4 4 4 !444p4r@4z"B HsBu "HK?_}4z!HtB@!:_(k?a HQ@* ?H@R @ (K!" HzK_5`KYA ?  ˀJG!A 4z!"K?a04 4K>7?a4zA`4 ‚K>HtuHs +4<K|9Q?@pK>YO?@AT4z?u@0K>Y@0#@ 7pK>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>k?7KB4`@_ @4r`@`@ bhK>4 4! 8?@@04K>@7?4Š44_g44Ƌ :K_C0C4074@7??E@54# 7k?o7C47?@4 @K? #+p7<0Hx8@4z H@HzK_KWHx8A  44K>@O?K|9Q?@4Ku;AKs;I k?k?ok? 7#k?4k?Ak?! (7K|9QK>K? @O?K?K?4@HK?!HK?_ 4 |A4ˀ}K>k?ok? k?k?k?!k?)k?177D k?A4H! JHC4܋: *7hK?AAd4Z!4`4H444 rHCH @" @H h 7hCAK?A?HK|9Q"6pK>K?1K?)K?!K?K?K? @O?K|9QˀK>k?ok? k?7D77%A74zA4!r@ZHC!b7hC9Ad4z!BHKv +4:k?!ZEHdK?!74[7 r C4\ 4 4Hw 2C4 #7A4z4K>K?K? @O?K|9Q K4\K|9Qk?ok? k?KW67kVB6kBB47D7w*aи"H64`xB24rb"HKA#7KSA a "4_40 `K>ق#@#"ӽc4 7?A \$A00N8E$IE IR\7Ӆ ] HB3Bց ?-֝ ӵ?@ Hg?HKA"6 K_At !4HKVKYHA4 6 !p4Hˀ a4 8 B"6 ].K|9Q=@K>HK\"6K]At  `44@\@0 `K>K?K? @O?K|9Q?@4K|9Q?@]HK|9Q?u@uHg? KE4\@ k?ok?k?7DAX44 87Ke9Q4K?YK?K?@O?444_4yKa!@HK_"6KYA\ ? 0Ke9Q HKW4xKTA  4HKS4K\A  (@AP4z4Ƞ4Ke9Q4zA@?@e4Ke9Q?4z=Hk?ok? k?7CA044 x7Ke9Q4K>K?K? @O?Ke9Q! A(4?4(4444z_=4K?@HzKW +48KTA 0Ke9Q?=@HzK]4K\A >+4HzK_4XKSA  A44_4z ȼM4A@4 k?!Ke9Q444z_7Kx @HzKVKDK?!A  4HzKC4KWAt  (@AK?!4Ƞ54Ke9QK?!A@?@4Ke9Q?K?!=Hzk?oK_4C h7C4Ћ7 7hz_4z z4z_4 RXK?Y7h}_4z "4z_q404K?Y@O?"k6|k?ok> k>K_47CC"7hz4_4z%7HzKY# 7K]A %r47>i_=4z%74K},7hsHz#KTKE A 7,44z_I@$x7@4z$X7_4zk>!A4#(7444z_e44_ 4z 7@@4z7"@Hz"kK_6xKSA  "4HzKYK]K>!A *Ƞ`K>!47*7hCҕ6?{4?#K7U  Ke9Q"RA4"z4Ke9Q"b4zKe9Q"B4zKe9Q""4zKe9Q"4zKe9Q!4zKe9Q!x4zKe9Q!4zKe9Q!h4zKe9Q!b4zKe9Q!BX4zKe9Q!"4zKe9Q!@4zAK>!Ke9QKe9Q=oHzK>!A@Kt=@HzKV4@KUA =+4HzKU4KTA A444K=K>K> @O>Ke9Q?4u7>i7hbHz +KUK_ A48 <@44z@@?%747hdHz KKVKW 4X@A0@<_+44z@@>7u4Hz7hw#KBK] A7`;+44z@x@=747hxHz"KDKS d A6;o+44z@@=U7E4Hz7he K\KX  Ah4:+44z@H@<747hHz KAKY ! A4:}@44z@@<%74Hz7h| KAKX  A84:@44z_@;74_4z;e7HzKT40K_A 9+44z_i@:747hvHz K\KW A4@9+44z_@:]74_i4z:57HzKS40KEAp 8+44z_9@9747haHz KBKY " A4`8'+44z_@9-7_4z9 7HzK]40KDAH 7+44z_@874Ke9Q844zKe9Q#=7"k%6e k?ok?K_47CC!7hvB?4bcz4fCh@HzK\KAHx8A H< #@4H7hyKxCЗ"6?HzKW# 7K]AP "4HzK]7a/KT $ A "4HzKU4KVA "ˀ44#7huBӟ4`b4dBrHzKU4KBU A`@"H4HzKVK\Hx8A X "04Hd4hxKw@_ 7?HzK_"6PKYA ` ? !4HzKY7b.KS D A  y !4HzKT4KUA !44K?YK?@O? 4K|9Q?@HK|9Q?@HzK|9Q?e@%HzK|9Q?=@-4 K4\K|9Q>@HzK|9Q>@HdK|9Q>@HzK|9Q>@5HzK|9Q>]@M4 k54| k?ok? k?k?k?!KW47Ck?1B7%"44?!4_#:4%4! @@4z 87HyK34K=  44K>K?!K?K?K? @O?Kg9Q?4HKg9Q?4 HKg9Q?g44z4z@H4?%7?44Kg9Q#@HH4X   A84?@46h|4z_e4>]7HzHA X4T>o+4H4 4K?1_4z=746ha4z_4=7HzHA 4L=+4H45 6hv^U4z= 7@4z<7^4zHzC_4 (7K?14z_44 "4z@x4@@84z h7^U4z H@HzK_4@KUA  Kg9QHaH4H?  <@#HzHAP7`<_+4HzHA4 H@HH4X   @t44Kg9QHvJ# 7J  HzK]KWAP :+44z@ 4:-7H4_ k?ok> k>k>^m7Ck>!Hx4z4C_k>k>)4``з4r@4 4"j7>@4z"(74@$407^4z"k>14z@ P4HzK_4KU@ $H9^u4z@44HzKY4@KBY A8@$44?^4z_4z#7K>1^4zK>K>!^]4z#P7(4zHzKT"6K_A( $4H|7h_4z"7??K>4z4‚@J4`:4䀶 *@4z"P7Ȁ(4z6?4? 4 ` +Kf9Q#K7Fp4@4z>74@04z!7Hb@Z4U>@K>K>!^54z!(7@4z>M74He@@0@` 4r@ 4!7>@4z x7Ha@94 *@4z=}70444z^K>)44K=K>K>K> @O>Kf9Q?4HvKf9Q?4X4zKf9QH9^4z@4??4HzKf9Q?454?@ 4z>7H|4;@Ȁ4zK>!7>_4z>}7ȀU4zKf9Q>_4UH|HzKS#7KF@, >7+4Hv6hf_4z=7@He4hw_ Y4z=u7HzK]4@KE@ =+44z_E@=77#+7&k?oKW7CB4X x4‚@ 4@ K4\K?Y@O?K|9Q @K?Y@O?6h|_ 4z04K?Y@O?7},  " +K?Y4<p@O?HzK_KY@ ? ?+4HsK?Y6tˀhtk?ok? k?k?k?!k?)k?1KT7C7$B4 4@4H4 44 @4!Hs6aha@?! b HaH6? !4@@<4!hK|9QHa"H7? !4@@4 K|9Q@4K>K?1K?)K?!K?K?K? @O?H^4H7? >_44@@4>?4 EK|9Q5K|9Q44 0@4>HsK|9Q44 P@4=HsK|9Qk?o7Ck?^4!HtB4: rK} H@HzK_# 7 `KW@  p4Hs6uhuK?@p4z J4z^404 K?YK|9Q?HsK?Y@O?k?ok? k?k?k?!k?)k?1k?9k?Ak?I7DKZ(4?KAKF7% @4P!z4 HC"4" 4'4!+4 @!^ 54 4 _4!@^ u4Ka7I7? U!4@@l50Kk9Q75|K>K?IK?AK?9K?1K?)K?!K?K?K? @O?Kk9Q`?5|mH|m5|IH 5@   H!"7hHC 4c>@HKB4RKH  @ @!J4 !b!Ku5K 4 8@HH@5>@Kk9Q@ 5`?H5|`:HK_58 K]@  :4 4_ @>}7}5|Kk9Q`?4U5|Kk9Q`>@-5|` !+`05+ 5|k?7^@04K?Y@7?k?ok?k?k?7%7D^E44!4HC]Ӻ4 pӿ4`A4ra @ L4!7444_4y7! !j!"`# 044K?YK?K?K?@O?Kf9Q?@@Kf9Q?u@(H^U4 @@4 p@^474^]4ܞ@ܞ4Kf9Qܞ4ܞ4_ U4>}7 P@HK_"6!KS@   Kf9QHH=H? 6?= HKY4KE@ =+4`>@HKW4xKBW @ |@=+4HK\4KS@ |  @`K? @O?HzK_KY@d ?  4ˀK>K|9Q?@}K>k?ok? k?k?k?!k?)k?1^7C4 7K|9QK>K?1K?)K?!K?K?K? @O? @HzKW4 KT@ "ˀ4zH|8k?A@4 h|8%K|9Q4^4z>@4x^)4z>@4& 444z^%@>@@H4z>m@^e4zHzK_77K]@  44^M59HuB>%@4|^ 4z=@Hb4AhaK?A@\Hz8he84z^M4ˀ]K>K|9Q>4z5K>K|9Q?4 K>k?ok? k?Kt7CK_ C4€@b4`RKe9a6?? 4!z4ăD!4҃"4؂"HzKU4PK]@| #44z_-@"7HzKT4RKY@ 4 #Z44@@#Xk?)Ke9QKe9Q 4Ke9Q h4Ke9Q@K?!!:Ƞ84 4"7hb@_4` p@HzKS#+78"0KW@ ?+4Hu6Ƞxhv4b? RHzK]# 7"@K_@$ >+ȠHu k4e"P4K>K?K? @O?7h|@4k?!444z^m7 H7HzK_KVK?!@  ȠKe9Q4 d8 HzKWИKU@ =o+@HK?!m4Ke9Q>4M4zKe9Q>w44444z^7 x7HzKAKBK?)A @H@ (@@XK?)4Ƞ4Ke9Q@(K?)?@4k?oK_4C!7C4 Z7hC4 j7h}^4z b(K?Y_4z04K?Y@O?_E4z?@4z^ 4?@47hs@H4z?e@4z^4?=@-4k?ok? K_47CC 4"@4z!744^q4z"7?94^4z"h@^4zk?K?9BP@HzK_4PKV@ 0Kd9Q"@_4z7!@HzK]4RKY@H = !4HzKYKWK?@@ #@@PK?h44>_4@4z2D44K>K? @O?Kd9Q?404zKd9Q?4xK?9Kd9Q?44z4=4?C4Ȝ%4Ȝ4Kd9Q>]@@K?>4HzKT4PKU@@ >+44z_@>e7HzKS4RKT@ >w+4K?9&>4HzKU 4"K]@0 >7+44z_=@=7HzK_4RKC@  ȀE4EKd9QKd9Q='4 4k?o7C^4拀 4^4z @_4z p@HzK_# 7`KW@  @44z^@04K?Y@O?K|9Q?@4zk?oK_4C 7C_ 4z BHK?Y_4z "4z^q404K?Y@O?47 Z7hsBz4?m@^4z?@]4z"e6 k?ok>k>7$7C^4!He@4 Z4?k?K?4Y4z^Y4'(7#+7<&4`` 4r@4b"4B47?4H^4z?5@K>YK>K>@O>K|9Q?@4K|9Q?@4K|9Q?u@ 4#`K|9Q?M@04# K|9Q?%@4$ K|9Q>@4$K|9Q>@04$K|9Q>@@4%`K|9Q>@4%K|9Q>]@4&0K|9Q>5@Hd7??4?#K7_ `4HzKU#7"KA@`5 ?U@ˀHHdHzKT 4"KU@ =o+44 4"HzKS 4"KT@ ='+44 `4# HzK KVKW 8 @4#@<+44#`*@4#p<+44# HzKx KAKY @ ! @h4$YHzK\KW@ p  844z^404 K>YK|9Q?4zK>Yk?o7C^!4!@^A4z!b4^4z!@@HzKY"6`K]@ !4HC4V HzK_"6&KS@ x   44H|7ha@4z JPK>7?^4z "4z@x404K>@O?K|9Q?@HK|9Q?@4k?oK_4C!7C7haKt BHzKW#7'KV@ "4HuB4`?@4r_`47?i4^4z!K} "K?iHy]6!ZK|!@@HzK]4KC@ (}  jˀ4Ks`?@HzK_4bKU@  ˀE+`K|9Q K>و jKv ZHzKS# 7'KBS @ @ ˀ K|9Q04K>@O?K|9Q?@HuK|9Q?@=+`k?ok?7CYk?A2@4!@w4!^a4z 7Kd9Q^4z 7^14z4^ 4z X7^94zk?K?@@7 hKd9Q@K?^4z@4K?@4y Kd9Q@44K?YK?@O?k?7"k?6' ZY4 P4K?Y@7?H? P @@K?ˀK?Y@04k?K?_m7?+@K?]K?YKa?# 4:@X}7'0Y@K?Yk?ok?7$ 047C]%4 d74  `K?YK?@O?k?7k?]4k?K?_%7K?YK?@7?k?o7CY KZY 4zK?Y@O?k?7K_k?Y@K?YK?@7?k?oK_777C`7 Y7@  y]Hz |K?Y4|@O?K_@@k?ok?7CY H7$H_4z B4K?YK?@O?Y)@HHzZHHς k?ok?7C7:YQk?74z_-7 "4K?YK?@O?HzZK?ς dk?ok?k?7C7X @7%HH  _m4z *ˀK?YY@HHwA`@ "_P4_?HvH 7   _6?` H|H w <  6?7?HtH    U7?77?HzH  z X HsH S y  4HwH Z=HHHt 4hsK?YK?K?@O?k?ok? k?7C7%k?!Y7Hu7 _4z0ˀHwA2 }P7?Hb W   B  9_6?` Hsw   VHt6?   !7?H}   Hs6? D z   \=7W?HvK?! Z4H| ha4K>K?K? @O?k?ok?k?KU7$7C7_60ˀzHwA2 }P7?Hb W 6 B  9_6?` Hsw 6 VHt6?7  !7?H} 6 Hs6?7Tz   \=7W?Hv  4Ha4"hbK?YK?K?@O?k?ok?7C7:Y k?Hx7  _4z "4K?YK?@O?HHw ZaK?Hy $ ςhzk?ok?KT7$7C_60ˀbHwHy 4Hs6Hz _ H}7huK?YK?@O?k?ok?k?k?77C7&` H x` YA@4z_40ˀ4?AZY?P7??HHz  W  Y \_6?` HH}  t 6? HHv 7?  " E 7X?HHa:   } 7?HH|  Hs d 4 dK?YK?K?K?@O?k?7@@K?Y@7?@ @K?@ @k?7@@K?Y@7?k?7@0@K?Y@7?k?ok? k?k?k?!7D@"7%@"Kc @4&HyX4 bHc`?Hy" ZHyX4#j( 4$p4Xm4 āHz]4"@7Y47]4 |"74Y)4( 4'p4X4 gY147]I4!`744Y4Hz @XU@ fY47]4 | 74Y4K (@KX4@@K 0kcˀ0K>`u@ ( 4<pH|ˀK>ˀK>ˀK>ˀK>KeH jKX4`H@HH (@KXM4_@H x H|K>K?!K?K?K? @O? _ : W ]  SV@ \CT x4@ӿ< 77Z<  @?@@Ku;Ks; k?k?o7hd>he>hf>hg>hh>hi>hj>hk>hl>hm>hn>Ka?H&7$7H7 %4%0Kh9qKj %IYX 5 eIJ@?IY@%zIG@4^"!@X%475s4 K?K?g~4` k?k?77h_5 @H4 D 4`5@ K?K?~  k?k?77h_]5 H?w5@$4Y-4!k 5y@ 07IY@ 7@ 5:75:@ 77X55z7X5 5 K?K?~4`  k?k?5y7@ @7!k 5y@ 77@ 55y@ 7XE5:7K?K?~4`  k?k?A774 tp4 `55775)76 7,?5yX5!5yXu5!45@ H5X 75@4!I  @5 @x4!X@ ?5!2A7 ("5)A7 ?5)>E@  ˀ84~4 ! M5ph44~Hb>YHn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>˄}hmhk?ok? k?k?k?!k?)KG7C k?1@4zHc`#Hh( H0"jHf$4HsHw d Hg$XH: GXmK?1DRĄX@H}7G? ܋ #D!HHt( Hu0 刀 6# @#*Hx7G? Ջ#D?Ht(Hh  Hh#Jz HXUK?1?-HHa Hy' Hc "Hx C HwH Hh!J HXK?1>HHb H}G Hc!H C XK?1K?1_7Hs(76yHt76y?Hb07 E 7@=Hyˀ8K>Hx Hc!H CK>K?)K?!K?K?K? @O?ˀK>_M@\E@_-@\@_ @\ H _@\E@_@\Hˀ K>_@\H_}@\ H _]@\@_=@\ G @4ś7 Ş'H| ˀMK>_@\% C L҇L HzH ZD:D  " @6# @70#+ @7<P#K @7\p# @7"k @6|# @7" @6k?o k k?\-4z C @\4z C `@\K? C 0@\4z  C04|K?Y@O?C8X7? (7W6 ?7@6?k?ok? k?k?@ 7E@ 8Kc9q( 4$4X4 @( 4$`kd9qXM47] ak?! 7K?!4X4kf9q Xu4zK|9qK>K?K?K? @O?k?ok>k>k>7#7Xek>k?K>4k?7z7k>k?k?k?yk?qk?ik?ak?Y@k?Q!7@ @4z X7X 47]4"`74z4X4k?Y7?7? k?7?7?!k?7?7>k?7>7>k?y4z@k?K>X 7K>k?47k?QK>4k?K?k?K? k?K>k?yK?k?qK?k?iK?!k?aK>@K>! 7Ƞ4H @@4H H 4 `4 KX @@ J 4c ? ``4@44K>YK>K>K>@O>H @@4H jH  X4 K_ @x@ K:@  ?4?4X4z4 _ : W ]  SV@ \Ku:Ks: k?Ku;Ks; k?Ku:1Ks:9 k?Ku k>k>k>!7D4@KZ@" _4"p77>_4 K>48bb@]IK>7" K>4g44_4!@ _ _4H B4% # 7 *!]48 !H7 H(4 !hHz"H!hHz H!hHzH C   !`Hz H C h !XHz(h(H!XHz0 Ch0Kg940kw9_4K=_4K=K>!K>K>K> @O>XA4zK=_@\}@_u@\ _U@\H_5@\H_@\h(_@\ C Xa4zXQ4 Ku:Ks: k?k?ok? k?k?k?!Kd74%7C4&4tk?qKx9!:4K9C 4 "7k9C?7 8077k9C ?7_ @ _?'k?qK9C?=@>k?q4K>K?!K?K?K? @O?k?Ky7?q_4>K9KKu9Ks9 k?Ku:Ks: k?Ku;Ks; k?Ku:Ks: k?k?o 7hd6he6hf6hg6hh6hi6hj6hk6hl6hm6hn6ho6757$K?K?~`4`  ~k?k?7Y77X}4#  7 XU4 + 49 p_4#P7DvF04Ka?4&4'4(4 4 F44z7q_4%H@u7q4k7q"Һ ߀ H@H5kA}"Ӻ |ߋ?5kA _85l5kAbZ zH"B ߈ RH5kA|Ӛ@ *"@ \߃?5kAa ` 5kHAx! Ѽ߀ BH5kAv! <ߋ?5kA|#25m5kAw rH!b <߈ JH5kAw@ "!: Ҽ߃?5kA!* `5k0 iȀ04_@-@_@UH_@@_@H_e@%@_E@EH_%@@_@H ` 5kKy9Ks9y @h@X57\5!755X %5Kx9Kt 5XI7\e5!0755X 5Kb9K 4Ko95kw95zY!4 R44z7q_-40`i7q4Y4z7q?4Dz4_-4 "KzKy9Kw7X444~Hb6YHo6Hn6Hm6Hl6Hk6Hj6Hi6Hh6Hg6Hf6He6Hd6@O6k?ok?K9 A04#\M ڃ `7K9Ky X4Kw9 +`XIKzkdkc9K?YK?@O?@P@K?@ @Ku;Ks; k?k?7KZ_K9K?Y@7?k?ok?k?7#7D 84X47  `?44K?YK?K?@O?k?ok?k?7#7D h74 44X@7 `? ?4K?YK?K?@O?k?o X7\ x4Y77x7K?Y 04K?Y@O?"}6vT"6*  " < 6"6&g?  Y p _ 4  @k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=64 k>4K=ak>K=iX9k>K>K=q K=yK=K=CCK=4xk>cC 4yk>ǃC 4 `_#ªXy57J (@X5!e6 J?@R4K=Y X56O \ 7#7K>K>5X54^K>K>4t_%566? 6@ 4CC*cCZǃCq> #ǣCr@$"K>7@ P5J>M@$jK=Q`$ZK>_K>7_4z@7>p֟t&a&i8G&qFq \ -4:(#7P64ǣ@ 4@ `4 @47`4 4eK=YXI5zM7X)5ZU7X 5:]7X4%7X457X45746K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>47@X5ycܥ@4\7@ 5Yǃq>4\7@59Eq>z?@ V47@5ǣr4V7@`4r4X77@4`47@4eK=QX56K>_K> 4 @K> @K> (K>J I K>K>_]4 0o4oAj6 o!:4  40 ! Ǐ@K>K>_=4 7k?X 6Zk?K>76Yk?5k?k?yk?qk?ik?ak?Y_k?Q - K>6X_uK>5?575?~@6 M Ku:qKs:y k?KuK?1K?)K?!K?K?K? @O?_@H_@H!+ 59 @H4ܞ=@_u@m@_@C8X7? (7W6 ?7@6?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK>76K>7I4K>4 K> K>y ` @ :C_ 4 4 r4V_ b4X R5)A? 8 (@ ( _8 ?5)K:: Y4K?IK?AK?9K?1K?)K?!K?K?K? @O?? crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)? crt0: errno: tsd>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>===>>>>>>>>>>>>>h>>>>>>>?$>>>>>>>>=>>>>$>,><>D>>>>P>>X=>`>>x>>>>X>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>debug-symsdemangledynamicextern-onlyformathelpline-numbersno-cplusno-demangleno-sortnumeric-sortportabilityprint-armapprint-file-nameradixreverse-sortsize-sortstatstargetdefined-onlyundefined-onlyversionUsage: %s [OPTION]... [FILE]... List symbols from FILEs (a.out by default). -a, --debug-syms Display debugger-only symbols -A, --print-file-name Print name of the input file before every symbol -B Same as --format=bsd -C, --demangle[=STYLE] Decode low-level symbol names into user-level names The STYLE, if specified, can be `auto' (the default), `gnu', 'lucid', 'arm', 'hp', 'edg' or 'gnu-new-abi' --no-demangle Do not demangle low-level symbol names -D, --dynamic Display dynamic symbols instead of normal symbols --defined-only Display only defined symbols -e (ignored) -f, --format=FORMAT Use the output format FORMAT. FORMAT can be `bsd', `sysv' or `posix'. The default is `bsd' -g, --extern-only Display only external symbols -h, --help Display this information -l, --line-numbers Use debugging information to find a filename and line number for each symbol -n, --numeric-sort Sort symbols numerically by address -o Same as -A -p, --no-sort Do not sort the symbols -P, --portability Same as --format=posix -r, --reverse-sort Reverse the sense of the sort -s, --print-armap Include index for symbols from archive members --size-sort Sort symbols by size -t, --radix=RADIX Use RADIX for printing symbol values --target=BFDNAME Specify the target object format as BFDNAME -u, --undefined-only Display only undefined symbols -V, --version Display this program's version number -X 32_64 (ignored) Report bugs to %s. %s: invalid radix%s: invalid output formatbinutils/opt/binutils/share/localeaABCDef:glnopPrst:uvVX:unknown demangling style `%s'32_64Only -X 32_64 is supportednmdata size %ldgnu_compiledgcc2_compiled%s: no symbols%s %s:%u %s: Undefined symbols from %s: Symbols from %s: Name Value Class Type Size Line Section %s: Undefined symbols from %s[%s]: Symbols from %s[%s]: %s[%s]: %s:%s[%s]: %s: %c %5s %s%-20s|| %c |%18s| | | | | |%s %c Archive index: bfd_get_elt_at_index in %s %s: %s: %s %s: %s %s: hppa2.0n-hp-hpux11.00can't set BFD default target to `%s': %s%s: Matching formats: %sSupported targets:%s: supported targets: %.12s %.4s%s %ld/%ld %6ld %s %s /%s: bad number: %s2.11.2GNU %s %s Copyright 1997, 98, 99, 2000, 2001 Free Software Foundation, Inc. This program is free software; you may redistribute it under the terms of the GNU General Public License. This program has absolutely no warranty. ? tr(r(r(r(r(r(r(r(r(r(ttttttttrqttrttttqdqttttqtqttqttttttttt<ttttttttttttttttttttsTqlplllLllllll(lPlllllllllllllllllllllllllll(llll$,$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,$$`P$$$$$$$$$$$4$4pnw newdl deletenewdeletevn new []vd delete []as=ne!=eq==ge>=gt>le<=lt<plus+plapl+=minus-miami-=mult*mlamu*=amlconvertnegatetrunc_mod%mdamd%=trunc_div/dvadv/=truth_andif&&aatruth_orif||ootruth_not!ntpostincrement++pppostdecrement--mmbit_ior|oraor|=bit_xor^eraer^=bit_and&adaad&=bit_not~cocall()clalshift<<lsals<<=arshift>>rsars>>=component->ptrfindirectmethod_call->()addrarray[]vccompound, cmcond?:cnmax>?mxmin*szsizeof autoAutomatic selection based on executablegnuGNU (g++) style demanglinglucidLucid (lcc) style demanglingarmARM style demanglinghpHP (aCC) style demanglingedgEDG style demanglinggnu-v3GNU (g++) V3 ABI-style demanglingjavaJava style demanglinggnatGNAT style demanglingconstvolatile__restrictconst volatileconst __restrictvolatile __restrictconst volatile __restrictoperator operatorassign_type_ada____<%s>global constructors keyed to global destructors keyed to import stub for statictemplate <class> class()%d.e'falsetrue0JArray1Z__pt____tm____ps____S,_GLOBAL_{anonymous}___imp____imp___std____sti___ virtual table0123456789Qt__thunk_virtual function thunk (delta:%d) for __t__vtbl__::[]unsignedsigned__complexvoidlong longlongintshortboolcharwchar_tlong doubledoublefloat%xint%u_t-2147483648U...__ct__dtT%d--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument %s%sCannot allocate %lu bytes after allocating %lu bytes undocumented error #%d???UUUUU\`````P4``````````````````````````````````````4444444D4\44\4\4D444444444444444444444444444D XhAllocation failed.Expected ?std::Unexpected end of name in .::Unexpected character in .Unexpected character in .Zero length in .Internal error.Unexpected end of name in ._GLOBAL_(anonymous namespace)aN&=aS=aa&&ad&ancl()cm,co~dV/=da delete[]de*dl deletedv/eO^=eo^eq==ge>=gt>ix[]lS<<=le<=ls<<lt<mI-=mL*=mi-mlmm--na new[]ne!=ngnt!nw newoR|=oo||or|pL+=pl+pm->*pp++pspt->qu?rM%=rS>>=rm%rs>>sz sizeofoperator operatorUnknown code in . [nv: [v:Unrecognized .guard variable for vtable for VTT for typeinfo for typeinfo fn for typeinfo name for java Class for non-virtual thunk to virtual thunkcovariant return thunkconstruction vtable for -in-Unrecognized .Error.in-chargenot-in-chargeallocatingin-charge deletingUnrecognized constructor.[Unrecognized destructor. [::*Non-pointer or -reference function type.complex imaginary Unexpected character in .signed charboolchardoublelong doublefloat__float128unsigned charintunsignedlongunsigned long__int128unsigned __int128shortunsigned shortvoidwchar_tlong longunsigned long long...Unrecognized code.Non-alphabetic code.restrictvolatileconst [extern "C"] , Missing function return type.Missing function parameter. () Template parameter outside of template.Template parameter number out of bounds.ibi iii ll ii i Unimplemented.falsetrueUnrecognized bool constant.:(stdstd::allocatorallocatorstd::basic_stringbasic_stringstd::stringstringstd::basic_string, std::allocator >std::istreamistreamstd::basic_istream >basic_istreamstd::ostreamostreamstd::basic_ostream >basic_ostreamstd::iostreamiostreamstd::basic_iostream >basic_iostreamUnrecognized .Substitution number out of range.string literal [# [#0]_ZMemory allocation failed. /opt/binutils/share/localemessages/.moCPOSIXLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_ALLLC_XXXLANGUAGELANG/locale.alias/opt/binutils/share/locale:.riso#%X%'@'' P'$'$X'('D'H'\'`'l'p*X+,,,,,,,,,,,,,,,,------004$84(4l4p4t4x444444445554585T5X5t5x555555666666999P9T99::::;(;,;;;<@= =? @ A8A<ADAxBBBtBChClCCCCDtDxDDDE,GHGLGGH HHTHpJ@,JDJ,JLLN NOPOTOlOpP@PDPdPhQ$Q(QHQ|U0 U4U UUUVpVVVWWWW8W8WTWxWX X<XlXXXY$Y@YYYYZZ[h[[\ \\\]8]]^^8^^^^_H_L_\_`____`` `P`l``aab b(bbccPccccdhdlddee e,e0ehelexe|eefff<f@flfpftfxffffggghiijjl4l8lxl|mm nnoooop pv@ vDvH vLwwwwx xy yzz{${(||DHx| 04PT,   0L8 < H Lx 0 4( ,X\LP (,tx(,DHPT  8<<@ $lp tx(,hlHd¸¼HLx|`|<@xҔ@DpӌHdՐՔռ@Dք֠,hlؤbبb DH$(48@DLP`dڔژڨڬ|ۀ۸ۼHLpt܌ܐܔܘܤܨ(,݄݀pt޸޼48ߌߐTXhl04(DTX$(hltx t xlpDH < @@DX \  D H   \ `    X\8<tx\`  48\` `dtx $ ( H L  !!"" "8"<"T"X$$$$%%0( (( (**++++++++,,,,,, ,(,,,4,8,,,,--/t/x//0 0p2 22 23x3|348, 8088889@9D9999:X:\=d =h? ?APATAAAAE` * + 9 ; ; ? AH Bx C C D D D G HX L N QL U U Vt V W W W< W| X$ Xp X Y( Y Y Z [l [ \ ] ^ ^ _ `T b c f g w |   4 | L d    | t  L ֈ    , " % 0 2 3 8 8 ? @"$Revision: 92453-07 linker linker crt0.o B.11.06 981204 $/usr/lib/dld.slERROR: mmap failed for dldERROR: mmap failed for TSDbug-binutils@gnu.orgbsdposixa.out@""@"*@"2Ip@dICI@LI@pIfIhIlI@tI@tI@hI@XJPJ@`J oJ0tJ8@\JH@TJX@DJ`Jh@lJx@PJ@H@":@"B@"J@"R@"Z@"b@"j@"r@"z@"@"@"@"@"@"@"@"@"@"stXXXXXX^^___(_0_P_X_p_x_ __@___``.::.::.::.::.:: type_info node type_info function.::.::.::.::ZxZZZZZZZZZZZZZZZZZ[[[[[ [([0[8[@[H[P[H[X[`[h[p[x[p[[[[[[[[[[[[H[[p[[[[[[\\\\\ \(\0\@\H\@\P\`\h\`\p\\\\\\\\\\\\\\\\\\]]]]]] ](]0](]8]@]H]P]X]P]`]h]p]h]x]]]]]]]]]]]]]]]]]][^^^](^ ^(^0^(^8^H^P^H^X^`^h^`^p^x^^x^^^^^^^^^^POSIXLY_CORRECT: ii i(i0i8i@iHiPiXiPi`ihipixiiiiiiiiiiiiiiijjjjj j(j0j8j@jHjPjXj`jhjpjxjjjjjjjjijjjjjjjjjkkkkk k(k0k8k@kHkPkXk`khkpkxkkk`kkkkkkkkkkkkkkmmmmmmnnnnnnnnooo o(o8oHo`ohoxoooo  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000@"@"%04x%02x%08lx@U$.$?e`gpstw3<0@c +??332990ֈ?|HX,c8^8%d;0(3DQdN`T4|??D0X<(ELf;??A`YAH^ ]] ?[?_QL*DG\UVW<XpYUWW|XZVtW X$Y([lCDBxC8@$@$@$@$:T:;^p2binutils/binutils-RUN/opt/binutils/bin/objcopy010075500000000000003000010000000732753200700203310ustar000300000000000000@?@8XxxP((((GCX(+@?  92453-07B11.17;^ 92453-07B11.046g0@  X"((LX 88tX!??X!??X &xj&xjX 8@40@40X HppX IʈʈX Xʈʈ(>(@`>(@<>( @P>( X@ Xh>(`@0`t>(&0@10 >('0@70>((@7>(P@8@\@>(R@8dY ? +@ $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$y </#|;d'!0 <p(Ohů;A8v˚vbR b . b )٫JȀP8[XDgkR'i0HVL "f/v'6!xy!xD!xry 4'APנu R`aDg6mTL,שL'R'̃!xT/}(24!x݌/!xg6OXkQ0k\T/X\T !x/P )'6Y//]]! '/!x\T/Bj+ 4gyh!xng@M5]E Yœ03tftfpr͈ S)Lr*rZAYZA5axU)qVlGɘɘwqS 0| oN)bX,ҸW[\ip>>a9' ƿU{mo2geدH<9j%y{t57A$=;>t0;_u~klhSOŗ.l9Ҁ;ahslN;\wpan[Nz Gf^<,$"dsxُZD geX}|BK(.Z~_Wd8EjUjKCJ|+V 6YUD,_J9 ,A3׻8fC1Y+ulklh ]L./"æC  '@Bp{`wgx!$0bPDd}2Y|BQ4݀C.k~_M6/RpqR)J)rzȶVB6YO"d{?A˚v8vhů;An bRY;tltD8rP.Y;2Y;Y;'bXs,2K[\ip>j>a% '-P`  "  p@:v@:}@:@:@:@9@0U@U@U@0U@0U@0U@ U@;U@U@UʈUʈU pU @U#@U)UU)U/\U?UOU]Ub`UkDUUUCU?U!@4U        )6<CIOV_ekqx %-3:BIR]dmtz #,3:CVkz%3GTh :M_v.C_q'7EVgw $ > _ u   2 C R d p    1 D X h x  8 M e   % 9 G [ s $x$|$$$$$$$ $$%(% ,%0%4%"8%*<%2@%:D%BH%JL%RP%ZT%bX%j\%r`%zd%h%l%p%t%x%|%%%%%%%%%%&& &&&"&*&2&:&B&J&R&Z&b&j&r&z&&&&&&&&&&&&&&& &'' '' '"$'*('2,':0'B4'J8'R<'Z@'bD'jH'rL'zP'T'X'\'`'d'h'l' X' \'/tmp/libtool-17744/objcopy/opt/binutils/lib/opt/binutils/lib/libbfd-2.11.2.sl/usr/lib/libm.2/usr/lib/libc.2_tepv_ktepverrno__ismt__dld_loc_hex_valueoptopt_SYSTEM_ID_CPU_REVISIONopterroptindoptarg_FPU_MODEL_end_environ$RECOVER_END$RECOVER_START$UNWIND_END$UNWIND_START$ARGV__text_startfreadmemcmputimemkdirmalloc_isupperwritefopenctimerenamestrrchrsprintfstrcpystrcmpreadstrchr_startcallocstrncasecmpchowntolower_isdigitfclosefgetsbsearchfprintfexitopenunlinkreallocrmdir_isalphachmodstrcatstrncpyqsortstrtolstrncmpstrdupvfprintfstrcasecmpgetcwd_islowergetenvlstatsetlocalestrtoulfstat_isspacestrlenstrncat__flsbufprintfmktempfputcstrpbrkatoiatof__assertsscanf_isalnumfreestrstrstatstrcspnclosesbrkabortmemcpystrerrorstrspnmemsetbfd_initbfd_is_local_labelbfd_set_section_sizebfd_set_formatbfd_get_stab_namebfd_hash_traversebfd_set_section_contentsbfd_get_section_contentsbfd_hash_lookupbfd_hash_newfuncbfd_get_machbfd_printable_arch_machbfd_set_symtabbfd_get_errorbfd_decode_symclassbfd_scan_vmabfd_hash_table_initbfd_check_format_matchesbfd_set_relocbfd_get_archbfd_check_formatbfd_get_section_by_namebfd_openwbfd_openrbfd_coff_get_symentbfd_coff_get_auxentbfd_hash_table_freebfd_errmsgbfd_get_reloc_upper_boundbfd_set_file_flagsbfd_hash_allocatebfd_canonicalize_relocbfd_set_start_addressbfd_closebfd_openr_next_archived_filebfd_set_section_flagsbfd_make_section_anywaybfd_set_default_targetbfd_map_over_sectionsbfd_make_sectionxstrerrorxexitobjalloc_create_objalloc_allocobjalloc_freemainhex_initobjalloc_free_blockfnmatchdcgettextconcat__d_trapsetup_sectionget_sectionscompare_section_lmamark_symbols_used_in_relocationscopy_sectionieee_name_type_newfuncieee_write_undefined_tagieee_add_bb11_blocksieee_start_compilation_unitieee_start_sourceieee_empty_typeieee_void_typeieee_int_typeieee_float_typeieee_complex_typeieee_bool_typeieee_enum_typeieee_pointer_typeieee_function_typeieee_reference_typeieee_range_typeieee_array_typeieee_set_typeieee_offset_typeieee_method_typeieee_const_typeieee_volatile_typeieee_start_struct_typeieee_struct_fieldieee_end_struct_typeieee_start_class_typeieee_class_static_memberieee_class_baseclassieee_class_start_methodieee_class_method_variantieee_class_static_method_variantieee_class_end_methodieee_end_class_typeieee_typedef_typeieee_tag_typeieee_typdefieee_tagieee_int_constantieee_float_constantieee_typed_constantieee_variableieee_start_functionieee_function_parameterieee_start_blockieee_end_blockieee_end_functionieee_linenostring_hash_newfuncstab_start_compilation_unitstab_start_sourcestab_empty_typestab_void_typestab_int_typestab_float_typestab_complex_typestab_bool_typestab_enum_typestab_pointer_typestab_function_typestab_reference_typestab_range_typestab_array_typestab_set_typestab_offset_typestab_method_typestab_const_typestab_volatile_typestab_start_struct_typestab_struct_fieldstab_end_struct_typestab_start_class_typestab_class_static_memberstab_class_baseclassstab_class_start_methodstab_class_method_variantstab_class_static_method_variantstab_class_end_methodstab_end_class_typestab_typedef_typestab_tag_typestab_typdefstab_tagstab_int_constantstab_float_constantstab_typed_constantstab_variablestab_start_functionstab_function_parameterstab_start_blockstab_end_blockstab_end_functionstab_linenoalias_compareerrno__ismt_ktepv_tepvbfd_und_sectionbfd_com_sectionbfd_abs_section__iobChunkS3Forced__SB_masksbfd_target_vector7!?9" 7]!9ӽ9Y4!:ӽ9Y4T ;|ӽd Y"ӽ9"ӽ@>B! @ Z A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  a@@@ @7]]@]2@@ @] @@ @@ @ @*@ :7!?9" : B*= @ Z ]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]` =@ :7]@ k? k?k?XZ]XZ]XZ]XZ]d@"Z]> ZZ]> ZZ]9 Z8 =@Y :Z @Z@ ZZZ] ZZ @"ZY :ZZ@= ZZZ@= Z ZY :Z]ya: =]: =]  : =@4ZBu ZZZZ ZZ]ya: =]: =]  : = @4ZB ZZZM ZZY :}@4Be]yZZ5@*Z@ya AZ@ya AZ]ya A @Z@] Z]: =] y a: =4Y(ZYY8Z@] Z]: =] y a: =4Y(Z YY8Z]Y Z @*Z@YA AZ@YA AZ]YA A @ ZZmZ@@K?@ @Ku3QKs3Y k?#a87{7 +~h#+~h8 'y 4yEe'y 7D7%767+4>#"0744445 rנjb+~h%+~h% (4Ц @Ц D(43 H?(ਃ 43 ` 7+4>7D7%7744z#*74444@H@7D7%7#,7444+~H8 7D7%77Kv؆ 24e74444#0/7@@@@ 7K?@ @@@@k?7k?#Yk? 7Y k?4@4 @@K?K?7@4K? *@K? K? 7@4K? rKa?H:@7?!#7 4@04@x7?!7?!7@4#979 04@4Ka?@ H:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 86 0.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?ok)4`@44` G>- ""46 _4K>9K>Qk<+~H<K>i *K>y4ߟ444K>IKa_k? k?54@p44? 7+~ Y4Y@4:p_4h4k?4K>a5k?4@44?"p74@ 4K+~k>44k>Kk>v k>+~H3k>+~4'k>y 4 c?+~K?4=k>Ka?43k? Ka?44k?֠ k?Ka?45k?7vk?1+~4<!0k?!(k?)#7 @4_47=)"6 p4_4G=-+~"6 4:p_M4_+~"y6y04:p_4 949@+~4:p_4] k?)Kk?9k?A k?Ik?Q@k?QKqK>Akf k?q( k?4?k?(k?47k?k>  k>7uk?y7>7>444?]7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4!4! <4?@@k?7k?#Yk? 7Ypk?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?!#74_-4@x7?!7?!7_4#9794_4Ka?_H:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 86P0.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?7Kv+~ H4?44477K?Y@7?K?Yk?4?k?474_4$4?7 k|_M@eK?Y#+~74:_M4%K?YKu3Ks3 k?Ku3Ks3 k?k?ok?7# k?44`U |4 KxK?_5744U <4 K?_744U 4 K?_7KzOK?` J#47-U4 +~K?480_U7_u4zK?YK?@O?k?ok?7# k?44-AU4 KxK?_7#47U4 K?_u744-U|4 K?_=7KzOLK?` B44-U$4 +~K?48`_7_4zK?YK?@O?Ku3AKs3I k?Ku3qKs3y k?Ku5aKs5i k?Ku4qKs4y k?k?ok? k?k?k?!7F4 4X_4 7446q4_4 ?44|K>K?!K?K?K? @O?4_]4!?_e4=46q464_4 -?464_4 _464_4 464_]4 464_%4 M464_4 464_4 474_}4=47_S 44774_}7 k?144471Ut4 7O4447qU<4 +~49O74Ku3!Ks3) k?k?ok?k?Kc7D` @7%Hz_}4 (@Hc`?@ 244|K?YK?K?@O?S 04X7k k(k8k0k@kHkPKMk|k?ok?7D7#S4H |K?YK?@O?Ku6AKs6I k?Ku2Ks2 k?Ku2QKs2Y k?Ku3Ks3 k?Ku6Ks6 k?k?ok> k>k>k>!k>Ak>I_7>cK>#h@S7"K>A7_67у#7K>44z_4 @DW: 448U4 K>AO7_U4K>z 4 K>7= `@"044F4@4 J@? #B# 04?4@( "4c@(0@x(0p4 0J7C7(0  ?7 0jC7( *6B(0@B !ڀK>I_4z4@v=4K=K>!K>K>K> @O>"467U4 Ka?H:7_u7K>A4O7K> 447Up4 Ka?H:7_7K>A4O7K> @04✍@ @04]@k>1#478AU4 K>1k>174OK>AK>1k?o7# @k?Hy_K? 8@Hc`?@4K?Y@O?ςK?Yk?7K4 7?P+`Kw! 0KzD K}0 @Kw @Kx K_4K 0@K h@Ks  ZK J4K?Y@7?ςK?YˀK?YςK?YςK?YKu3Ks3 k?Ku7Ks7 k?Ku6Ks6 k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?y7CKZp4k?K> ]i04 7$64F4Ka?4*4+4,4 4 Ka0I I@P6 7Kb0 zHsHB0B0 R B_ : 6 _6 6PKr0 j _ I _ K 2HxC0B 8 Kw 4@!*$:PI _ u6R7HB077HxC0 >@_M6 Q@**I K3JtJҠ_B - 4Ky0_6>@4Ky0_u6>@4I _4z!@4_m5 BUKy0 _ "I _ K 8@K 4@?@Ky0ǑXK 4 4@@Kr0R04w 4?]@K 4?5@ 4?@4z_%504߂@! JKu0 Ky0_U6 Iנ?׿i - @Ky0_6 0@Ky0ɀ @@_6 "I4>"iK?  /44Z7 K? 4K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?k?ok?Kd0 @7CH_ 4z @@H?@4|K?YK?@O?HKu4Ks4 k?k?ok?7d0Hk?` hk?Hy_ K? @Hy_ K? 4dHc`?HyR4K?_7 |_K? ` | K?YK?@O?#478U 4 +~K?49 O7Hy"468U p4 +~K?49@O074dKu1AK=  73844CY7ZKx19  @Ku19Jv66Kt1A76m67@v@}Ku7Ks7  k?Ku5Ks5 k?Ku91Ks99 k?Ku7Ks7 k?Ku71Ks79 k?Ku6Ks6 k?Ku7Ks7 k?Ku8Ks8 k?Ku8Ks8 k?Ku8Ks8 k?Ku8Ks8  k?Ku7qKs7y k?Ku6!Ks6) k?Ku9AKs9I k?Ku6Ks6 k?Ku9Ks9  k?Ku4Ks4 k?Ku7Ks7 k?Ku6Ks6 k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>YKT7E7$K.J44I 4 -H`_4-Ku p4)#479U4 HI7k?HK8H_5HK1!%4#K  Kvx v 蘀74 HHV4}7n7R @k|1Q47k|1IHIv7k>ɋn7Ky0 @Ky1QA047K ڇ! Kz K}0 Ks0و Kt0ш Ku0Ɉ zKv0 jK| ZKa JKw0 :Kb0 *Kk0 Kl0 Km0 (@+~H9Kx1Q_4K>7R  k|1IK>44k?Kw1Q_ 7k>Ka0 @027>7w1I4@ 5Y,@Ky1IK>_M4+~H94_4Kip 0R4I:k?4I9(_I8 ,I) ?4Kv1 K|1!*" (5(R D5Cy1 57_7H`@4 C(7Kx@KH h  ,.5k? 45X_5+*  ? 5h_=@HH6P447* Z44Y;1U4 _}7_7H4N74 hkg11HK}1) _m4'P@HKM 4Hp_] '@HK*X_]47_u45y75V4=7&@H`_ 4'H@Kz1Q @_@Kz1IKs1Qz @_@+~H94_4Kjp !4 IY_4i\(&7IX_4'@IZ_a4 (7 IH IP?4IY(_m4& I( BI0IA(h=8IB(h]0IU(B(ןb(I8 IS( I@ j}8 IZ( K\` k\`IJ@>_IYKw1 @Kx164 H R5zk?+~H977?_4+~H744_5YR\5z745x_7Kt1!5L? !x4 K _C(-D@KH 5t K88KW8  B  _4 B  55k%@Ku1!45:T4 K_7_755yN74 kl11Ku14w4 5J? C(7CHK8KHKx '4 _=43Kx#:479:T4 IJ_e7_75z5YN74]ks11 449aT4 N7K=NTH4ke11N,H4kx11!45:T4 74_757_ 455Z_ 75Nd7H`N TH4kw11 44:qT4 _ u7_ 7IY4N74`k11N H48kn11N H4 km11_ @U _@✭KxN H4 kl11N H4 kk114 hkj11N H4 @ki11_=@u@N lH4kh11K=K>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>Ku2Ks2 k?Ku8Ks8 k?Ku81Ks89 k?Ku8Ks8 k?Ku8Ks8 k?Ku8AKs8I k?Ku4Ks4 k?Ku41Ks49 k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>a7$7CK:k>qN7%k>y4_7#Hth4_4zKs1174`00X4&+~4)4*4 4IK>yN59`K>q7_U7Kx7 @4IK67>57"`74R @77"pHy`_u4"4_5 5_ 5_5 @NIkk11Kw 7>A5K>q_e5 4z5 _u75 7_5Kz11@ =4 _4!@NH4k|11"46;T 4 Ka?H:7_7K>y5N7Ht#47;T4 IN7]4N54kb11K=K>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>N$H4eka11_4z (@NHz4kv11 8@_}H_HH?@_K>yK=Ku7Ks7 k?k?ok? 6k?k?_7 @7NK?4k}11K>K? @O?4_-4z 0Ht0JK?_4 (7N$K?4Uk114z_45K>7?4_m4z!0Hs0JdK?_4 (k?!NdK?4kw114z_7_K?! (@NK?45kx11_4z>@NK?4ky11NK?_@ @NK?_K?4kz11@P@K?@ @Ku9Ks9 k?k?ok? k?k?k?!K6 7#7DH7K% 0Kt%zKu0%jHz_474 Kb@ 0 H%Kz $H $Hy_4 7 44]H0H( BH0@( h8`(h0HH8=+@(H0h8`(h0H8H8=+>@H@ h8Hx`h`Hx HH4 HP ?X4_q4 r 44K?!K?K?K? @O?@@K?@ @Ku8Ks8 k?Ku7Ks7 k?Ku8Ks8 k?Ku7AKs7I k?k?ok>k>k>k>k>k>k>k>k>k>7&Ky117E7 %4#H H@K$ғ 0KzD$K}0$H_Y4Kh7 0H`$H@Ki $*H $@(-CHXHHk?Y7 04_u4ch7 !444_e5HHH#bHH#RHPBR K?Yk>K?Y4_a7K?Yk?44K>_5#@NH4ka11R`5zKw1Q744_u7b07KzH @R5zk> `4 5+7 `KJK_)Ky0ـ @ ` 5J5_5k_5:K>5M04 4558_5HHh@@(H ݍ`(RK?YK?Yk?7444_7!@NH4pkv11_!@4œ]k?YNHH4 kb11N H4ku11K>YK>K>K>K>K>K>K>K>K>K>@O>Kw1A@7?Y_4K?Yk?445_Y4 (@N(H4k|11_4K>Y_qK>K>Y@ @K?@ @KK6@@ @K?@ @K_K7K J @B@"K8J8B@4@4? _K8@4 @4?KHJH @4 4@@ @K?@ @k?ok? K#X7$k?)`# k?1_e4c 7"@RP7K?)K?174_e7b7bp4Ka?4?KKa?xP6x?H947Ka? } JK T(4"7_@a} 6JHS S( 38:H5u (@JuֿjuJKJ|K S( 38:H4t (@Jt֟jtJKHJ S( 382H"S "Jz_jzJKHUJ S( 382H<| "Jy?jyJK~E7 ` @_A4zK>K? @O?K?)H:N 8k?K?K?)HZN k?ˠeK?H5k?! (Jԟ (j (J (K 7k?ok? k?k?KV7CJ 0 Z44Y=T4 HuJ7NHy4K>K?K?K? @O?I 4zK>7?ik?7?yk?7?a7?qL4z ˀeK> 4<_ 4z74=_ 4z7 0K?q4z_ 4 @K?y4z_ 4 z4h`"h`6 4zk?!_ 4 (@K?!4z_ Y4 j44=!T4 _ q7_ 7Hy4N 7ˀK>K?qk?44zK?a_4 :K?yk?44zK?i_Y4 j44=qT4 _7_7Hy4N 7ˀK>ςK>k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=+~47 k? 4>Qk> 7H7'Q|k>444 !4Ka?4*4+4,#4-744444? $"4k`11 54_4wKz11#@Ky 7>@5 @ Kx@l5kl114^5Z 5Z@^4k?K>54Q K> >@ @N4>Kv 84)K| @Ka04 0kbKl1ɐ`04  *5`Ka?4:@^4b@4*Ka?4+ Kt=Kl11 ^m7>}@44>TP4 Iz^7 5Np7@ Kf1Kc1Kc1Ýk?Kz1^ 4kokrkqkpKz1^ 7y0ek?Kz1^ 7y0=k?%Kd1kokqkoko"k?k?N X ɼk`11_!5 @_Y5]44K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=Ku5Ks5 k?Ku3Ks3  k?k?ok;k;k;k;k;k;k;k;k;k;k;k;k;k;k;+~ zk?474x>k4y_644ySl4 Cx1 7M6?Ȁk?Kz1Mt4ykg1k|x}kg044yS4 +~490M7Ka144yS4 +~49PML7K|1Kz1M4y0kg1!k|Kz1Md4yPKa?}h<Ka?eh'Kz1^7y0Ek?Kz1^q7y0k?Kz1^I7y0k?Kz1^!7y0k?Kz1^7y0k?k?44yS4 M7+44yS4 Ka?H:^)76Z7ML5K04k1aKy1a K?_4y+_4yK|11K?YK?@O?Ku4Ks4  k?Ku31Ks39 k?Ku2Ks2 k?Ku6aKs6i k?k?o7?(a4>hdhehfhg 7%_4a744_4`7+4'?44_@X744_4 44_M_7Ka?H'_}4_m4`ˀHb?ϟHb?Ka?H%_%4Ka?ϟHh%Ka?H&_4_4Ka?h&4?Hb?Hg HfHeHd4~@O?Ka?ϟh'Ku2qKs2y k?k?7K70k?K8@7?k?_k? @K>@7?#:479S 4 k?Ka?H:^a7K?K?M7uK>Ku5Ks5 k?Ku2Ks2 k?Ku4QKs4Y k?Ku3Ks3 k?k?ok>k>7k>7:k>_7>ɋ 7G>> J G>݆b @K>_K>!7 @K>_e7>^mK>4K>YK>K>@O>K>_-K> 7?4G>K>_K?qK?y_-K>_W4G>K>_ҹ%4"46S 4 k>Ka?^ AH:K>K>M7^ K>4#47S 44 Ka?H:7^ 7K>4MD7k?ok? k?7C7@k?!7!7?k?K?!4z4@(4!@HwJ" :7?k?K?!4z4@ 4!:HK *4z4@7?!@K? bH}K`0@:K?!4z4Kl4 4k?K? :449@S4 HyM<7ȀH4Ȁ84Ȁ(4Ȁ4Ԁ44K>K?K? @O?Ku8!Ks8) k?k?/,ok>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yk>k>K= k>40, 7e1qk>7k1y7Ck>44k>k>k> k>K> k>4zK>_K>K>7S_U4z7 0@(8CHHk?Q 5Z744z4_7#A(?DIHk?Q 4k>44z5_a7#ڈ BK>k?44yK>BK>$7K>42 44 F4HpJP5z7HoIh75z Al7HnIP75za7 75(.5k  4k?7>K>K>Ka?4:@k? :7?Hx49'00N8D]'D5kjHp@@^4K>6р K>B4$*4K=K>K>K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>O>@/0,^@Bk?^IK>7^aK>k?Ka? Z .Hx4:@4Y]@ˀK=^ @k?^K>^7k?K>Ka?4:@ : MHx]U49ˀ=K=ˀ-K=K>   0 ]67? !b5_R7]6 b@?Hw5zJPy74 M6bE?]6 b@?Hw5zJP74 MP6bE? 7^5]67? % 65/7k?55k?5@6K>45B 5;5k@0@@ @ˀK=ˀK=k?ok>k>k>k>k>k>k>k>k>k>k>k> 8 7#k>77E4 ك 7+K>4Z4 4 HI7?I4Iy 7C?QH" :k?K>44B04w#(7 K?Y5]4 7? *!5߁5Q77]77?  IK4M57^55Q@77]-77?  IK4M57^15 @^55]57?  555k?G?eҹ5C?a@K?IK?Ik?5G?eK>B C?a 5kfH@@ K>B5 4K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>ˀK>Y@X@@@ˀUK>YˀEK>Yk?ok? k?7#k?!k?)_}7` 074K>K?K? @O?@(?@HHk?Q4k?1K?!44^7 ˀmK>K?)K?!4E \K?1 *ˀ-K>^@̂Mk?^K?14ς yk?ok? k?k?Kbk?!7F7cHB z7%@ 7^@KK?!7}0 f7y87x@  QHKw6RA4! 6ku  <K>K?K?K? @O?Ku7Ks7 k?k?ok? k?k?k?! z44ypS4 Ka?4:@k?1] ]7K?1] E4y4$Kf7e0צ H !_H (7K?1] 4yPHH K?1] 4yH] }4y HK?1] ]4y0HK?1] =4y@H@ @HK?1] 4yPK?1] 4y`4RX7K >צK>K?!K?K?K? @O?k?ok?7cH4? `@ ^ I@ `_4c k`K?YK?@O?k?7Ka?7X#4:@]7K?Y@7?k?ok?k?k?7#76P4@744@^7 K? h He H@P$4744^y7  eH4 K?YK?K?K?@O?k?77KX h7?KX Rk?KY 9(77_=7K?Y@7?#:479S4 _7ˀK?Yk?7P4hk?44h^7K?YK?@7?Ku5Ks5 k?k?ok?k?7$"7C 06@P4744^!7 P4744^7 H  e@H "+~4:049`_4 d d4 `h` h`(K?YK?K?@O?k?ok?k?7CH7$"z 06d@!*K bHC_@ *CW@ ] 4!H?@P4744^7 HK 6J?64 eK?YK?K?@O?#47PS 4 _7ˀK?Yς ek?ok? k?k?k?!k?)7C7$7#Z 07D@ H64K>K?)K?!K?K?K? @O?Hy B#47S 4 _7ˀuK>P4 4k?744^7 P<407440^7K> 4?4zi 4 Hw64hh _ e ˀ]K>k0ςEK>k?ok? k?k?k?!77'7D 06H! H P4(744(]=7 gK>h e fH7_K] @KK ?@4K>K?!K?K?K? @O?ˀK>"z46y S4 _7ˀ}K>k?7K] bK_ RKW BK k K?Y4@k@ @7?"46S4 _7K?Y4@7?"z46ySx4 _]7ˀK?Yk?ok?k?KS7C` 7%Ht P$407440]}7Hy 4?h Hx 7K @KK?@4hd K?YK?K?@O?"46 0S4 _7ˀK?Yk?7K_ RKW @@J j K?Y4k_ @7?#7 4S84 _7K?Y4@7?"46 S4 _7ˀK?Yk?ok?k?k?KU7C7%!7H( JKH}] 247 ?!6?@P ,4744]7Hs 4?48 47h`4k H(0Hv 07Hhf(K?YK?K?K?@O? Z44Y @S4 _7ˀK?Y7`  ς] $k?7#47 S 4 _7K?Y4@7?k?7#47 S4 _7K?Y4@7?k?o7 0ˀ:4_4 k004K?Y@O?k?/,7p (0H 4K?Y7?@/0,4 _54 ˀK?Y7 ς/ k?ok?k?k?7 0064 _4 @7׀4K?YK?K?K?@O?P4744]-7 4 uh0k?7#47 @R$4 _ 7K?Y4@7?k?ok? k?k?77? `06KW @KW ʐ  Z604k?7_ m4!7ˀ8K>KX 47(4K>K?K?K? @O?#:479 R|4 _ ]7ˀK>#7 4R44 _ 7ˀMK>P,4744]7 K>4  h0k?ok?k?7$7P4 744 ]7 4 K?YK?K?@O?k?ok?k?k?7#74_ 4 @744K?YK?K?K?@O?Pt4744]7  u k?74_=4K?Y@7?k?o778_40K?Y@O?k?778_4K?Y@7?k?778_]4 K?Y@7?k?778_4 K?Y@7?k?ok?k? 46_7 8744K?YK?K?@O?P$407440]}7  k?ok?k? 46_72C`Pt407440] 7 K? K?K? h h(K? h( d4|K?YK?K?@O?k?ok?k?k?7#74_4 @744K?YK?K?K?@O?P4744] e7  u k?o2CˀJH| :4_4 0 |K?Y@O?k?ok? k?k?k?!7#7 H644K>K?!K?K?K? @O?4_4 74PX4744] 7   - k?o2Cˀ*4_ 40K?Y@O?k?ok? k?k?k?!7#7 H644K>K?!K?K?K? @O?4_-4 74P4744] 7   - k?ok? k?k?k?!77' 0064_54 P7Ԡ44K>K?!K?K?K? @O?P4(744(]7 K> K>  h E k?ok? k?7# 8744K>K?K? @O?4_4" 7Ƞ4P`4k?!44]7K?!= k?ok?k?k?7 007#4_4$ H7Ԡ44K?YK?K?K?@O?P@4744]7  u k?ok? k?k?k?!7%7 H644K>K?!K?K?K? @O?4_4& 74P4 744 ]u7 K>    k?o2Cˀ*4_4(0K?Y@O?k?o2Cˀ*4_U4*0K?Y@O?k?o7#k? P74K?Y@O?_4 p7ˀK?Y7??蟽@"46 0R 4 _7ˀeK?YK?@h4y=K?Yk?ok?k?k?7&76P4 744 ]7 K?4   K?YK?K?K?@O?k?ok?k?k?7&76P407440]7 K?4 K?h h(  K?YK?K?K?@O?k?ok?k?k?7&76P407440]%7 K?44  h K?YK?K?K?@O?k?ok?k?7$7P4744]I7 4 K?YK?K?@O?k?ok?k?k?7&76P8487448]7 fK?4| eK? dK? K?hw hx(hy0K?YK?K?K?@O?k?ok?k?k?7&76P0487448]7 fK?4?4| eK? d hw hx(K?YK?K?K?@O?k?ok? k?k?k?!77% 0X7DH@ H z44,_ %4 7`44|K>K?!K?K?K? @O?"z46y R<4 _7`4|P04744]7 44 fH44k?_79 `4|k0 k?ok? k?k?77# 07FH B 44 R4 _7Ƞ`4H4.u HH64y]iJ BԤ44K>K?K?K? @O? z44y R4 _7Ƞ444._4 7ȠM4P 4k?!44] 7K?!44 H4x4k?_Q6 Ƞ4k0K?!} \k?ok?K?7 8X7##47 pRd4 Ka?Hx4:@7\ 4 d4K?YK?@O?k?ok?k?k?KS7D`!7#H H( rK bH 8@HC_@w \=4y!ZH?@H?e@HJ H jK ZH 2HCX@y \4y H?@H?m@4K?YK?K?K?@O?"46 R4 _ 7ˀK?Y}H0mH0k?ok? k?k?k?!KE7# 7H H K H Z H0K: 8@HC_@w \4y H?}@H?E@H?@4K>K?!K?K?K? @O?H0k?oK?7#k?7?Փ !" 07K @K?@k?k?Hs6t?ՎHuJJ K?_%7?|4|#47@R4 k?K?4y@4Ka?K?4:@\74|K>@O?H|K7?_UK?|4|k?7 4K?Y@7?_4 ˀK?YKK? 8@K?KJ ?@@K4, 4. @4K=K@J| ZK< RK?7?ՎR :K8KK ?K<׀4@ˀ@K9eK9k?7 4K?Y@7?_M4 ˀK?YK4& * ˀK?YK}KKeK<k?o 7K?Y4@O?_4 ˀK?YK4& R ˀK?YKK zKK?YJ|@O?KK= }KK?YJ@O?k?7 4K?Y@7?_u4 ˀK?YK4* Z4( : " ˀK?YmK]KMK=Kk?7 4K?Y@7?_4 ˀK?YK7? ˀK?YKK 0ˀK<@ 0ˀK<@ K? @K< @4? K? @K<(@4?k?ok? k?k?k?!k?)7C7$k@XKZ8k?1Hx07hz@He!0hy0HhwHh`PHK?1KH7!"H 44H RK B4zK?14@H5!I?4zH K?14?4z@4 H>H4K>K?)K?!K?K?K? @O?ˀK>و>4HHK?1!7>@ˀeK>ˀUK>ˀEK>k?ok? J67$0k?!j""҇  hk?Hw04@K? *HHyK?7 ˀK>Hw04@K? ˀxK>k?Hw04K?@`J ˀ0K>k?H}04@ K!ˀK>ςK>HHyK? 7K>H0H(K?HyKK7XK>Ht k?4Hs0k?@pHwK>HHy7Hx017K>4v .7?/HHy7K?K?7hK>Hu0JK?H Hy7 K>]@4K>K? @O?k?ok? k?k?k?!6J4,k?1K>7D7# 44. :HJKH0Y%Z4. 78%B jH0 H ( 78:H "+~4:p49^4HH`4?"6x H @K K 4k? 44yK?1_H(Hk?K?1HvHH H(7(@HJ4 ?Gk?HvK?17K>K)4k? 44y_ K?1)HK4 ?k? 8H ,84k? 44y_K?1,RHH4 ?k? Hk?H44y_ K?1'ˀ`K>k?H44y_K?1(zˀK>k?H44yK?1_uK(ZˀK>k?H44yK?1_%J)*ˀxK>k?H44y_K?1+ˀ0K>k?H44y_K?1+ˀK>HH0K$KH@JHJ4K?1HvH=7 `K>ي 2HvKK?17 K>44_ 4 07HvK?17 K>H 04  zH jKH@@@HK344@Jy0ˀ HHHH$K?1HHvH7 K>"46R4 ^}7ˀpK>HKHW *HvK?17 K>k?K?14_4yK>HvK?17K>Hv HK?1HU7xK>Hv(HK?17@K>Hv0HK?17K>Hv8HK?17K>H KH@S@44@4;Hˀ`K>+~4:49^4 HH HvK@4Hk?4H04K?1u76@ˀK>ˀxK>k?K?144y@x48K>H @Hv@K?14447K>KK4K?1}7K>HvHK?1M7pK>k?H44yK?1_H0ˀHJ6M@4?HH4K?1HvP7K>ˀK>HvXK?1U7xK>HHv`K?1HYHX 70K>k?H44yK?1_H :k?H44yK?1_MK0ˀHHvhK?1KKK 57XK>HKK?1Hvp7K>k?H44yK?1HW_m@ :k?H44yK?1_-H70ˀzHvxK?157XK>k?H44yK?1_H70ˀHJ3K4?HK Jk?K?14_=4y ˀK>ˀK>HK(4K?1Hv4K7 K>HvK?17K>HvK?17K>k?H44yK?1HW_@pK>HK44yk?K_K?1 K>\5@4K>K?!K?K?K? @O?k?ok>k>k>k>k>k>J67Ek>K>%7$44H|k?(4k?h84Hvk?04K>H447&@H$@K!:K`!(4k? 44K>_ H&`@H JHHK>H H 7 ZˀK>YHk?K>HHH H( M7%HaH?4 >k?HgH K 4k? 44K>_ uH%*HHK>HH m7$@H|K4 ?Wk?HfH "jK"X4 HK>H 7$h@HK!4 I70 0k?K>4_ %4$ k?I744_ K>#I?( k?I8 k?I90(4k?K>HI9I8I7 7 bˀK>YI= k?K>HI9I8I7 =7#@H5 @>w HK> 7"@HvJ 4 = HK> 7K>YK>K>K>K>K>K>@O>KH@="44@4x! HH0K HxK( h8Kk?K>44_=59U@ˀK>YKH@BZHhI4K>HHw7uK>YˀeK>Y+~4: 49p^4juHhˀK>Yˀ K>YˀK>YˀK>YˀK>YˀK>YˀK>YˀK>YˀK>YˀK>Yk?ok? k?K>7#k?1Hk?!K@k?)!k?H4yK?!_5K?)!@K>04Hv0K?)K?17!ZH k?H4yK?!_K?)!"Hv8HK?)HH 7 H?k?H BK?!K?)4y@4 H?K?!HvPK?)7K>K?K? @O?ˀK>ˀK>ˀK>ˀK>ˀK>k?ok? k?6J7$k?!@Pk?)!H( @Hw 2H@HyK?)7!@H( RK BK?!K?)4_4!RH?K?!He H@K?!K?)4_4!H?K?!Hw K?!4@K?) @Hx( @Hy *HHHy K?)}7 z4K>K?K? @O?ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>k?ok? k?k?k?!k?)KFH7C7$k?1 6HyP444`HP  p@  @HKK?1HX7 HxP7uhwPHhzH7F@?-h`P4K>K?)K?!K?K?K? @O?ςK>ˀK>k?ok? k?k?k?!K77C 0@7% 0"+~4:49^4|HHHu@jHgX HJxH  XH H4z@H4 bHH"HC  2C_@ \ 4?u@H?%@Hv86h}84O 744\7  H|X hfX4K>K?!K?K?K? @O?k?ok? k?k?k?!7%7C "7"H :HHEH!@H"?@H :HHH!@HB?@!H4, H4.!z4. H!H!HH&!7?ā!!H` 2K K!K?@k?A7?9 k?IHb`4@k?9hf`H6?󶠇4?u 84 XK>ˀHK>ˀ8K>ˀ(K>ςK>HK4z_-4 K>HK84z_4 K>ˀK>ςK>HH _84 XK>ςHK>\@ˀK?9H H84K?90ˀJHz@@K 8ς4z4@4hK?9H H840K?90ˀJHKJ KH C_C8 rHH Z\@ B4H44@ 4H ?C_H84' @H84K?9HH_-4zK?9HHJK p@JK_4z BHHJeJ0404 (ˀ0ς H bH R4z_-@ 24H 4H?4zH84%rH84XK?9HH_4z(K?9HHJK 84 JK 84*JK_4z 4HHKJ 84 KJ=84*K J S84KJ_=4z 4K?9HHKJ 84u#KJ_4z 4XK?9HH4zH9_uK7 4"HH4zH_%H 4K?9HHJK JK_4z @HH4zK_}J BHHJK0404 4(ˀʐ0ςH bH R4z_@ 24H 4H?4zH84!"H84K?9HH_54zK?9HH_4zK?9HHKGKH[J704 BHH4zHHX_e@ 4K?9hw`K>K?!K?K?K? @O?k?ok? k?k?k?!k?)K$k?1KHHe0404&HH|0404&zH Ha u049045&BH(Hb(8484V& !H!rH!bIHCCB"%IH%@IH%I %H [%@%p@I[H%@IK?1^4HK?17^}4K?15_7%4H 4H>IH$H@$H( Hx(_K?1$H H HeH JK5$rJKV$ZJK$BJK_]K?1$4H 4H?gJH#@H#H "@H"Hc Hg"rHHCAC3a#r[u@#ZHH0404#"!@H!H!rHIC]C!"HIb"HI"H I "H(I("zH0I08484"B[5@"*HI_ K?1"@H0 @I0_ K?1!4H 4H>HH!H !4H 4cHg=HH!P@Hg!:4K>K?)K?!K?K?K? @O?ˀK>ˀK>ˀK>ًY I(H(:gIˀeK>ˀUK>ˀEK>ˀ5K>ˀ%K>ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>Ku6Ks6 k?k?ok?7$k?N7:K?77_u4d 4|K?YK?@O?Ku51Ks59 k?k?ok?7$ KCKa?4h 7Y_mKZ7 X@Ka?H7 : B4 4K?YK?@O?@x#047PQ4 7@4z4k?7#0k?47QP4 Ka?K?4:@[ 7K?Y@7?k?7#0k?44 k?Q7Ka?K?K?4:@[ u7K?Y@7?k?ok?k?k?7&76N\4744\ 7 fK?44 d e Nhxh|74?4|hypK?YK?K?K?@O?k?oK?h7# Xk?A4y @Hyp^ yK? h`h4?hwpHc` RHx04Hy^K? H |Hc`?Hx4K?Y@O?ˀK?YˀK?Yk?ok? k?k?k?!k?)7#K9 7k?1K>6 K>4Ȉ "@ Hz( @^yK?1%h`@Ha 4haPH|0Hb(h`H0hb0hzN,4h|h` 4?O4?"6 HeH &Hh$Ha0Hv8$  ^ K?1$@K?1A4y$Htx6(huxHfh @@ 4Hp ߘ7K?1A 4y$h@K?1^4$Bh`h4?hgp@$(@Hf $"N4ph| @!Hh% Hh Hy8 $ K?1A4y$@K?1^ 4#h`h4?hdpHbH@ $bK?1A4y"@H|0Hu8  ^K?1"Hsx6}?Ch}x :0449Q 4 Ka?4:@[]7ˀK>ـ @Hp'hdp4t[e4 @C4̂ 4 Hxh @Hp 4 7K?1A4y"@K?1^5!4?h}pHh4hyh hd8k?K?14y4k?@4" ˀK>ˀK>4 Z044YQ 4 Ka?4:@[U7ˀK>ˀK>ˀxK>ˀhK>ˀXK>ˀHK>ς8K>4^ N4(h| 44K 4h| \4hd(ˀK>ˀK>ـ r 04@[E4 4Hhe@4`[ 4 4hv@4h|H4K>K?)K?!K?K?K? @O?K?1] 4?4ˀK>4z4A 4K?1]4?G4ˀ=K>A 4zK?1]m7>4ˀK>4z4A 4>4ˀK>Hz8 D K?1^4>w4ˀmK>K?1^4>?4ˀ5K>K?1^4>4ˀK>Ku3Ks3 k?Ku5Ks5 k?_@/0$@k?ok>k>k>k>k>k>K>7#7k>4t4[K>k?!/@4tC B7k?![4t/k?!C?7@4HHz@ /4@4?.4_.4ʃ.4.4."046Q4 7_m4K?! (@@4@V%24%"Ȁ@K?!k?K>44y@7?!/7k?704K>]%4/rK?!C4v$*k?7K>4k?!4y@7?!/K?!C?k?4(8@K?!C4v#k?7K>4k?!7?!@`4y/K?!C?k?47?Yk?K?!7?!C 0k?!K>4y@4.7.HgK>^a4.7K?Y (H|(4cHxKCA@' [=4(HcHw?Hx@K?!C4z+z77k?!C4_+4Ҁ+4ʋ+Jk?K>47?!@ 4y+7K?!C]4X+\u@K>74^4x ˀK>Y7?Yk?K>7?!4y@ h4,X7,ZK>^!4,JK?Y 4K>YK>K>K>K>K>K>@O>_m47K?!Ka?H?7k?!(C  *K?!C4P 4Z(4 k?K>47?!@ 4y)7K>4]4>4ˀK>Yk?K>47?!@ h4y)7H}HgKB0`xHiI! H:C] 87ZCW@ [4 4?_5)4k?PI9PK3 PK4PJv0P k?K>4y4A<4=4ˀK>Yk?K>47?!@ 4y(7k?4 K>4yk?A4Y74k?!K>7?!@ 04y'@K>44^17K>^7'k?K>47]4;4ˀK>Yk?K>47?!@X4y'7k?K>4]4;4ˀK>Yk?K>47?!@4y&7k?4 K>4yk?A4:o4ˀeK>Yk?K>47?!@84y&7k?4K>4yk?A 494ˀK>YHvHuJ |94K>4^a4%K?Y =4k?K>47?!@4y%x7k?4K>4yk?A484ˀK>Yk?K>47?!@4y$7k?K>4]E48/4ˀ%K>Yk?K>47?!@4y$x7k?K>4] 474ˀK>Yk?K>47?!@p4y$7k?4K>4yk?A@474ˀK>YςK>Y_4ˀK>Y+4$7K?!K?!+4$_@7k?!C87?{4?" 6 _4ˀK>Y_4ˀK>Y_@0HK>]454ˀK>Y\ @K>7]%45G4ˀ=K>Yˀ-K>Y_4ˀ K>YˀK>YˀK>YˀK>YˀK>YˀK>YˀK>YK?!C4h8%k?K>47?!@`4y8k?ˀ=K>Yˀ-K>YˀK>Yˀ K>YˀK>YˀK>YςK>YˀK>YˀK>YςK>YˀK>YˀK>Yˀ}K>YˀmK>Yˀ]K>YˀMK>Y_4ˀ-K>YKu4Ks4 k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>iK= 6H7#h`Ka?H?7k>qH44(k>yAz4 ?4?*  HC4 P z4Z jk>k>HA5ҷ 6?U4?#Z 7X 4@7>*H@04z0* :K>@*K>ɀ@4zAX7> <H7 4 Bb">H4 P4 Z4 v4 4HI6)pB <>HB W( w8>M@ 05A)"5A?@5 C) 84HCi?HHK>q44y_4,07HC4 X,k?7K>q4 4y_4+7N4PHC4 v4 7 4 +5M7m( 5k N057k?K>q44y_4 +@HC?M5H5l ( 5E?  ^1K>q*k?k?K>q44y_4)7HC4Xp)k?7K>q4 4y_4)x7K>q]4܀X@C4+b7 K>q4y4A 47+K> *K>q7>4yAh4+ 0@K>q4^ 4044K=K>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>C4F;k?7K>q4 4y_4'7HC4v'zk?7K>q4 ]4ܞ%@C4 ꁿ#4 #4ʁ#!045P 4 K>y_7H44: [ 4xH7[4t4 x4 t#`7` g@, rAx4 H5g4| X8 #7?4@?@@I#  ZH '_U4 0@H ' 4  0hlk?H 4yA0K>q4ܛ 7? 7?1@4"H@K>K?1\":K>K?9" @] K>q7K>;M@K>q7>4yA4;@4_@m4K>q4yA7>ܛ=4_)@@_AK>y4\7RT6҄VH̟HHu4H]4HE4_K>yM4 <4<@4_AK>y44 K>q44yk?_54=74k?K>q44y_4K>q]}7ܘ@k?K>q44y_4K>q]7ܘU@k?K>q44y_54K>q44]E7ܗ@k?K>q44y_4K>q]m7ܗ@k?K>q44y_u4K>q]}7ܗ=@4_ K>y44}4_ K>y]4M4_ qK>y-44_ AK>y4444k? K>q4 @4]5ܕ@7>k?K>q4y4@H4ܕ@K>q@ 4ܕ@K>q@4ܕe@K>q@4ܕ=@04k?K>q7>k?4y4@4ܔ@_ K>yM4k?K>q44y_ 4K>q7]4ܔ]@_ K>y444k?ok?k?KD7%4P@ 07C 4_ 94z 4 s4_ 4z H4XC 7 }4_4z H4RCU Z7 v4K?YK?K?@O?_ q4ˀK?Y_ Q4ˀK?Yk?ok>k>k>k>k>k>k>k>J67k>64k>_7?A$K>KK?A 84} KK?I K84I?C4zH B #K>457k?_ EK>ك#x7I?C4 vt 7 'I<k>7?_Y5:I?C #77 *7?_5:I?C7"7 9K? K?  !:0K>59_40 *59P4._5Z"p@K?@0 "595Z_m40"R :0449PP4 7_4z!R"0""  B*0BB0"Z r4#" ZcB4#b# K>4] 4K>Y0pЀ_7J 5 *4h#ן#?#҈_4zˀK>YˀK>YˀK>Y_Q4zˀK>Y_14zˀK>YK>4]4pK>YK>4]4@K>Y]AK> K>YK>]94K>YK>]4K>Y z04yZ4 0@K>4]4hK>Y4yZ]4 0K>4]y4K>YK>4]I4K>YK>4]4K>YK>ѕ]4K>YK>4]4XK>YK>4]4(K>YK>є]Y4K>YK>K>K>K>K>K>K>K>@O>K>4]4K>YK>4]4UK>YK>4]4%K>YK>K>A7?A Z#047P4 7_4zK>4]4K>74] 5eK>Yk?ok? k?K%47#k?!@ 4 Ԁ44 C4Ƌ 7 b4^4zHC4v `@^4ˀ K>^44K>K?K? @O?7 v4^=4zHC4v @^=4ˀuK>7 |4^4zHC7 0v a @]IK?!K>K?!ә]Y4K>k?ok?7$H4k?4^k?HC4v 74^4HCW4v p7f ` `0 j]K?K?YK?@O?^eK?ˀK?Y^EK?ˀK?Y]K?K?Yk?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?aK$4 Z7#k?q@7 R4t *He4 b@F?@Hj5K kM4P7M4PHzC_47!4 4v!z4 X?!j4 tCSs 7M5A?5^U M5 t74^4zHC!75N7P x4 4M,574M 57 , Hz5C_ 8 >CS  K?q H74C0v g]4K>K?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?^E4ˀuK>k?oK>k?6k?!4k?1k?)^k?k?9K?7?QK?!@K?1!7?ak?K?7?YK?!@K?1!rK>k?7?ik?K?K?!K?)@K?1!"7?qk?7?yK?k?K?!4w@K?1 @K?a :K?Q *K?i K?q K?y K?Qk?K?ik?K?qk?K?yk?K?K?K?9]K?YK>@O?ˀK>K?YK?K?]K?9K>k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>4 B6K7k?@i"k? 4 4^}4HC4X7"7 4M 7!4 4 b4 d!04 v4`HB_"B"@H45P `4 7^=44H7 4^M4HC7"zk?7K?4 K? _i4"P7k?K?68]5 " HC"5)7&}  4 hK>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>ςuK>Y^4ˀUK>YH46} C띟4 נj=4H45@P4 7^4HU4MH=H^4ˀUK>YˀEK>Yˀ5K>Yˀ%K>Yk?ok>k>k>k>k>k>k>k>k>k>k>k>K>674v4 K4k>4Pk>M lk?HA 74 H4 4 t4 \5̀"4 M 47A ?(! AY H7]  K>K>@4!JHA?=54 gK>YK>K>K>K>K>K>K>K>K>K>K>K>@O>5Z4t 7Bx?7 k? K>4k?@XK>>HˀK>YˀK>Y^ ]K?ˀK>Yk?ok? k?k?46K7k?!@ k?)^ 4ˀPK>k?44_ @F44_ 2Yˀ4̀ 4Ā #047PP4 7^ 4H Z0C4F4t @^ 4ˀ@K>HC 04]K?! P7"046P4 7^ 4 :0490#Z04J7Z@HܞCk?7K?!4 K?)_ 4k?1H4XC5 @^ ]4ˀK>7 4^4HC4vt 7^ 4ˀpK>k?74K?! K?14]Ak? |04K>K?K?K? @O?k?ok? k?k?k?!K7&7k?16^4k?944^ @ (Ƞ7 wB4dZ B4` :Hbx4Hb`4ȠPHb#047Ot4 7^M4Hb44G gk?K?144_ 4w @74K>K?!K?K?K? @O?HC4t 7 zZ4v 7^4ˀeK>k?Hz^ G4 K?17K?9]4K>|44K>:4Xw ^ 4ˀK>7 v4^4zk?AH4XC= @^4ˀ-K>7 u4^%4zHC4v @^%4ˀK>K?A7  a04k?K?14k?K?9]YK?AK>ς5K>k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=K=4v6k> Jk>C]k>1k>Ak>Ik>)k>!'8k>" 6 Hk>94tZ!@&7@4t&HzCU4ވ5 *CV4V C\4H!J^ F4ȼ x!5 4Hs6z zZA4v'(7K> k>5Y]a4&< 04 K>7?Q]5Y04 Hz^ M5 A4 b&70` 4 74 f@4\ (0*4@4 \ ?44\%Hz^ F4 7M4P474 4k?K> 44w_K>%(7H}C4t=Hs^EK>ˀ8K=Y"046 O4 K>^u7HC4~7 44\W&J4TW& 7 x4^I4zHC%"7 Cӑ(%@5%`47 u7 yZ 475z_444%X44 K=K>@xK>%7K>]!5Y%k?K>17?I5k?K>4k?K>k?k?y@k?q$7ˀK=YK>5X] 5 \ 4@%HyC? 5i:@ I  H7CK>)6 wK>AѠ2K>A5k>A M0K>Ik>IK>45X]K>IK>)k>) |HzCRD84tK>IK>) 4K>IK>!@ K>I (K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=^aK>ˀ]K=YˀMK=Y^1K>ˀ-K=Y4 7 CӳK>96w?4?W 447 |7⚝ b7š a7 oše4]H^1K>ˀ-K=Yk?K>44w^=K>HC4t:7@p@^K>ˀK=Y"0K>^6p 47 v44 :@k?I5+ˀ"4 Mp47k?K?I;k?k?K>5X5]k? G ˀK=Y^iK>ˀeK=YˀUK=YKu4aKs4i k?k?ok>k>k>k>k>k>k>k>k>k>K> 6k>@04 k>K>k>K=k> K>@04  Ka?H?$@ \ 4  @@)04  R@ 04  2!054^404  @5'(4 "4zZ 404@04J@0H4 0\4@(04B Z04Y4^404_ : k?!Z07?Q5Y55[5:4 Z5:  Z4@4 "@6@w4""@4H_ 4\!4I 4z"7ZQ4M 74y4ZI75ZZA45Z_}59 5Z_]45Z_E4 @ HK>7?1@ K>#7ˀ K>Y 4 K>K=+` 4, 4-`04,04- !Z07?Q5Y55[y5:]@M5z7] @^@@Z)4|K>YK>K>K>K>K>K>K>K>K>K>@O>5ZZ4y5Zk?M4K>7K>\K>%K>YK?1k?K>K>\K>K>Yk?ok? k?k?k?!k?)k?1K>4v7 K>6 Kk?A@% k?I4 iHC4!7 C4zw 4V 4Z 7 bHC4J!r7 i7?q_4z!RK?qI_ *K?yI< 4  iK?A44wk?^-K?IHC 2 "7C ?7 7 4K>K?1K?)K?!K?K?K? @O?ςK>ςK>ˀK>^ 4ˀuK>k?ok>k>k>k>k>k>K76k>7?Ik>7?Q_qk?I!P@K?Q!K?Y!HB4z?!b"0K>\u6 0 07K>4\4 7K?I 0C Ka?H?CZ!84 07 Ka?H?!B \׀4K>YK>K>K>K>K>K>@O>k?K>44^ K>HC74v>7^ )4ˀEK>Y^@ 2HC4Z 7 44^y4HC4v>U7^ y4ˀK>Y^!@ 2HC4Z 7 44^4HC4v 7^4ˀK>Yk?7K>4 K>^ 4 7ˀK>Yk? 4k?K>4\ U5%K>Yk?ok?k?k?7C7%7M`40H`7HwXHzk k(Hy78 hxHzh|`Mh|Xh|H `K?YK?K?K?@O?K_X @K\PKkYXKWK  k(K_X @K\P@Kk?ok? k?7KX7k?!7CKZ MPhh|Hd` H HY-K?! H?@ `@HyHz75? U H(4K>K?K? @O?"046 @Ox4 K?!^Q7H}Hs7? | e @k?ok? k?k?k?!k?)K>7#76 0K>Hh Hw@ HxH M4(744(Z7Hy 4   i hhK>K?)K?!K?K?K? @O?k?44\4K>k?ok? k?K$7# hk?!H k?K?!HH\1H ZHZ4?4h`4K>K?K? @O?ˀK>k?ok?k?K$`xK#KXb@#047 O04 Ka?4:@7Y 4xˀ`K?Y"z046y pO4 Ka?4:@7Y 44K?YK?K?@O?KW4 e`` H 2Ld4 47Z 44c?ሣ_HH 2L4 47Z Y4H6 k?7K7 k?K`27:_7 87ˀK?Y@@K?Y@7?K<?@K?\4K?Yk?o7:6_7 04K?Y@O?k?ok? k?7`hk?!4?D@R7# d 4?4?# 7 (  :0449 Ox4 Ka?4:@7Y -44K>K?K? @O?"0K?!46 0\14K?!#0K?!47 P\4HK?!K?!4\4 04 ` Z0K?!44E p\y4K?!#0K?!7 4\94K?! :0K?!44% \4PK?!"0K?!6 4\4K?!"0K?!6 4\y4K?!K?!4\I4"0K?!6 4\4pK?!"z0K?!\6e @@K?!#0K?!7 P\4K?!#Z07E `K?!\4K?!#:07% pK?!\4K?!#0K?!47 \4XK?!#0K?!7 \i4 K?!"0K?!6 \4K?!#0K?!7 \4K?!"0ˀ6 K?!4\4 0X4 Z0K?!4E \q4(K?! :0K?!4% @\94K?!#0K?!7 `\4K?!"0K?!6 \4K?!"0K?!6 \4HK?!"0K?!6 \4 K?!"0K?!46 \y4K?!"0K?!46 \94K?!"z0K?!46e \4PK?!#0K?!47 \4K?!#Z07E 0K?!4\y4K?!"z0K?!6e P4\94K?!#0K?!7 \4XK?!#:07% K?!4\4K?!Zy@K?!4\7d  \k?ok? k?7#6k?!]U7K?!74\ 7 7Z44He!bHC_@ YE4 H?@4(L<@744(Y7Ht 44 K> K?!\ h heH 4K>K?K? @O?HK>0 Z4H ?}@4(k?7#0k?47 O4 Ka?K?4:@Ya7K?Y@7?k?ok?k?Ka?H?7CKTB4 4$ < zHvB6 S wH s 75?B p  Ӝ?Hv4K?YK?K?@O?]u@-@]U@k?ok?k?k?Ka?H?7CKUB7$!* <!2ˀK?Y]@ Ka?HHeH?@4 X@  73?! }  Ӝ?@@40 b0 4K?YK?K?K?@O?]@>@Hf@6? He4Ka? tH?>}B u]@Ka?H?k?77_k>4k?qk>4k>k>k?k?ak?iL tk?yk?7?a7>@k? :K>Bt j7?a@7> H@K? @Y@K>4@7?Y}K?k?K?q B#047 O@4 Ka?4:@Y7K>K?yK>K?q@7?Ku6Ks6 k?Ku61Ks69 k?k?ok? k?7#4k?!K:Yq47 7C?7@!z7E?#07@_47?Hu 4% h@Ka?H?! @ <! @@4!4 Ht X@Ka?H?!@ Ӝ @4X @@!@K?!4y@4`K>_Hzˀ@K>]@>@4 z4K>K?K? @O?]-@@@D 4@d?4#:079P_4 7C @_mHzˀ-K>K?!@04yK>_%HzˀK>k?oK#7k?`? Z04Y`4^ !4z j@4H 4\ B4a k?K?4@7? ˀK>@w4 x@@z_ b@x4ފ J@y4 24|k?K?4@\7? 4K>@O?ˀK>k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?YK.7#7Dk?aA4 4 !4 44444 4 "r#"!?#Z_#6?B444@4y"4 ˀ(K>44@x4y05"@Hz 4@5"z4 4 444@4y"4 HnA>@ *444@4y"4K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?44@4y H} 4@5 ɀ4 44@4y05!(@Hy 4@5 ɀ 4 ˀK>5 x05>Hn45 w05ˀ-K>5 s444@`4y4 ?]4 ˀK>ˀK>_}K?aˀK>ˀK>ˀ}K>k?ok>k>k>k>k>k>k>k>k>k>k>k>k>K#47$@7E$@77?B@u 5?4k H5M 4 #85(?4 4 5 HC 7 HC== Q44@p4%"k?YK?QHH7_ K?QK?QY %7 "*ˀPK>Y_ 4HY7z!ʀ 4H\57 4 H]5I 75\H$7H\)6 7Y5 @  ?5@6 Y 5  JH] 5H7\y77Y ]5 J 4k?HHH_5"7H  <5? 4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ka?H?@z4*!4h <! @v4` @Z5I_@z 7 Ӝ :I_5 A Ҝ?5A 5 _ 54zˀUK>Y] =@>@v_4zˀK>Y] @@] @-I__4zˀK>YˀK>Y_e4zˀK>YˀuK>YˀeK>Yk?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK#4n7$k>7:k>_.(k? Y HK? H  7? _4(K? #(4!z Ka?5g @4&44 4 \4 HA&z5 K>4@4"rˀK=ـ" HC0 7 HH)x@:  JH7S H)PBz |?HHCO 7 H)B Ѽ JH7= H(C ќ?HHCn 7 H(B \ H7 H(CZ <?HXK? B7?a_4(@@HK?a  K? 4@K>#Hr]4z 0744pH 77Y544H47Y4'j4_ 54'J4!4 \ 4@4|Jah5Y?C] *CA 8CF? 77ZC] *C\ 8CE? 77ZC] *CV 8CC?x 77ZC] *CU 8CB?X 79^7Z79 C] *CH 8CI?8 7?7ZK>]!4Y44K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>K>4@ 44 4444!4A? Z7?{4? 44  @?7?{!@HC2 7 HH!`@Z :K? H7 H!0B Ҝ?HK? _Y4zˀK=_94zˀK=ˀK=B4  B4Y@Y@BU4BE4B54B%4]@@]@ǀ bHC1 7 _49/K? _4zˀMK=ق6@_A4 0@_4zˀK=]@}@]y@@]Y@@]9@ @]@M@]@u@_4zˀ K=_4z @YY4ˀK=k?ok? k?7K87#k?!_7:HzX7 @_K?!ˀHK>ِ H Hw  y4K>K?K? @O?k?ok>k>k>k>k>k>k>k>k>K)4 7#k>77Fk?Y 6L 4P  k?aH4C(0z4ʁ!j4 4 7?Y4  7("7 vX"k?q7?y_4z""K?yH(*K?q6a?` k?qk?K?y 7?H W7?a4k?@84!K?q7??k?qHC(0 >@ HK?a Hl4 A *4 Hx7 y4K>YK>K>K>K>K>K>K>K>K>@O>7?q_4z=7?y_K>ˀeK>Y_K>ˀEK>Y_K>ˀ%K>YˀK>Yk?7?a44y@ 4>HˀK>Yk?ok? k?k?707?k?!K%7&64@HK?!!@HK?!@4  K? K>Hz7XK*6HL HHv K?tH|7 a4K>K?K?K? @O?ˀK>ˀK>k?ok>k>k>k>k>k>K&# 7 @Ҷ6?`4? 7%7D74 @? 44 @Ka?4)HI?'B <'HB6 X C?  7\?  ?oHHC4 '27 44_4x'$R#0H[%7 0 @H4[54k?H47k?[uHy |7?97?A4_54&HC4&7 44_4x&#(@HHyK?9[K?A |7?i7?q4_e4&HC4&7 44_%4x&"ZHK?a[=Hx( |A44%Ґ`07?a4_4%HC4#7 k?aHKa?@Sk?ig04k?qH5 H?$B \>H_q4HXe7jH  `> 4k?H5_ IH>k?aˀxK>Y4 44_4x"j @H[]Hy |4K>YK>K>K>K>K>K>@O>4 7?)_a4"JK?)H(RH  7?1k?14_4x?'4ˀK>Y4 44_4x!`>4H[Hy |4 7 HC4":7`;U U44 44_4x"ʀ`=4H[-Hy |ˀK>YˀK>Y] @8oH_ i4ˀuK>Y_ I4ˀUK>YˀEK>Y_ 4ˀ%K>Y_ 4ˀK>Y4`9 4ˀK>Y_ 4ˀK>YˀK>Y] @U@_ Q4ˀ]K>YˀMK>Y_ !4ˀ-K>Y_ 4ˀ K>YˀK>Y_ 4ˀK>YˀK>YK?qk?HyK?a[K?i} |4 44_4x;G4ˀ=K>Yˀ-K>Y44_4x:4ˀK>Y44@ 4x:4ˀK>Yk?ok? k?k?k?!k?)7'7DK:k?17444444444HBt!!b!r!6s 6 Ka?H?)XA )Z7?q4_ 4)R'@K?qH\e Sk?9H[ 7 |YK?9Hu'"k?K?qHH _IH& |ˀ@K>6u8 6t 6v Ԣ4>@HB4? Z 4A < _K?1  J Z0H4Y @[ e@  |[AH |H7  p@+ 49 049P[ H ( |H5[4 |H6  p@+ 49p049[ 5H ( |H5[A4 |H6X  p@+ 49049[ H ( |H5[4 |H6  p@+ 49049 [ H ( |H5[4 |H6y  J :0H[ u49 |H[)4 |H7   H+(49@+ 49`049[@ | "H5[4 |H7W  R#0H[=7 ( |H4[I4 |H7?`  J"0H[6 p |H[14 |H7  J"0H[E6 ` |H[4 |H6p  J"0H[6 P |H[A4 |H7  R H[Hy | @H[Hy |4K>K?)K?!K?K?K? @O?` 44_4 `?4XK?4k?H7H^%K? |X-K?H|>@ˀK>\5@67?q^K?1ˀK>ˀK>ˀK>^K?1ˀ}K>k?ok?k?KW(7C7%K_0077h0Hz K h| Hy Hs( 3 4EHx H}(  Hu(6hv(K?YK?K?@O?k?77?7] p7k?CKa?"{k?K4:@6yPKJX @K?YKKa?"J4:@X6K?Y@7?k?7#k?47NP4 K?4_7K?Y@7?k?ok?7$k?K 7:K?77\ 4d 4|K?YK?@O?k?7@4K?Y@7?k?ok?7CK:HuUrC_47Z@:4@ 4@#7D?$4` ςH_4zˀ0K?Y4 4K?YK?@O?H}7? _ 4?]_U4zˀK?Y!P6?]Ks 7?K!@"S K!4"_"HaR@ Kւ 7?K3B| K$45Kׁ K=C K#4t4K K$@ K"4S3Kֶ K#@t K!4=Y~=4 ςK?Y#47M4 74z_4ˀ-K?Yk?7@k?K?Y@7?k?ok?K=7CKZhK?C47:`x=Ht!7?$4_4z4K?YK?@O?4Z P@C7=Ht \_]4zˀK?Y4?@CC7u 6Ht˶} S "46M\4 74z_4ˀK?Y4K3 z 5 ςK?Yk?ok>k>k>k>k>k>k>k>k>K"7?7%k>7C7444  4 !{4z_4#HsJ# K?yKЃ @K?@"RZ7ZTbK0 47?aH7?i4z_4!K?i H@RU6ҵaK?a u7?aHB`6 >w7?y7>J45ypMd4 74z_57?aRV6a4?H?HT?  \m4G4?!H? 4K>YK>K>K>K>K>K>K>K>K>@O> 440M4 74z_}5ˀUK>YˀEK>Y 44M4 74z_5ˀK>Y 440M\4 74z_5ˀK>Y 44M4 74z_e5ˀ=K>Y!45 M4 K>7_ 4zˀK>Yk?ok? k?k?4x7k?!7C4}X !rHsk?)4@ 444?#07_ @K?)4Z4 [4Y 7 @K?)[4܀K?!4?_4zK?)Zu774|X @ ZK?)474vX f4K>K?K?K? @O?+4:49Z4=4|X ;449`M4 K?!7_e4zE4ZK?)#;ܞ=79K?)4Z4#ܞ7K?)4Z4"ܝ6K?)4Z]4#ܝ7K?)4Z%4 [ܝ]4YK?)4Z4 ;ܝ%49@K?)4Z47#7`K?)4Zu4"ܜ6K?)4Z=4"ܜu6K?)Zm4"ܜE6K?)Z=4"{ܜ6yK?)Z 4#ܛ7 K?)Z4 #[ܛ7Y K?!4&_4zk?1K?!4z_e4 4?k?4K?1k?K?)4ZM7#;ܛ 79 PK?)4Z4#ܚ7 pK?)4Ze4"ܚ6 K?)4Z-4#ܚe7 K?)4Z4 ;ܚ-49 K?)4Z47#7 K?)4Z}4"ܙ6 K?)4ZE4"ܙ}6 K?)4Z 4"ܙE6 @K?)4Z4"{ܙ 6y ` [44Y MT4 K?!7_ 4z4+4:49 Z4*E4vXk?ok?k?k?KFH7C7$ـ704@ Fğ@HzPK(&h|PHzH F4 XHsHHPצ3  ? 7 hfH rHtP H JK4 4HzZEH 8 4K?YK?K?K?@O?ˀK?Yk?ok? K777Dk?_ 7?0ˀJK?4RK?_4 |04K>K? @O?7>k?4_ 4 ˀK>K?HP4m }k?ok:k:k:k:k:k:k:k:  7>qk;I7;Y7j?4xj?!j?)j?1j?9K;Ij?Aj?Ij?Qj?Yj?aj?ij?qj?yj?j?j?j?j?j?j?j?j?j?j?j?j j(j0j8j@jHjPjXj`jhjpjxjjjjjjjjjjjjjjj6k=Yk;1k;9k;Ak;Qk=ak=ik=qk=yk=k?ik?q k?"6#4444 4 4 4wk?@ "6k?B?  _@"* B?!_!ڋ!27;1@7? *ˀK:Y7;1@7?!rK?/4wK;Q7;Y!ςXK:Y"46 MT4 7;17_4y4K:YK:K:K:K:K:K:K:K:@O:"46 M4 7;17_ 4yˀ]K:Y7;1@7?>K?ˀ%K:YˀK:Y7;1@p7?>_K?ˀK:Y7;1@7?>'K?ˀK:Y [44Y M4 47;1_7ˀMK:Yk?ok> k>k>k>!k>)k>1K)587(A&87C_m7>(P47>7>4z_]5(4)4? „̊""Ȃ4?7>7?4z_5(K? ?7>K>_K>'7HzZa4$ˀK=Hu( RK>_K>(7HzZy4(4h|(7?)7?94z_5(R7?I4z_5(*7?Qk?7?17?A4z_5'4 ?7?a4z5_I7?Q'@K?Q@#J"?7?a8H 7? 4z_5&"7?4z_5%7?4z_ 5%@K>&@HzZIK?%h4 !JĂR" 'rK>_9K>$7HzZ14$@Hz84 ha(X@h`8HzP h`0X@h`PH8!xh`HKhiHKIh|PHw87HxHJ\H 7>4z_5#7>4z_i5#7>4z_5#h@K>44z_ 59!X7ˀpK= [Hz4Y `ZA@"4h}(H 4t(j 44 M4 47_A4zˀK=7>k>4_4z"BK>HwP%Hz[5 @Hz[a57K>_K>!7K>k?45HzZ!4>H ˀK=k?4_4z"ZK?HPEHz[5 @Hz[Q57K>_K>!7K?k?44HzZ5=}@ˀK=ˀK=ˀxK=ˀhK=ˀXK=ˀHK=ˀ8K=ˀ(K=ˀK=׀4K=K>1K>)K>!K>K>K> @O>ˀK=#;K>\ 79  ̂UH K?47>4z_59>7ˀ%K=ˀK=ˀK=ˀK=ˀK=ˀK=ˀK=7?i4z_5 7?q4z_5 Z7?y4z_i5 27?7?4z_5:H ˀK="46 M4 74z_)59ˀK=0 Hs 0 gHu 4Ht Ha 4" 5hb k?ok?KW 7_(7C7$6?hw J4 "Z#j !R!!rK4h|@Ha0Hz0 Kp Hb@ \H|0Hz@  KZ\AHy8K4h|8HHH}HJ]Hw8H}8HdHK[HyPHs846zX 484"6?Jj!?6?4K?YK?@O?7?4z_4! @Hy K4?4K?HzZ6?g4ˀ]K?Y7?4z_i4 K?HzZA6>4ˀK?Y"46 M4 H7_14zˀK?YˀK?Yˀ}K?YHzZJ>O4ˀEK?Y7?4z_Q4>4ˀK?Yk?ok? K77$7Ck?_A7?y 7?7?4z_94 bK?y4@r"46 MH4 K?7_4z׀4K>K? @O?7?k?yHd004@ D@ Hz8Jd h|8H}0  s  4 X  hd0K?yHz8 K? T4K?yHy8 s K?9 5k?ok< k<k<kk<4_4z7HC4D77 7<4z_ 48 K<4@7?kI4_e4z:K>IHwP K>QJ J0k>Q5p"5k J57k?K>1k?_ yK>9K>QK17>94z_49K>A97>I4z_ a49r7>Q4z_ 949H@K>I /7>4z_5YK>Q k>Qܞe4,"5) J 57k?K=y_ K=K=k?7K5lˀ0K;ق67=4z_ !46K=р 5MJ5J 5J4575:J57K=_K= 6 <K= , 5k?7=7=4z_ 4>K=ˀK;7=4z_43P@Jt4P744PX74 4 7=Qk?7=A7=I4z_ 42K=Q`25,5*"5J Jl57K=A_QK=I <?Ok?ˀK;7>q4z_45J7>y4z_45"7>4z_I447>k?7>7>4z_ i44@K>?k?KyZ Ky4KyK>yK4z^=4-7> 4z^4,@K>X04K> ZK4z^4,7>4z^m4,H7>7>4z^m4,K> ,K>ɑ04K%K<7>4z^4,z7>4z_!4,RK>,,JK>Z9K4z_4+ 7>4z^4*k?4z5Y_4 K>k?47K>Z K4z^4'@J<4P4 74  7>A7<4z_4'K<47>7>4z^-4(K<0ƴ4ZiKKˀ K;ˀK;#;479 Ll4 74z^ 5yˀK;K>ZKk>k>k>K'7$7C^}7?%27?!4z_4% H7?)4z^%4$K?!k?i"{6z 0k?a(Hf7?94z^ 41R7?A4z^ 41*7?yk?4z47?a^7?i0K?)4| K?940K?A 44H@_ :1"7?I4z@4 :ˀXK>Y4z47?a@|7?i1K?A4Y4@7?k?Hf0߀ @Hv8  !K?)4|#J߀04߀@ F@ Hz8J h|8Hu0 !   4WM hf0K?Hf8  # @7 0YK?Hg8 9 K?! G  Hk?aHk?i HfK?! ZY4 K?) " 0 7?dRJ4 K?!44YMHk?! K?)7?`4?#;78 4z4@7?I%ˀK>YˀK>YˀK>YK?) *7?94z^4K>Y 44 L 44 74z^4ˀ8K>Y 44 @L 4 74z^=4ˀK>Y ;449 L 4 74z^4ˀK>Y7?94z^40ˀJK?a^K?iK?! 7Y4k?!4 h K?9k?K?!44yY 4K>Y7?94z^40ˀrK?a^K?iK?! 7Y 4k?!4 h Hz@K?9k?K?!44Y 4 K>Y7?94z@$40ˀK?a^5K?iK?! 7Y%4k?!H 4w( K?   "4h (K?!4h K?!0 4K?9k?4Y m4K>Y4 h ςXK>Y4 h ς0K>Y7?94z^]4 R7?A4z^54 *4z47?I^=7?y0ˀK?y:w4z7?Q4z4^7?y:?4zˀHK>YK?9K?IY54K>Y7?94z@t40ˀK?a^K?iK?! 7Y u4k?!4 h K?9k?K?!44yY-4@K>Y7?94z^m404K>YK>K>K>K>@O>7?94z^4 *7?A7?y4z^4 ˀmK>YK?a^K?iK?! 7Y 4k?!4 h K?9k?K?!44yY4 K>Y [44Y Ld4 74z^4ςmK>Yk?I47?9k?Q4z4^uk?Y R7?A4z^M4 *7?I4z4^U7?y ˀK>YK?y 7?Q4z4^7?y ˀmK>YK?y :7?Y4z4^7?y ˀK>Y#47 L4 74z^4ςK>Y7?94z^4 *4z47?A^7?y ˀ]K>YK?y 4z47?A^7?y ˀ K>YK?y J7?yk?7?a7?i4z^m4 ˀK>YHC4Ĉ 27?I4z@4 ˀUK>YςEK>Yk?A7?94z^a4 R7?A7?y4z^i4 "7?I4z@<4 ˀK>YK?a^AK?i7YE4K?Ik?47K?A 44Y4wK>YˀK>YK?y R"46L4 74z^4ˀK>YK?A4z@x4mK>Y"46PL4 H7^i4zˀK>YˀK>Yk?ok? k?K?77$k?!7C@ $7?I"(@K?I4 p4?4?"Z4_"4!"4!4z@4 ˀK>7?i7?4z@ ,4"7?q7?4z@ 4!7?y7?4z@ 4!7?4z@ 4!4K>K?K? @O?7?Q4z@ |4!"HHu4C4?w47?Y7?a4z@ 4??4ˀ5K>ˀ%K>#47pL4 K?!7^a4zˀK>4z@x4>4ˀK>ˀK>ˀuK>4z@<4>G4ˀ=K>k?ok;k;k;k;k;k;k;k;k;k;k;k;k;k;k;K<77Ck<7<@4k<4zK<7<7<@ 4z4ZHd@4X4?HK7 01bK>k?5K< YH71zK>Yr&1_K<7?17?A@4z2@K<7?Q@4z2h@K<7?97?I@4z20@K<7?Y@4z2@K?I15?4k<K<7=@(4z,4 K<7=7=@4z,@K<7=7=@4z,p@K=K=^ 5?K=? 487H|0Hp8 1 P JK=ي J[K=Ƀ 6(0@0eJYK< IK< Y7'7-*k?K< 568k?Y57-:K<)5.ՠ2K<)6k<) I47   .K<7>Y@4z,@K<7>q7>@04z,p@K<7>y7>@4z,8@K=9L 5?k>aK<7?@4z-K?ǿ@K<7? 7?@X4z-@K<7?@X4z-ZK<7>a@(4z+J5?K<7>i@4z+*K>YmD 5?Ha0Hm8 P@IK> I[IK>y 5(͟@͘@K<4^4zK< 44Y97ɼe@ǟ K<7?!7?)@4z+ʭ4_?K>yK>P 4 4^@K>YK=9ǡ7*k?K< 55Yk?ɼX@Hk?K>a55k?K< k?Yk?7*rK<9 P4IK> I[K>q 5?5(K<1BKq4 K>   i II 73*7i IID II ] I6"iI B `/7=90`4K<9I 746I 9^  (K< Yq7h )h \55)(h V%K<9k?Hk?Y K< KK?K?K? @O?"46`Kl4 K?!7]4zˀK>ˀuK>ˀeK>ˀUK>ˀEK>"46K4 K?!7]54zˀK>ˀK>"{46yKl4 K?!7]4zˀK>ˀuK>k?ok>k>k>k>k>k>k>K%7$7Ck>@`7?$ K? *7?!7?14z@4#7?)7?94z@4#K?"444f04 4H6?Bz H Y I8"*I?K?9"I:[K?)!K?4!#I7 !⁘@H #@HzYH#X@K#47YyHz#P7K?)K?9[5 @V5K?9# 4 ?u44![5YK4 K>7]u4zˀK>Y=4Hg@=Hp@I7 04 5?}5J?فa4w4 4He@!HK?!C]C5 B[K?1 (@VqHK?1<=@H?}@m4ˀxK>YˀhK>YˀXK>Y#47@KD4 K>7]4z4K>YK>K>K>K>K>K>K>@O> >%@@XI$"K>6] 4zˀMK>Yˀ=K>YH  <4HzYH R!;459K4 K>7] E4zˀK>YHzYHHzX7 04EK>Yk?ok? K#47$k?@w k?"46@K4 K?7] =4y4K>K? @O? K?7?] 4 ˀK>4 CW "g Y6}?7"46@K4 K?7] E4yˀ K>K?K?]4K>k?ok? K#47$k?!@wk?!Pk?4 CW "h Y6}#!b7 K?7?] =4!@K?7?] 4!P@K?7?] 4! @K?!K?4!K?K?4]K?!K>K? @O?#47pK4 K?7] 4yˀK> 44pK\4 K?7]4yˀ=K>ˀ-K> [44YK 4 K?7]U4yˀK>k?oV=7#  `p 4c@4c?K?Y4|@O?k?oV7#  `p$4c?@4cK?Y4|@O? 4@ k?ok?K77$ 07CI4   dH4 K?YK?@O?K BK7 K:0? _K=@4k?ok?KV7C4JUx7$I4HK H}K|H} |HyK?74  DHx4K4#kK?YK?@O?k?ok?KW47DJ7#7j6 4u 4HH\4ԃ@HH44K7k  hy_47 4?M@0K?Yy_e4 4K?YK?@O?k?ok? k?k?47%8H7C4 7?`??4?7?ЁjHwJ4ԃ7j6 44 ZHxK@6k7 W 4?44K>K?K?K? @O?HwJ4ԃ*7j6 ς%4z_=4eK> {44yK4 Ka?4$@7Ue44y4UE44y U-4ˀK>4_}4z>-@ˀK>@_E4z>M@ˀ]K>k?ok?k?k?7C7&U%7:47HwJ4ԃ7j6  ςHwJ4ԃZ7j6? 444z_-4"*@ b4HxKj6k7 4 ?44K?YK?K?K?@O?4žןHwJ4ԃ䠲7j6 44HwJ䠒7j6_ ςe4z_u4>u@ˀK?Y4_=4z?gHw"4z_ 4> @ˀK?Y4_4z=4zˀMK?Y ;4490K<4 Ka?4:@7U4ˀK?Y_=4z= ˀK?Yk?7"k?k?6_ k?7 4 "K?_uK? 4(@K?_=K? 4K?Y@7?k?7"k?k?6#_5k?7 4 "K?_K? 4@K?_e4 4`@K?_-4 4(@K?_K? 4K?Y@7?k?ok? k?k?k?!7C7'76Ip4P744PV7 @H  K> 4`HHy hdK>K?!K?K?K? @O?k?7@P4K?Y@7?k?7@4K?Y@7?k?ok?k?KD7C#7%"H "@H\2HbP!4yP_4z#2HwJ4ԃ7j6  4 34HwJ4ԃ7j6 _ 4 44_4z"`@Hy(_4z":04yPHe0!4y0_4z"2HwJ4ԃ7j6 44HwJ4ԃ7j6 ? 4 U44_4z!b#7 0_4z!:4y04 _4z!ZHH4Vh4K?YK?K?@O?+4:049PX 4"04_4z=_Hw"4_4z=4ȠE44_u4z>/HwȠ 44_=4z?@=4Ƞ4k?ok?k?k?7!6'8 E7EH` 2H HwHc`?@I4744Vq7 f dH 0@K7K?@  4K?YK?K?K?@O?Hs 昀 f dH?4KHw4HzKW wHzVKD?% dHHHz4k?ok?k?7C7%H<4744V 7 H4 hdK?YK?K?@O?k?o7Ck?KY jHzKXk?K_V 1hK?K?4_]4zK?Y@O?+4:`49X4#:eHzk?77k?673k?46wk?@4?K?Y@7?k?ok? k?k?k?!K>77Ck?1$h7&xHd_ 4z&*HwJ4ԃ7j6 ? 44HwJ4ԃ7j6 444_ 4z%Z#;79 0_4z%2k?K>4z4_K?1!27_4z HwJ4ԃ7j6 _ 4 <4HwJ4ԃz7j6  444_ 4z (@Hy(_ 4z>k?h7HwJ4ԃ7j6 44  44z_4 44z_ 4 4HwJ4ԃ27j6 4ςb4_u4z 4 4z_4 4HwJ4ԃᢲ7j6 4ς He4htHd4hK>#07 0 *_]4zK?!K?K?K? @O?4_4z:7Hw74_4z?@E44_4z 4+H%7>k>_4&4_7>&7=_7>&7=_7>&7>!_7=у&7=_i7>1&b7>A_I7=у&B7>Q_)7=у&"7? _ 7=у&7?_7=у%+4904X7=у%@K= @@07=у%k=+H97>_57=K=و%K>"z7=_17>&2K=J4ԃZ7j6? 44K>_7=у%"6 0_7=у%K=J67j 44K>_7=у% @K=J䤪7j6 4x4K>_7=у$4_i7=у$4B_I7=у$jK=J*7j6  4A47=7>_7>$K>k>K> k>k=7=_7>1#+H9 4zUU7=K=و#K>1 7=_A7>1#@K=J4ԃZ7j6 447=7>_a7>1#0@K>0ςz 4U]4zk=404"#(78K=Um4z04"K> 4KK? K=U4z04":K>"(4Hk?44zK=U4!HH? ׀4K=YK=K=K=K=@O=ˀK=YˀK=YˀK=Y4_7=ы:@4_q7=ы;@R4_A7=ы;e@"4_7=ы;7=ˀK=YˀK=YˀK=YˀK=Y4_7=ы<7=ˀuK=YˀeK=Y4  h@U@U7k?Ka?Hx4:@4`U4ˀK=Y_7>_7>ςK=Y@ @K?@ @k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?QKE#h7$4444 4 4 !HX#H04$X40_4z$"HwJ:7j6 J4HwJ棚7j6_ +44_4z#r5 0_4z#RHmH5h|K梊6k7 44z_)5#H@H _4z#"HwJ27j6  4H_4z"@HwJr7j6 44z_)5"H@HXJ  Z"*4_4z":4_4z"H<@4K>K?QK?IK?AK?9K?1K?)K?!K?K?K? @O?4_14z<@44_4z=4z44_4z=@44_4zK?K? @O?ˀK>ˀK>4_ A4z=4ˀK>4_ 4z?@44_ 4z>@"4_ 4z>4ˀK>k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?YKUP x7C4yP_4z*HwJ4ԃ說7j6 4 4H|p"P@Hb`@*4e`4z_14*HwJ4ԃ䪂7j6 4 Z4HwJj7j6 4 =44_ I4z*!;59 _ 14z)4_ 4z)4_ 4z)Hf4?_ 4z)r4xp4z_Y4)J4z_4)*HwJZ7j6 4 }4Hd4?_4z(Ha` r4y`_4z)*HwJ4ԃ7j6 4 Z4Hex *444?B04z(Hf 4y_!4z(HwJ4ԃb7j6? 44Hz UaHyh BHwJ*7j6 %44xP4d@4z_4'4x`4z_4'4x4z_4'4z_4(HwJ4ԃ7j6 44HwJ7j6  4 44_4z'p@Hy(_4z'J 4 04z_4'4_a4z&4_Q4z&Hg#44 HaH,H #8HI0m"A("FIH I?@ "H K5\ A(K=F`I0IH rHH XHK5S :A(K!FI0IH HI _͢ 4 HwJ7j6 E4HwJ7j6 (44_4z%R4z_4%24z_5%@I7_y4z$4z_Y5y$HwJ"7j6 4 j_4z$Z4z5x5W_4$:H<@HwJ7j6 44ςHK>4^]4z>'44^-4z>@R4^4z5e@ˀK>+4:49W94'*M4e`ˀhK>4^}4z5Hwˀ0K>4 ^E4z?@44^ 4z?@Hd4^4z77HexˀK>ˀxK>4^4z74ˀ@K>4^U4z74xP׀4K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?ˀK>4^4z84ˀUK>4^e4z?@-4U@5 U@♕ U@ 4^4z:E@ˀK>ˀuK>4z^4;@ˀ=K>@ @K?@ @k?ok? k?k?k?!k?)7$C9(79A(H0HHHe 0 H@H?@4 rHb2"4z4@4 H濕HK>4z44@4 B40 }Ua@He4 zK>K?)K?!K?K?K? @O?k?ok? k?k?k?!k?)KS`7C7&7"X64y`^4z$:ˀK>4HwJ4ԃ礊7j6 44HwJj7j6 4\44^4z$:#7 0^4z$4z^U5#H6^-4z#4z^ 4#HwJ磢7j6 44^4z#:4K>K?)K?!K?K?K? @O?HtJ4^_4 7H x4k?14\_7 4y`^4z!HwJ4ԃr7j6_ 4 (4HwJZ7j6  444^4z @K?1^4z 4 0^4z 4^4z 4^u4z `@UK?1H _۽@Hw4^54z>HwˀeK>4^4z?@44^4z;Hw"4^4z;4ˀK>4^]4z?@e@ @K?@ @@4@ @K?@ @k?74k?4^4K?Y@7?@ @K?@ @k?74k?4^4K?Y@7?@ @K?@ @k?o7#0 @7h *d b j$(k?(k?,4k? 79^=4xK>@O?#47J4 Ka?4:@7TU4xˀK>@ @K?@ @k?o4 ? @7#x *p h b4(k?6k?84k?4^4xK>@O?"46Jh4 Ka?4:@7T4xˀK>@ @K?@ @k?ok? k?4 7# @7D` `0"h!zH 4H !444 Y_4!r4^E4!R#7 0^-4!*HK`0h` h 4K>K?K? @O?k?4 X^4K>k?4 X^4uK>#;479@J4 Ka?4:@7T 4xˀK>ˀK>@ @K?@ @k?7_4K?Y@7?@ @K?@ @k?ok? k?k?k?!k?)k?1k?9k?AKC7D7'764 4`$4 ?Hy##Hs`#ڀ H  H 4 K  C_C8 jHs(j JT@ 25J H  ?w  Ht #j *H    #2"4 4k?4k?44k?^58# @ 4^ 4"ڀ 4^ 4"€ @H p4 ^e4" @ ^ %4"j5k ?  ? jG407440U 97HK a gH bhhe 4hf( d4K>K?AK?9K?1K?)K?!K?K?K? @O? 2@C5 T4ˀK>ˀuK>ˀeK>ˀUK>@ @K?@ @k?ok? k?k?KW7D4BH^m_4@724_)4!(7Hy !"444^4!*4^u4! 4^U4 Р_HР_K:Р_ z4K>K?K?K? @O?k?44@4^4K>ˀK>k?44^4UK>ˀEK>@ @K?@ @k?ok? k?k?k?!k?)k?17&7C74`4G 4?@x7 HtBH4Ҡ_7^4z <_5)?Ha`4Ha@"H@_4^54z7` 844z^59"7H "4z^e7?i"k?47?ik?44k?4?^4z!4^4z!4^4z!4^4z!b4^4z!B4z^m59!" 4 ^=4z `J4 ^4z ¤_5U4 4B^4z 4^4z ˀ`K>ˀPK>k?44z^ 4K>׀4K>K?1K?)K?!K?K?K? @O?ˀK>HhK?iK?qi i( Hw J ςMK>@ @K?@ @k?o_7C0ˀ"HCH4cHK?Y@O?@ @K?@ @k?ok? 7Ck?KXk?CH_k?)K4z^ k?!K?)K?!4z^47 4 "4^4z 4@K?^4z 4@K?^Q4z 4b04^4z 4(@K?!^4z 4K>K? @O?@ @K?@ @k?ok? k?k?k?!k?)7F7$^7HCHg_4^UKk?I`P47?Q7&&8G&FrK?I^4!07H 8@K KE!K?@445^ 4!*04^4 @K?I^4 Ҁ 4^i4 4^I4 ˀHK>ˀ8K>k?K44^-5K>K?)K?!K?K?K? @O?ˀK>ˀK>و x@G |4 744 T7HJ   Hv hg ςK>@ @K?@ @k?oKW7CBH_^k?k?K?44^ }4z7 4 "4^!4z 4Z4^4z 4(@K?^4z 4K?Y@O?@ @K?@ @k?7^k?^K?K?4_}4K?Y@7?@ @K?@ @k?7k?k? k?^@K?K?_UK?K?Y@7?@ @K?@ @k?ok? k?KW7D4BHJ_k?)^ k?!8k?14^7!7Hy !K?!K?)4^ e4! 4^!4 4^4 @K?1^4 Р_HР_K]Р_ }4K>K?K? @O?ˀK>k?K?!4^qK?)K>ˀK>@ @K?@ @k?ok? k?KW7D4BHJ_k?)^k?!8k?14^7!7Hy !K?!K?)4^-4! 4^4 4^4 @K?1^4 Р_HР_K]Р_ }4K>K?K? @O?ˀK>k?K?!4^9K?)K>ˀK>k?7D*D B@ *4K?Y@7?T@ˀK?YςK?Y@P@K?@ @Ku7QKs7Y k?k?ok>k>k>k>k>k>k>7%7D7 64 #44444_%4#7I_#(4K3"߂KG 4`744`Te7 I\h IV  FH H5WhhX4^ a7?i"k?47?iK>k?H44k?^5"z 4^4"J4^5"* bHH 64241Kjh H E4HK?iK?qk0k8HBH# bHK>YK>K>K>K>K>K>K>@O>#;7?!794U 584ˀmK>YCPҀ__4KK?1K?)K?!K?K?K? @O?4]4z!4 $ 4z] 4!444z5]4<@ˀ%K>4]q4z!J4 $ 4z]m4!e44]4z 4z]4 =4+4: 49 U m47~4y`ˀ-K>4]4z: 4ˀK>SE@ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>ˀuK>4]4z;4zˀ=K>@ @K?@ @k?ok? k?k?KS7C7$BtH7]i҆?k?!H|8$hd0484k?44?k?4z4]=k?$r4]4z$R4]a4z$24]A4z$4]!4z#@K?!]4z#@]14zk?)4yH] 4z#ʈ(h`XHf4ha4yp] 4z#HwJ4ԃr7j6 ? 4 ]44z]4#B#7 0]4z#"6#] 4z"4z]4"4]i4z"4|]I4z"4])4z"r4] 4z"R44z]4"*044z]4!4z4]y4!@Hz`@!4y`] q4z0"Hu(H64ht(KW6k74 4x 4HyK"4Ԉ:HtJ 4 Hs6j6e ςS -@5hd047K>K?K?K? @O?74]4z<4z7+4: 49 @U-484y` 4 ]i4z 474] 4z 474z] 4 474] 4z 4g7K?)] Y4z 4-74]Q4z 4>@=Hy@ @K?@ @k?ok? k?k?k?!7'KY(7C7"!x6FX407440S7 4z HCH?]A h 4` h(H}` @KK@?@4yH]4z @H]I4z HsX6thtX4K>K?!K?K?K? @O?+4: P49 U}49 WˀK>k?ok? k?k?KE`7C!4H  #Ș4 k?H44])4z#HH4zCH cH4H` 4H_ H(#JH?H "@He4h|4y`]A4z#"HwJ4ԃ7j6 444z]4" ;49 0]4z" H4Y#]4z"Z4z]94":4]4z"4|]4z!4]4z!4]4z!44z] 4!@Hx04z] Q4!b44z] Q4!:Hd` P4H "4z4] 4 H?4Hz` SKD?4h``4K>K?K?K? @O?SE@ˀK>ˀK>ˀK>4]14z=?4zˀeK>ˀUK>@ @K?@ @k?o7Ck?\7Y`!@Hb(B P@K?]14z @_m4z!jˀK?YHwJ4ԃz7j6 4|4HwJ4ԃj7j6 4 44]14z #7 0]4z 4]4z 4]4z @K?]4z bK?]4z ˀHK?Yˀ8K?Y4\u4z>Hw4K?Y@O?4 \-4z?44H(7ςhw(@ @K?@ @k?ok?7$7C\u7Y` HwJ4ԃ7j6  4U44?\4z R4z]4 Zˀ8K?Y4\4z?4?4K?YK?@O?H}(H7? 䨀hdςht(@ @K?@ @k?oKW(7C"4y8k?H(7?hx(\4z"@HyX\e4z"4yHk?\]4z"Z4\4z"8@HbP!4yP\4z":HwJ4ԃ7j6 4|4HwJ4ԃ7j6 444\4z!h@Hy(\4z!B4yPk?!K?\4z!X@K?!K?\U4z!*h`0K?\e4z!@K?\=4z h`X4K>@O?+4: 49 U4:4y8ˀK>4\4z>'HwˀuK>4\4z?@54ˀ-K>ˀK>@ @K?@ @k?ok? k?k?k?!K] 7C7%7'(6Htx&Hu&Hv *4y\}4z!ˀK>Hahap4y4zHb4X\%hx&HwJ4ԃ禒67j  44HwJz7j6 4 44\=4z&@Hy \%4z%HwJ7j6_ 44Hyp\4z%z#7 0\4z%P@Hz hzhHzxRHyh#X@Hz RHyh!JHwJ4ԃR7j6 4X4Hz R}Hyx @Hyhyp4HyH75huK6k77 44Hyp\4z$ 4 0\4z$@Hz RHyx!@H|h|p4HsH6whwK"6k7 W 44HwJ7j6 ? 4 44\4z#@Hyx\4z#HwJ磢7j6 44Hyp\4z#: [4Y 0\4z#Hsxhsh"6#\4z# @Hyp\4z"4\u4z"4\U4z"@Hy\-4z"4\ 4z"p@HypHx\4z"Bhex4hdhfK>K?!K?K?K? @O?+4: 49U 4:Htx4\]4z9HwˀeK>4 \%4z?@44\4z?@Hyp4\4z:@ˀK>4\}4z;-@ˀK>4\E4z;@"4 \4z<4ˀK>4\ 4z?@eHypˀK>k?ok?k?4 7#%``7DH 2F 4 47Sy44c?ሣ_HH 2F4 47S4H7 # K?YK?K?@O?k?ok? k?K>7Dk?)KXk?1K8 k?!K>K>` K> K D k?04K?!k?K?)4k?@K?1K>K?K? @O?KPK@b@мKHмx@ _  : p6Wk?K?!4k?K?)k?K?1_=k?7U4zK>x@]: zk?K?!4k?K?)k?K?1_k?447U4zmK>x@!0ȠG4 7G""@79G6 jG!!@79G5 G< <@ 9G4 @k?K?!4k?K?)k?K?1_Mk?k?4K?!4k?9K?)4?k?K?1@k?k?K?947k?U4zK>"{46y 0H4 7B 4ˀMK>_%K?)7K<@4UI4zK>k?ok? k?k?k?!k?)K>7k?1K>@(K>4 u@4 "4`4?"{6} 44UI4܂U14"{܁6h 44U94#܁p7 44U4#[܁87H 44U4#;܁7( 44U4#܀7 4U4"܀6 4U4#܀h7 4Ua4"܀86 44U4!5 7544 U7 ``4 `@ 4K>K?)K?!K?K?K? @O?44U4 [ܟ4H 044U4 ;ܞ4( P44Ui47#7 p 2444U94܀8K?1k?44w@k?7K?1_-4= 2444U4܀8K?1k?44w@k?7K?1_4 *44U!4܀(K?1k?@47K?1_4%Ku8QKs8Y k?Ku8aKs8i k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=7'6k>H4P4ETk>HK=74 3B4 HHBj4 4 4$4H 7>K>_=6"4H4RhC?H6v HhC?02K>46_7?!"7?!C? :#  *J K0J 4 @!k?G?46Wk?K>k?K>_ k?k?J74zk?U!67"`75p@"5 E47 /HI` 6 HH}4 04D 4zU4K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>"46 Hx4 RE7Re74zB7ˀ K="46 H4 R7R74zB(7ˀK=J J0JG?- 7 ˀ]K=k?ok>k>k>k>k>k>k>k>k>k>k>J7#4k>E4P7E4PHx74 B(4HHwB 4 4 Ha ? 7?y5_K>Ⴠ!Hv6hbC?Hy7 y hmC?_!"!"5-@J4 4E574E|57I X I J0I -x#47 H4 R7R74zA<7ˀK>Y4 8@H` @HH|~Ha  K>4U 4K>YK>K>K>K>K>K>K>K>K>K>K>@O>k?o7K>k?C$4k?K>!0K>4"" # 0"" !"  K K04K k?UK JˀPK>UIK"h7K?_ -K?4K>@O?K J04K v k?U)K?4ˀK>K K> 4J0K k?UK?'4ˀK>K H304 K3 k?UQK>4ˀK>K HT04KKT Tk?>g4ˀ]K>K Hu04K k?T5K>4ˀK>UK=4ˀK>ˀK>4 _(@0 @4@4k?ok= k=k=k=!k=)k=1k=9k=Ak=Ik=Qk=Yk=ak=ik=qk=y67>ik>4 7Ck=4 4 j?4 4j?4 4j?4?j?K>K=j j(j0j8j@6k=k>k> k>Fk>!44K= 4z5_7? '@C?/K>7: O K>I7k>"k> 26Y 0RY6# 'k?H|ѳ7>k?KPb@ѳk?K8   Sk?7>!4z_5'7_5zI H!074IA k?59T5'B C?/@0 G?9@ 7?I_I  PJ+05J @  T4& H?5J4 4 4 H444z5_-7?1$7?1 2C?-' ""[6Y T 4%"C?-4"4?!7?1䂒$4ʃ=7"[4ȃ& "Z 0 B!J!Rk?G?)7>4zk?7>!5k?_k?&rk?7? 4zk?7>!5k?5_k?!ˀK<6Y R6!R$I J04IQ  7T5$4G?) HxK@v@G?)KH ׽]!H@C?/6 7C6I I0IK?9    HjIV4z577K>K=zK=4K4zk?7>!5k?_k?!k?7? 4zk?7>!5k?5_k?>K>ˀK<#7 4G4 R ]7R }74zA7ˀMK<"46 G$4 R 7R 74zAD7ˀK<ˀKˀKI JW04IT ;K>ˀK<ˀK<@ @K?@ @k?77\k?@ k?K?\400ˀBK?K?\7 4?k k(K?Y@7?k?ok? k?k?K>7C7$k?! k?)HtȠHJ4z844]4 "K HtJ#7 4G4 R}7R74zA 7ˀK>He0k 4H(0h| R h|(Hw0Ht7  hs0JK`47?7D @ g?HdHHx7?K?!57HfH7?K?)K`7HuH6?" YhyEHz |HvH| 7?V4H7hw4K>K?K?K? @O?k?ok? k?k?7C7k?!6E@4HK?!E7 K>74 h h(h0h8h@HxX hdXK>K?K?K? @O?k?o7?k?7"k?6 07?ak?S}7K?K?4_m7?aK>@O?k?ok?KCX` X7DHhX4zHwR]k?K?K?YK?@O?+4:49T4}Hk?ok= k=7E7k=q46k=k=!Ek=k=+H9h4k=)7=k=yk=\%k= K=)\7?! k=44k=7=4HRk?k?Q4?4k?A44k?I7=qk?Yk?a_k?i zˀPKk?Hw`6#k?7 7?Ah`SQ6K?44z_E7?AK>@O?@ @K?@ @k?ok? KYh (7C4_4zK>k?Hd`4"hdh6 7?Ah`4S144z7?A4_%4K>K? @O?@ @K?@ @k?ok> k>k>k>!7#7D 7`p p44w? !24_=4xK=ٌp"*4 W7>(k?p"4 We7>k?47>4_4PK= 44 G4 7A4y4K=K>!K>K>K> @O>H`4h` E 4 7>4S4 4 W-7>hh@Q}7> ֖t@7> 7?S4 ]k?h=@4 W7>%k?RY@k?h@Q7> :z@z@7> 6?S)4 `uk?R@Uk?@ @K?@ @k?ok>k>7# 07D4?4 4 244_4 Jˀ K>Y4_=4xK>YK>K>@O>_4k>H`4 (h`4?4 Ek?"K>6 7?!SQ4k?RK>47?!4_-4K>Y@ @K?@ @k?ok>k>KD`47%k?"7Ck_`67?!4SQ4 Xk?4z7?!4_54K>YK>K>@O>@ @K?@ @k?70 0784?_@K?Y@7? *  4?4?!@@ @K?@ @k?ok? k?k?k?!k?)k?177C7$6 4 4Q47H :4Q]@ 7( @?5)E5!7!;590R15H!RQ4EH7"{76y 4Si74k?444z_ M4 ˀxK>444_4z"4z4_ 4!R154K>K?1K?)K?!K?K?K? @O?+4:@49`T 4|u@R4ςmK>He`4hy`!;59@54S4H X@Q5   Sq59` 4?459pW 5>k?4k?444z_ 5>%@ˀ5K>ˀ%K>k?ok? k?k?k?!k?)k?1K\X7C7k?A"`6HXKP"k?K _ 4z7Q7E7"K?A767S 4R!4444z_4!@R44Hg`4hs`_ 4z7k?Q%7D7(#7K?A74S 7k?R!5:H '4z45_}4!@R 54K>K?1K?)K?!K?K?K? @O?+4:49T)4uHXˀ}K>K>HȠ04Ƞ@ H@HD H 4 R 9 H =@HzXK] =}@_}4zR !74z4_4>?4ˀ5K>ˀ%K>@ @K?@ @k?77_xk?7Wp4T_%4K?Y@7?@ @K?@ @k?ok? k?k?k?!a(7C %HXK  *_4zR 7@_4z7Q 7D|77k?47S4R 4444_M4z @R 4^HX4yk?44w4z_=4K>K?!K?K?K? @O?ˀK>@ @K?@ @k?77_k?7W4L_4K?Y@7?@ @K?@ @k?ok? k?7K_X7Ck?!K k?)K_]k?k?1Q 7D7k?9#K?!7K?1S17k?RK?1K?)K?94_ 4z *4K>K?K? @O?R)K?9ςK>@ @K?@ @k?/,opk>k>k>k>k>k>k>KAX7C7$H' 7_6k> 4 HvXJ 4HwX& 4z_EJK>Q77Qm5Z D7:ȉ !h7 4 k?Q5k?#K> 7S4R1K>R!5ZX:7>x&a9G&iEi k?4z558_94 4K>YK>K>K>K>K>K>K>O>@/0,Hi`5:hz`#75Sy58]4R5ςEK>Y@ @K?@ @k?ok? k?k?7%KYX7C_K& k?!Q7DT7< 7 4k?Q4#K?! SA7RK?!4z44_!4 4K>K?K?K? @O?He`4hw`#74R44R4ςmK>@ @K?@ @k?ok? k?7CKZXKE _4zk?! 4 HxXK $ 4k?_Q4zk?)QK?!K?)Q}7 D6k?1#K?)7 K?!R 7RyK?)RiK?!K?144z_4 *4K>K?K? @O?QK?1ςK>@ @K?@ @k?ok? k?k?k?!k?)k?1k?97C7 6_4z$HvXJ _a4zDk?AȀ04D 4? @x7 4 @HXK 47_4z \?_5J? @_4z#Z 4 H}XK  47_)4z <4 4 HtXJ 4_4zK?AQ 77Q4 `87H4Q  B_5)D$5!;K?A75907R=4QK?AQ4`Z459@W5 W5QE _459pWI5 @Q4k?44z5_a4!BˀK>D 47_4z 4 @H|XK ? 47_q4z̢U ˀHK>و<4?=@Ȁ@׀4K>K?9K?1K?)K?!K?K?K? @O?Qm5ςK>@ @K?@ @k?7K_X4k?K_ 4K?Y@7?@ @K?@ @k?7K_X4k?K_ %4K?Y@7?k?ok? k?k?k?!KG7C77%604Ǡ@ G@HzD 'h|Hw   4Q hgHw ZHz` Hs`Hy6} h}`Hg Hf H K>H|HA Hy(?JK> Hy?K>K?!K?K?K? @O?@ @K?@ @k?ok? k?k?k?!7Ck>4Pk>k>Dk>K> 7 Ƞp47>k?K>4_4z`7"{6yP4Re44Qi4K> 4#K> 7`R4K>k?4z44_4 B׀4K>K?!K?K?K? @O?D4HtXj(4HuXJ(@ @K?@ @k?ok>k>k>k>k>k>KVX7C7k>J 6_AJHsXJt(!7H}XQaK(K>QI7 Q14 D6dK>`7!z!`#7  ŀ!bk?HxX75:k?K>k?K(R]k?HaXQH:(H|Xk( HbX4 hC 4K>YK>K>K>K>K>K>@O>+4:490S 4 >5H}XQ@#7p#7k>474 F6Hyk>57K>K9k>@K>K>@ @K?@ @k?ok? k?K_X 7CK( "+4:P49S }4 HXK 4zk?)Kk?1K(k?!K_ k?k?9Q7K?!Q7 D,7Zk?A#;K?979@K?!R E7QK?9QK?!K?1K?)4z_ K?A *4K>K?K? @O?Q5K?AςK>@ @K?@ @k?ok? k?k?k?!K>7Ck?1K>k?9k?A K>Ȁ04HyXK$ _ 4zK>7k?K?14zK?9_-K?A0ˀB!  HsXJt`"+4:490S4 D4(H}X"K76PR 7hHzXQ4D`7#7`77R 4Q 4HzXkF@ HuX4 j 4K>K?!K?K?K? @O?@ @K?@ @k?ok? k?k?k?!k?)K]X7C7k?1K _!6HxXK( 7HwXQAJ(K?1Q)7 Q4 Q 4 Dp7ZX7 r P"+4:P49S4 p-HwXQ @"(6p"6"6k?HX6p5k?K?1k?RK(HtXQ -J(HsXjh( HuX4 j 4K>K?)K?!K?K?K? @O?@ @K?@ @k?ok? k?k?k?!k?)7CKZX7k?1KD 6_I4zk?9Q 7D72 b4`7!!4d  K?1K?94R4QMK?9HX K( "+4:49@S4 H}XK0@ 04KW 4F ?44D %4 HsX j|0HgX4h 4K>K?)K?!K?K?K? @O?Q @4`M 4b5 @ @K?@ @k?ok?K_X7C k?K( "+4:`49S4 ZHzXKZ8 0@QK?D7Ȝ`QY@k?QAK?K?HxX 79DXK87Q4"K? R6HsXjd84K?YK?@O?k?ok? k?k?k?!k?)k?1k?9KVX7C7k?AK>64^J  Xk?I 4 HtXJ 47^U4z7HX K8 "+4:49S4 r!z!4dK>!xK> 4 !zH}XK8Q4~K?IQ7K?AQ ! k?HX4 k?K87P Dk?HwXj8HzXKJ8Q!5ZK?IK?A R4QMK?I(@QM@4`u4b 4 >H}X XH}XK8QY4\K?IQA7K?AQ) \k?K8Q4TK?IQ7K?AQ \ k?Q4k?HX 7Pk?K8D HwXj8HzXKJ8QA5ZK?IK?A R4QmK?IH|XK8Q4K> 4R4Q4 HaX4 h" 4K>K?9K?1K?)K?!K?K?K? @O?@ @K?@ @k?7K>k?K>4k?K>k?_k?K>@7?@ @K?@ @k?7K>6k?4k?k?_}k?K>@7?@ @K?@ @k?oK_X 7CK8 "+4:49 S4HxX"K8V6pK?Y4@O?@ @K?@ @k?ok?k?K_X7C 4K( "+4:@49S4HxXPeKHyXK:(PE7HXK0 !x6dK8@!HxXK@@!@D h4HwXJ7Q 7HXK0@!@HwXJ(V4HXQK(HeXh(HbXHY8 "2#[7YpV4HuXJ@ ":H}XQAKH}X4K?YK?K?@O?J>u4(P} HXK04  ?@%K8P%@HxXP@ @P4"4 R6HbXHZ04KT h@E V4H|XK0Q % HvXJ04E ?E Qq@HaXmh 0V}4H|XQ1K8HvXj8V=4HtXQJ@HsXj`@@ @K?@ @k?ok?7C44\]7Z 7H `"+4:49 S4XH H(^4zK?YK?@O?@ @K?@ @k?77?k?_9k?` 74K>@7?K?^K?K>@ @K?@ @k?ok? k?k?k?!k?)KXX7Ek?1K^KK?1P77P4 Dx6(`A(7 K?145R4k?Q4444^ 54 B4K>K?)K?!K?K?K? @O?Qi5K?144\54 7k 4]k(k?H`4 h`K?145RA4wk?44 F4 Qak?9Q7K?9@7ˀK>@ @K?@ @k?ok?^=k?k?!P}K?K?!Pe7 D67k?#K?K?!7 R7QYK?!K?44^ 4 4K>@O?Q4zςK>@ @K?@ @k?ok?7:k?P%k?!D7(7k?#K?!K?70R7K?44^u4 4K>@O?Q4zςK>/0'@@@K?@ @/0'k?/,o0H k?!7:Pk?)D87(7?/ "K?)76PRI7k?K?!44^4 "4K>O?@/0,QY4zςK>@ @K?@ @k?ok? 7k?^ -k?k?!K?Pek?K?!PM7 D7("K?6pK?!7R 7k?QAK?!K?44^4 "4K>K? @O?Q4zςK>@ @K?@ @k?ok? k?k?k?!k?)7C7k?1^ k?9(7!"B"R* Q@ 4@4Ka?H?@ 4"4p  Hh`5h`P4C|7(k?A457R 4Q 4K?A 44k?PmK?17PU4 C7K?1744R 7k?Q Q4K?944z^4 4K>K?)K?!K?K?K? @O? 4L4 4L4U @@Q i5ςMK>@ @K?@ @k?ok? k?k?k?!7C7k?1KY Hz؇_ "+4:@49Sy4T^4z7k?K?1 4P @7P 4 CL6#7K?177Ra4k?H44h4H^ 4z :4K>K?!K?K?K? @O?Q I4ςK>@ @K?@ @k?ok? k?k?7k?!k?)^k?1 7 :Z!: Q @4@444k?P K?)7P 4z C<6#K?)774RQ7k?Q4zK?!K?14^4 b4K>K?K?K? @O?444@4Q4ςK>@ @K?@ @k?ok? K_7C X7$HvHx  4JK`6y74?hwH؇ RHuHw 4JK6`674?hHa4< h|Hw 2k?44z^4 P@HbDhx4K>K? @O?ςhdˀK>@ @K?@ @k?ok? 7CKX7$Hw hd :k?44z^4 B4?h}Hz@ JHy77? hhwׂ4K>K? @O?+4:49R4Hyk?H4 4z^4mK>@ @K?@ @@4@ @K?@ @k?ok? k?K_7C7%k?! 6Hw 䨀hd4P Hy :k?444z^4 hek?Hx 4zK?!^i4K>K?K? @O?+4:49PR4HwˀK>k?oQQ7CQq7Ka?7 @4:@k?# Kx7P4w(K>#; KxP79 K>@O?k?7_@C4K?Y@7?Ku4Ks4 k?Ku5Ks5 k?k?7Kxk?#[ Ka?k?7Y04:@Pk?K?K?_-K?Ka?H9@78?`Hh8@Ka?H?H7h7H4K?Y@7?K?_4K?Yk?77_k?17?9k?)k?!_k?9C 4K?Y@7?k?77_k?17?9k?)k?!_=k?9K?Y@7?Ku9!Ks9) k?k?7# 7@_k? @K?Y@7?" 46pF4 k?P]7K?k?Pm7K?K?_-7eK?YKu5Ks5 k?k?ok?7C 44F4 KxKa?4:@k?Pa7Hw 8@ `K?P)4 h?4cK?_4K?YK?@O?k?ok? k?7D {  Hk?!44yF4 K?!Pa7HKa?44y@FX4 K?!7P4Ka?H?K4 P4% K84y4PK?!H ?@K?!Py4ypK>K?K? @O?Ku5Ks5 k?k?ok?4^[ k? 7@xk? `PyK?C 7K?7P 7" 6V4+49V4_4K?H C d4+749P 7_44K?YK?@O?Ku7Ks7 k?k?74k?k?_7?K?C 7K>7@7?k?" 46F4 K?k?7K?_K?uK?k?oKx17Y { Pu4z044yPFh4 PE744yF84 P7P!4K?Y@O?@ @K?@ @k?ok?k?7?1k?1k?)k?!!0k?944C@ K?9 7B *7?6`Hw bB *7`?64c?`Hw?@K?YK?K?@O?P4eԠH>7P4?ԠH@? u4k?ok?7#k?PA7:k?@wPK? X7K?4U 4y 2@Pa4?744K?YK?@O?7KYC77, WǷ@44?@7?Ƿ# 7.& U KYC87?'00N9F8G'I  J79YC3 X6?Ǹ_M w @7? ]ǽ2KA4<\C XǸ_@4?@7?k?oK_4C7Cx x7 b@Y7v, _ǿ@_4zHC4] 2ϟ@K?Y4``J4r@:6?7 aK?Y@O?ϟK?YϟK?Yk?74_ 24 4X 2ςK?Yׄ4K?Y@7?P@K?Yk?7N:N!JJ ‡FF BbB B@ "P=@K?Y@7?# 7@" 6@# 7P#[ 7\p#; u7<# ]7"{ E6|" -6k?7_ @_7K?Y@7?Ku2aKs2i k?k?ok? k?k?k?!k?)k?1k?97'4Pk?A+7444( X 4* ` GP  | B G 7 (@  K?A_4x j4?@4K>K?9K?1K?)K?!K?K?K? @O?+48 P k?ok>7#4k>4P 7>k>#7>  Kw1  #Zk>K>^?*E$K> p7K>?@Z"K>@ 4yȜ84K>@ 7>7@ 7>4K>YK>@O>k?oK?7Cr Z:7? 87='Hz'8G'FC  |K?Y@O?k?ok? k?k?k?!k?) 7Ck?44 U9k? 44c 4@4#4x#4V4z! @P 4z0 _ w 67B7 @ R4@4 Z@_ 8"@?7044K>K?)K?!K?K?K? @O?C48"Z|4_77?7?_45? b K?7, VǶ5?@J w  TǴ26?` @ w  Yǹ_6?@2 w  "6? x ' (4 w 0H64`4@| S4 y X@ w 6  <]m7 w  Z Y? w }? 5?4\ 7\ w  w < w 6 u < w 4P 14z77?7?_4@y4x: (K?4P4y444Q4x4k?ok? k?k?k?!44k>k>KEXk@XKFPKD`KCpK>kPK>k@pK>k xK>!C`!B|7?QK>K_^7>A@7?Q7 (@K>7>A87?Q7 @@K>C "K>7>@ (7?Q7K>KP 2# 7B7?QK>jPKX 2" 6 B7?QK>@jXKxB *# 7`B\7?QK>jxK>7?Q@`4K>hPK>k%XK>kD`K>kpK>K?!K?K?K? @O?k?oBh7CHz@ @P@Hz@ @Pu@K?Y@O?k?ok?k?k?7C@7$44zTA4HH @H@@4H0!jH Ax4H8" H(B4H"H B4H@#RK?YK?K?K?@O?C0  |HPy 7C4Ha% \4HsHe  T4H@e_m@H0Ch u |HP % 7C(4H 4HtH  T4H _wHH8C  |H E P@7CX4Hx  <4HuH % T!4H(_e@EHC -h|HP 7C4Hz E 4HvH  TY4H_wHHC4h|B 7HzBHeK?Yk?ok?B X7CHz@ @PI@ `h`HHw H`X4HHw  P@HwH4_@PHzh`Hz@ (@Bp@PiHzh`K?YK?@O?k?7_k?_5K?K?Y@7?k?ok?k?7#_-7 4B4z84# 7@4B4zHd4K?YK?K?@O?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK27D7%B_744444)4 +4, k>4+ k>4* k>4. k>! 507j,! 4 4?47W?u4? w ǚ6\ C(b _ AǡRH6V B((@ _ VǶ_@k?444A4x (7H Y4A6YH^4 rk?444A4xH7^4 6S  06Qh`_@Hp Thp 0HH7 Hy@ 82H6 @? ?@HC0 7  bhh44@T4x 06Q (7H ?4A69H@ ^_HC (4 244A7?Y P7Hǡ K>@K>Bp7?Y4zB7?Y 46B H4^ޟ4^_ B8444B4x$7H^_HC#7 7?A4A847B7?Ak?B7?)k?B7?A 0H447?A@7?) (7H "4A469Hǹ@K>@K>BX7?A4zB7?AHXB5BP7?)4zB7?)HX7?hXHP HX*4zB7?)HP6?hPB7?)B7?A 4H@ @9 @B7?qH52 44A7?qK?qK?y] 75B7?q4zBX7?qB7?q P@H^rk?44k?4@@4xHPH4ZҠ_4 H7H^r44A4x47 ! bHƿ@4^_ A444AL4x74 !*HB_@67W? :H^"44A4x7 H H` # 7B`4zHp@ ZHoHp " 6B4z_Hp7B4z5<K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O> %@k?ok? k?k?k?!k?)k?1k?97& k?A74B77?iA44 !x4K?i A`44x4 7 7 K?A4_4x!7K?i@ 4B 4zHC?m@7 4B 4z`K?iK?A4AX7? 74zB 7?B 7?K?i4_4 HsBz?4| 4B 4z4B 4z4K>K?9K?1K?)K?!K?K?K? @O?B 7??GHsK?ik?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Y77#k?i 4k?a47B k?qHz7_ 4C4(04+4( P4) X4 4K?aK?i4y@PK?q 7HwB( H}Cf!44K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O??4O Hz474 LO (7 Hy_5x :5? L@>H}UK?a4K?i4B 4 , B K?iK?i4B 4Hx  yK?i4B P4Ht6 uk?ok>k>k>k>K747#k>B!j4!4!r444!4# K>7B `4Hy7: z_4z7 " 67?QQY4K>BX7?Q@ * "HC7 0 g44K>YK>K>K>K>@O>4y_u4ܟ44k?K>4A4yܟe44? jB J K>4B4Hx7 } 4̂5@>%@_Q4z@k?ok?K!7#4k?@?? "4y_4 K?Y4ڋ_ :# K?7B4Hu6 vHtB7d, YǹX@HyK?B84Ha45 uB Sdz_HyH|C4\ "{ K?6y B4Hv6 yC? XǸX@HyK?B`4H|7 tB ]ǽ_HyHuB4ʊ # K?70B4Ht6 xC WǷRHyK?B4Hv6 sBb ZǺ_Hy4K?YK?@O?k?ok? k?k?k?!6K77$k?1B47E!46 _14 87H H`_4 4|!4ڊ :# 7K?1B4H4 " 6@K?14B4_ 4@`4|!r`4|H " BK?14|K?1B4h4|>@K?14_4|(4|\ @ g?aK?17?aB4K?14B44| _ Q4>@#[ 7YPK?1B 4 `4|#; K?179`B4(4| *K?14_m4|4| !4? B4k?K?144@4|4|_ !477R 2# K?17pA4HB4k?9H7OE4K?9 F _H (k?A" K?16@A<4K?A 0K?1AK?AOK?A@ATK?9OK?9H  4|K>K?!K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>K>77)K87 97CK>6444 $4 AD4z7I?C40#7 ,_5:$7Hy @HzLD_5:$H$ A,4 $Hx A5z" 4z@597A$7?1'r'44z595_5'7 II B 6Hx <6Hw S IHu 4A5A5K? 5kxd4J>7?17 ?4z59_ 4&7_5:_m7OI:WK? 5A4I94A\5 p@B D5Ha+ \5Hv S I9Hu I4 u /_5:Ak? OI:K? aHpǰ8 ! I:5T 404  @I9K? A4 @I9K? A5zI5K?  ? " 6`A47? @5:!"5A7?1YK>K>K>K>K>K>K>K>K>K>K>K>K>@O> zK? B$ h|K? 4haK? `2Hs  7K? @K? a4 4 4 ! 5A4I?C;@7 74z59@\7?1=74A$7?1=@K?9K?1 YB5Hs k 5H} SK?1H} o 7?1 @A@K? 7?qAD7O4z @A54 *" 6@A4`@HBz?4|] " 6A4" 6 A4 0]@HH ? 8484zAx4 5k?ok? k?k?k?!K_7G7$K>76^"{ 6y^54  b7 }^4z""H   C4X!@H^_ 4^4 P 4^]4 ( 4^54 H4" b^4z!BH   @C4 7ς z4^4 ` 7 f^M4z H   C4 4K>K?!K?K?K? @O?ˀK>7ς }ˀK>ˀK>7ςm yk?ok? k?k?k?!k?)k?1k?9KH7#7EK976h 8 & 4#7?Ik?7?A4_4%@A 7?YHyK?A *A\4Hh_ HH hh! 5`A |4K?I4 4 7?YA ,@K?IC7#R!47?I@7?Y$*4 t44y@7?Y 4A t7?YHsB 8 4A d4A <7?YHCR" 777! *44yA H7?Y?/44 A 4A 7?YHC70 w0K>7k?I7?IA 7?Y"z847:O 4x @Hy <@ @A |4(HyHy4A L4Hy4  hA T7?YHh HH hh 4`A <4444 4 44yA7?Y>4 %47k?I47?I@ 7?y 5A 7?Y7?YA <7?y5A T7?YK?IC j7k?I7?IA X7?Y :4A 7?Y5A4K?Iu7?YA@K?IH4"?h5 Al4Hj@ Hz4S%4 zHwB4V ZBB B7z1O y "4A4@HjHh7hh4HyA4Hj F  K>K?9K?1K?)K?!K?K?K? @O?k?ok? k?7#4k?!7:^=k?)77ȠJOHz@0@K?!K?)4y_u444K>K?K? @O?k?ok? 7C7?k?4Ak?A4zk?!K?4z_7?!@HxPK?HsXrHh K? 'k?K?A7?H}X8@HyP76?hvPk?K? $848A 4zK?K? ? 848K?!A4zHb+@߿49 @_49 0A\K?K?A7?4AT7?4K>K? @O?# K?A7HzX7U?huXk?ok>k>k>k>k>B67#k>K%7D4"H^޿^_" 60^ M5"h@Ad7>K>AT7>44O}7>7>^]4A!z44K>4yA(5K>4_!4y! 7 eAK>K>A|7>4^7>5C @C :7C b?7C?7 ("7C ?77?A@>4_7>A7>4K>YK>K>K>K>K>@O>4K>44yA85Ÿ}4k?ok? k?k?k?!7#7DK:Ok?14Z" Hz6@Su4  2# Hz7PSE4  @Hy7: z4hx#@7s, VǶH"4(ȠhHPHƟ@ ^_b [ Hz4YpSu4"2H}7 |4hPO9HzZ Hz4S4!*HtB7z1YNu@!HCC!bC4 R7 v4K?1hX4@4y!@44 7 u4K?1hP4@4y 4H^ _@ Hz4`Sm4=HHs6a a4hXHf44N47 7C?7 4? 2# 7U54@ 7? <H`ȠHPHz!J@7u, WǷ@:4 *4_ 4? 4 Hƿ@ ^jǷb4 f^E4zHyAK?1NHzHt x wƿ@:^"^_HP7^_hP4 bHƟr@4v Z@4< BN@K?174_ 4y4_@4 @4ڂ *4 b@4 }( BN@K?174_ 4y4!@7t, VǶ@4 ^޿ ^_K?1@4z!@ 4@?4#[ 7Y0^4 7B0ȠzK?14_=4yȼ4@ 2K?144y_4ȼx44HP HX BHyK?1A 4NHzHa  b4K>K?!K?K?K? @O??4EHPKu5Ks5 k?Ku6QKs6Y k?k?ok>k>k>k>k>k>k>k>k>k>k>K?47#k>C7D4 P4C7z1YN @ HC#@HC C :C4 + "C4 C"4 7 :C4 "C7z1N5ҙ"HC `@C! әN5 *7i1Hz_}59$7 Hz4S4'XHz4@S4 *HC4҃'4̂'44K>YK>K>K>K>K>K>K>K>K>K>K>@O>_7y17HyK>AP5Hw  }7_7y1"*Ƞ4Ha49 y^ 4&7Ƞ47 sHX6hXHC: 7 jJ A_7 iA?5:!+4( P4) @7j,4+4 4 J ( k?K>44@ @4yȼuHzk?K>44k?_4yȼ-Hz _ XǸݽ@^)4zHzN7}HyHz_7y14 ZH=@H`߿95AK>Hy7: zHzC_>m@ { A4y4Hy78 x4 C R4 4 k?K>44@ 4yȼ:k?K>44k?_4y7!rȠ=4^4z@7N}Hz@ Ƞ4@@Hz5S%4 HC46 CC rN}5: P@K>A 5HbF  z_59@HHyK>A4Hh   H>u@7 yH+߿49 `K>_49 pA @NHzHyK>7A 7H}  b7W w^4z97Ƞ44P7?!K>A 7?!K>A 4O 94N HzHz \ 5 a7 nA+ 84' 4 (4'  R4 4 zk?K>44@ 4yȼjk?K>44k?_ 4yȼ(@K>4@ p4y7 "HtB Ƞ4K>ᐠ A 844k?ok? k?k?7F6k?!7#Al6Hy77R]4 H^4 87K?!A X4O4 @HyK?!A 4Oq4Hw  xK>K?K?K? @O?k?ok? k?k?k?! 7CKZk?14PSQ4" 4H}7k?C 47?^@!K? k?C C 7k?K?Bv?7?Hx7 wB@ 44z^@!7N 5Hz`HyK?1A 4Hw  C H@CF 0@K?1A4pHt6 gHuB ?4zK?1AP4(4Ƞ4Ԡ44K>K?!K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>67D7&@7k>4 4 4 0@HPӀ_HXӇӀ_'A7?9A7?QHB4H#6 ^4 H |@r44K>YK>K>K>K>K>K>K>K>K>K>@O>H A7?9 c5I?+4- k>4: k>4 4 5,Ah7?QHCW 4 7 HCw"k?44k?47?9_7?Q#7K?9< A7?9"4 @ZJ^4"744_57?9PK?944@7?Q"877?9A7?QK?9K?A ? 848@ 4 `2Hǵ K>@K>A7?9}5)?K?9 ^q4 7Ƞ4B4?67?0 Ƞ4 ` g?1O}7?1HC74 7 H7 <}@4=H7 ^ A4 H }'HȠ-@4K?9K?A ? 848K>@ 4 H+߿49 _49 @T7?9HX!; 59@$7?97?9@7?QK> "4z@7?9p@HbHfF :H+Ѐ߿49 Ѐ_49 @|7?94zA7?9@7?Q@7?94KA@77, S`_ˀ7?5KT6WB ]ǽK=46B S \6? dz_60V0=4@k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7D7&k>@<7?1@,7? @K>+4" @k>4- 0k>![ 44447i,5Jh!{ 4 4 44T4LHB?7? 4? Q 4*?HHC6?QB4 w)4 )4)K>4@ 47`04@? @K>K? K? R#[ 7Y@|K>K>@47? @7? @@7? )`04 4|6 HǴ@5y @ 7? `04?6 5y@@7? `046 K? K? H@C ( *5y@T7? 5y@7? 5y@7? HCM *444^ 7? 7HC 7 5y@d7? 6 7>_4 K>H@@"4=WK? hK>H 7?!Mk?!6 K? K?_ H@C ( *5y@7? 5y@L7? 44@ \7?  (@HC (0 Ƞ@&J;U@7E 6 045y@|7? HCS 84HǼ K>@K>@\7? HC? ? ]ǽ@^q4 k>NHK>@ Ƞ@H@7? HK> X 4 4! 7?Y4_ 47?Y@7? 5y@47? @HC4 4 4? *^H6 7H7 4CS!Ƞ5@ k?@7?qk?444^7?q8e7K?qK?y 8@7? @7?q5y Bk?444_ }7? >=7Ƞ-@"44@<7?  HC Ƞ@7 HӠߒ 0/K? K?_ 5y@|7? ^Q6:7@T7? 6 HbK? K?Q 5y@,7? HB^:7@7? H6% k?K>44_ 4ȼU@7 7>_4 K>H(vGHȠxK>7 ]4 87H H`]4 4K>@@@7? 44|K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>H " @K>@K>@|4̢K? Ku6Ks6  k?k?ok>k>k>k>k>k>k>k>k>k>k>k>7G7&k?977?A44@D44 ![ 4 4 4 44HC ( 8""#B#Hh@HHz_ 5Y@4zHB]Ӛ7@4zH6 4Ny4c?%N1H4H   47?9_}4K?94O 4HhHo 4@ 4z4z@ t44K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>4k?4k?44^7?A74z@ d7?A?47 HyHt 5Y@ <4z5Y@ $4z7 HxHsx 5Y@ 4z5Y@ 4zb7 HwH} 5Y@ |4z5Y@ d4z@4< HC:@4? ; 4<  @47 HuHi5 " 6@ 4z"{ 6y@ 4z47 HtHh # 7@ 44z#[ 7Y@ 4z47 H|Hk| #; 79@4z# 7 @4z%47 HaHl, " 6@D4z# 70@$4z47 HvHjV ! 5@4z! 5@@4z547 HuHf !{ 5y@T4z![ 5YP@44z̨47 HtHe !; 59@4z! 5`@4z̪E47 HyHv  4@d4z 4p@D4z̪47 HzH|\  4@4z [ 4Y@4z̬U47 HsHbS  ; 49@t4z# 7@T4z̬47 H}Ha= " 6@4z" 6@4z̬e47 Bt7, X_ȀH4 4C.77?!7" @X 8p47?!HB  6yH6` C9 ?HHA 4Ƞ47?!  H6M NAHH@ p47@7?q44^7?q @K?qK?y ? 8484@ 5H}Hb] ! 5@T4z4z@ 7?q@4@|7?qȀu@k?ok? k?k?K747#k?!B 4 6 a@7404 *4 K?!@44Hb4_ C7e, _ǿ@׀4K>K?K?K? @O?4 ˀK>" K?!@|6Hf4ςu ǿp@4&HzC_7y1c1@K?!Hy78 xC Sdz_@ # K?!@7 ςK>k?ok? k?K?7#4k?!C7D *4K>K?K? @O?7 s] 4z`7ˀK>#[ 7Y@@K?!A@4k?)Hy7R14K?) E ]H 8k?1K?!@07NK?1(H}HyK?!@4H}  tN1K?)ςK>k?ok? k?KW4Z7Ck?!B jc1K?!@H7y1Hv6 aHuB7d, _ǿ@:ˀK>4V?Hu6 |ǿp@4%HzC_7y1c1@K?!Hy78 xC Sdz_@4K>K?K? @O?k?ok? k?k?k?!k?)44HC!7 ]4A8h|@"HC!Z7 444z7CK(7%7@7H_-@Hy7? ph}ˀK>A H4h|@`7Hx4z_Y4 ˀ(K>@ 44K>K?)K?!K?K?K? @O?ˀK>Hz@?@@@-HxHy@p4H 4z@5ς5K>k?ok? k?7CKZ7@ k?!Hx@HH`b *4htHA x40 | WhwHHzA  |A (4K?!77R 4 `H@7hy@H} K>K?K? @O?k?ok? k?K_077Ck?!KX @b *4 hs0A 4(0 | Whw0HzA |A4K?!77R4 H 7hy Hz _ K>K?K? @O?k?o7CKZ(H8@b *4 h}8A4(0 | Yhy8HzAh |H|(7h(Hx  K?Y@O?k?ok? k?k?7D7k?!6A7K?!77R4f H K>K?K?K? @O?k?ok?KW 7C@jH6?hd   *N@Hw HHw _6?Hw(@jH6?hd(  *Nq@H  HHw(_6?K?YK?@O?k?ok?KW@7C@jH6?hd@  *N@H HHw@_6?K?YK?@O?k?ok? k?k?k?!k?)k?1k?9k?AKG7C7$k?Q4X4!{ 5y@H7HA ![ K?Q@5YHC4(0 4ʊ HvcZ4!; 4 4 ("B7 C *7?_)4 ˀK>k?H@ ^_Hy@4c]4k?CH^ޟ ^_K?7?k?K?cHs@czHx`K?4A?Ak?HyK?:  0k?Hs@K?Q@597?4z_7?a"H}@K?Q@p7?a@7?aHt_-4K?7? k?H "HuK?Q@594z4_7?a" HtK?Q@7?a@7?a4HC(0 <@Hx\@HC4ʈ" b7 HwB #; K?Q@ 79# K?Q@ 7 Hz# K?Q@ 74K>K?AK?9K?1K?)K?!K?K?K? @O?ˀK>7?_4<7HˀmK>ˀ]K>ˀMK>ˀ=K>k?ok? k?KD7Ck@H7hwHe_}h`k?!Hz@ @@ @hdHy78?hxK?!heK>K?K? @O?k?ok? k?k?k?!k?)k?17%K977D6 7@ 4z4@ p4zHz@4 Hs:@4 "444^4wH^ޟ ^_J HzM4 &H@HzM4 0&HeH `ZC4ދ BC49 *C7z1M !@HbHz B *`R 4] 4 *HhA 7z1M 9#HC4%0@C%C4ފ C4$8$C7x, UǕC ZǚĨ@C"Z+444' P DM u 0@Hb 4Y]4%z4?@K>HsH ` 74])4 +444( PHxHz X E  M e6?< *H  7]58#4?}@K>+444' PH|Hh D  M6? *Hy 79]5#R4?}@@K>4‹""C "+444' P DM 0@Ha 49]!4#b4?@K>Hg4 k?7?4_)7?i!0@@4z4P@4z4z@7?i@H7?iK>7k?7?4_7?i @@p4z# 7P@h4z4z@ 7?i@7?i0K>HP7hP@4zK>K?1K?)K?!K?K?K? @O?HX4EhX@4zK>@`4z4p@`4z+4& X @84z4@ 4zK>@4z# 7p@4z+46 X @4zK>@4z!; 59p@x4z+45 X @P4zEK>@4z! 5p@4z+44 X @4zK>k?ok?7CKZ `7$`@4@@4 |  | dK?YK?@O?HwH _K?Y _k? $  Y@@7?@ @K?@ @k?ok? k?k?k?!k?)CB77$#7W7x*444Z44^4\` _#Z J4~V#4T%jc@ V#"ςpK>@%`߿ ($% @?%B60B4 6046B64A`_ (@B6` @%4%Bc6 `$] jB ZB`_ (6B6 $` B6cĂ B6 ( r4~4^4T @!# @#B6 ( E84!4ˀK>قb :@$B@6 86b?@ ZςK>@ @Bc6 c@ "B4@<]6@#Zǃ 4^#R4K>K?)K?!K?K?K? @O?@!R`!R`߿ (7$ "`/B@??BςUK>6?k?1`_ (@B@7y*`&  @7g*4 `  *4xK?1__%4 4@?@ςeK>ςUK>ςEK>ς5K>ǣoB@4\ςK>ˀK>ςK>ς}K>ςmK>ς]K>ςMK>7@*c  @7%|@b:/4AςK>ˀK>ˀK>CW 07\ *7C?@4@k?ok?k?4?KwKxKy1 h x W W  araX4 P6? D X Ҥ `6 e4c_7`@ V   ֠ 476 m7 ` aH4P6? X ҃7 @67 D_4B`@ X  v 7ր 4\6 m7 7@ } Ku1Ka5kuK| kbK?YK?K?@O?Ku5Ks5  k?k?ok?4$k`Ky1ky77z"_}kyk|@4Z 4bHkz4V b(k`ؓ0k`ؓ0k}4|K?YK?@O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K>4'k`1K17Hk?K>7$7k? 6 4%Kt1 J4 0kj145_474k|1K 4#C!0@K1Km hkKn hkKo؍%KbKwW%% @_4K1 8kkhkh1K1Ƀ& B4ZU&B&6 (4 0Z4 kv #*K}1 4 ZB :K?"B _4"KmA4 44 84 ?4z "5A ?5I:4!51KyQ] - BKJ:M A !Z@0 6*61 J:@?}6*ku1 6 kp1kjAW 24z "5JAW ?5JI:* 4 KyQE * BKwI:M ) )`05+5) I:@?}5 6 46* #:@#K?@&Kq1 B &rKrB__4&BKa49ky4@+j_}5YKC@0Ka14,@0kl1Ƀ&4 t&C4= C4vS'"C,C+C+k1Ku16 kj1 (kK1ɉ@z C4Z C J7`8k1 C?7C ?7k:K1" M 6P:WK1Ks16k1KwKx ( 8_4khKKw (k1̟4Kmؑ0̟7kr1 4hkq1Kh1 BK|1Ka? \ H4:@4Y`MY@M KzKd k}k`1Kd144~kp1Kv16k1A! IW 50kf1Km1 !7? CKa?l 84:@#HIWMI7@@IWk? <49CHMMKzKb ksICkc1h4~ "@7kb1 kh1M1KzKeK? k}K? I_ID  44Kz1 :7?Ka? H"4:@M6`MYKzKx kxIZkz1@0tt4~4Kq1 Kl1 Ka?4:@C 2"HKwL6@+Krk?"6CHLk`1K17kz17e"ke4~Kg1 zKqKa? 84:@!H50L5W(+!H5pL5Wkj1X4~C4 44 04 k1K|17kj1_=kjK1ɋ57Kp1 8@Ka?"H4:@6L5Wkj1@ 8t4~`4545+ +Kf1 :Kv1Ka?"| H4:@L6yMKzKa ku4~Kr16Yky1ɀ "AS I 5Iki1Ke1 8@Ka?#<HIw4:@L=79PLKzKx ki4~ 0@K1ɉA*7ka1 kj1LuKzKd ksK? K? @ -IId  44K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ko1 :7?Ka? H#4:@Le7`LKzKn kl@0tt4~4k`4k`1k` "k1Kt16ki1K1ɉ Ky1 8@Ka?!H4:@5LM5Wkj1@ 8 t4 ~k`d7kn1 km1k?7K?k?_ Ek?K?Y@7?@ @K?@ @744_774666x77Y7!4=74 44477w4474 b6b:b8b<b>b@@6 @P@K?@ @Ku2Ks2 k?k?o_4 (744|K?Y@O?_m4 | 274  wM4z`u4|@ @K?@ @k?ok?k?k?4@4744z  | f7C 04Hw7$Ԁ2_4?gHy@7HsHz d  thu7K?YK?K?K?@O?_e4 7Hv7H}m |@ @K?@ @k?ok?7CKZ@ M1KD?4M4zK?YK?@O?@ @K?@ @k?ok? k?k?k?!k?)KE7C7$ 4H 44H?H H!2Hz 4KH r F84M@54?}@]HM@]HK_MA@507G5?/KH d04 g4 sHHz MKE?4 dH @HH@?@ g4 vK>K?)K?!K?K?K? @O?@ @K?@ @k?7Kv k? Q7LK?K?Y@7?Ku6qKs6y k?k?7K1 kz1_4k|1K?Y@7?k?oKs1 (7C_E4Kz1( \_4+~4= k?Kx1Ka?k?C4:@ 7w"#<2@7w#L 79_-4K>@O?k?ok?7C@04_4z 7_4z4K?YK?@O?Ku4!Ks4) k?k?ok?7# 04 _E4zȜ@_m4y7 @_4z4K?YK?@O?k?7Lk?7_]k?k?K?7PMK?K?YK?@7?@ @K?@ @k?oLEk? 077c0K?#7@N 4zK?Y4|@O?k?/,/-/.ok?97C4@"(k?@"K?B 4Z":cr@x4"6p.`7?a \ &00N8E&E_7?aa"#\7T. . 7?aK? ''001n0N 1A 'I9 @B7`!7?a$'('(08G'0G0N9E'8E0 8_7?a4K>K?9O?1/0./0-@/0,7:B4` K|1ˀK>}K|1mK|1k?ok?_4(70`"K?B4z04K?Y4|@O?k?o@ MKC `?4zK?Y@O?k?ok?7DKZ7#K]KS } `@K_77? ҕu B p4@ P4HK_4xKVB 0  H4ˀ K?YK|1?HK?YK?@O?K|1?@k?o7C_4 7 K|1Hwk 4 K?Y@O?K\K @_K_@KK_@K_K @kK_KK  P4@ K6? \0@4@KWJJ@  k?ok? k?7DH7k?!4Ak?)!@7HK4KK?) B @K?!!@H H? J@@ _h H(7_] h( HH(6 h4H( @Dԃ DK>K?K? @O?K|1A4K|1H(4h 7A4eK|1 `BKW7`2KZ( Y CӳK@ˀ@k?7_ 4 0K?Y@7?k?o7CKZ@ _@M4zK?Y@O?K_ KW0Y j Y@k 0K\K ??@@4@K_0?@kY0k?ok?7CKZ0Y 07$K__h0Hz0D?@K?YK?@O?@K\0k?ok?7D_ e4@ 0744|K?YK?@O? d44h d ` `Ah`0 h|8`}4|Hw _ ڋ?Mh|(AHz8`54|k?ok?7CKZ0@ _KD?4Hx7?`2H( A\4?@LUHz(_}HzAHz8L%4zK?YK?@O?k?oK_7#C 7ˀHk]Ks1 "LM6k|1Ky1#K|1K?Y@O?k?74_-k? BK?_ 4 @@(K?04K?Y@7?k?o_u7Ck?Hw4HzC_JJ 8  k?i4 r@4z "@K>AX4z 4z_5K?4K>@O?7?a@4z?@H|C?4z4?w4zK?a??47?iA4z?M@%4zk?ok? k?7D_ 7#k?!H44@_ Pk?I4 b4"4@4y"K>A 4"x `HC@0C4!(@H76hK_KW"6A "47?I@4!4H@94  0@K?!4_m4!X@A4!:K?I04 }4A4y?GHK> `7?I@4 @HC<4 p@K?!4_e4 P@A4 2K?Iz04 z@ `4K>K?K? @O?K|1?@7?Ik?ok? k?7Ck?!_%4!7Hd@4䃟 4? 4_!:AD40!74z@4HzKW4@KTA  z4HzK_4KSA  !*H_4zA4P4Ke1?HzH_E4zA4 jK?!@4z H74z_U47044Ke14K>K?K? @O?Ke1k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>7C_m7$k?aHt4k?B4&44`4 4 4 4 !444p4r@4z"B HsBu "HK?_4z!HtB@!:_(k?a HQ@* ?H@R @ (K!" HzK_5 PKYA ?  ˀJG!A 4z!"K?a04 4K>7?a4zA`4 ‚K>HtuHs <4<K|1?@pK>YO?@AT4z?u@0K>Y@0#@ 7 `K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>k?7KB4`@_ @4r`@`@ bhK>4 4! 8?@@04K>@7?4Š44_g44Ƌ :K_C0C4074@7??E@54#7 k?o7C47?@4 @K? #<p7< Hx8@4z H@HzK_KWHx8A  44K>@O?K|1?@4Ku4Ks4 k?k?ok? 7#k?4k?Ak?! (7K|1K>K? @O?K?K?4@HK?!HK?_ 4 |A4ˀ}K>k?ok? k?k?k?!k?)k?177D k?A4H! JHC4܋: *7hK?AAd4Z!4`4H444 rHCH @" @H h 7hCAK?A?HK|1"6 `K>K?1K?)K?!K?K?K? @O?K|1ˀK>k?ok? k?7D77%A74zA4!r@ZHC!b7hC9Ad4z!BHKv <4: k?!L QHdK?!74Q7 r C4\ 4 4Hw 2C4 #7 A4z4K>K?K? @O?K|1 \4\ K|1k?ok? k?KW67kVB6kBB47D7w#и"H64`xB24rb"HKA#7KSA a "4_40 `K>ق#@#"ӽc4 7?A \$A00N8E$IE IR\7Ӆ ] HB3Bց ?-֝ ӵ?@ Hg?HKA"6K_At !4HKVKYHA4 6 !p4Hˀ a4 8 B"6].K|1=@K>HK\"6K]At  `44@\@0 `K>K?K? @O?K|1?@4K|1?@]HK|1?u@uHg? \E4\0 k?ok?k?7DAX44 87Ke14K?YK?K?@O?444_4yKa!@HK_"6KYA\ ? 0Ke1 HKW4xKTA  4HKS4K\A  (@AP4z4Ƞ4Ke14zA@?@e4Ke1?4z=Hk?ok? k?7CA044 x7Ke14K>K?K? @O?Ke1! A(4?4(4444z_=4K?@HzKW <48KTA 0Ke1?=@HzK]4K\A >+4HzK_4XKSA  A44_4z ȼM4A@4 k?!Ke1444z_7Kx @HzKVKDK?!A  4HzKC4KWAt  (@AK?!4Ƞ54Ke1K?!A@?@4Ke1?K?!=Hzk?oK_4C h7C4Ћ7 7hz_4z z4z_4 RXK?Y7h}_4z "4z_q404K?Y@O?"|6|k?ok> k>K_47CC"7hz4_4z%7HzKY#7K]A %r47>i_=4z%74K},7hsHz#KTKE A 7,44z_y@$x7@4z$X7_4zk>!A4#(7444z_e44_ 4z 7@@4z7"@Hz"|K_6xKSA  "4HzKYK]K>!A *Ƞ`K>!47*7hCҕ6?{4?#\7U Ke1"RA4"z4Ke1"b4zKe1"B4zKe1""4zKe1"4zKe1!4zKe1!x4zKe1!4zKe1!h4zKe1!b4zKe1!BX4zKe1!"4zKe1!@4zAK>!Ke1Ke1=oHzK>!A@Kt=@HzKV4@KUA =+4HzKU4KTA A444K=K>K> @O>Ke1?4u7>i7hbHz <KUK_ A48<@44z@@?%747hdHz \KVKW 4X0A0@<_+44z@@>7u4Hz7hw#KBK] A7P;+44z@x@=747hxHz"KDKS d A6p;o+44z@@=U7E4Hz7he K\KX  Ah4:+44z@H@<747hHz KAKY ! A4Ѓ:}@44z@@<%74Hz7h| KAKX  A84:@44z_@;74_4z;e7HzKT4 K_A 9+44z_i@:747hvHz K\KW A409+44z_@:]74_i4z:57HzKS4 KEAp 8+44z_9@9747haHz KBKY " A4P8'+44z_@9-7_4z9 7HzK]4 KDAH 7+44z_@874Ke1844zKe1#=7"|%6ek?ok?K_47CC!7hvB?4bcz4fCh@HzK\KAHx8A H< #@4H7hyKxCЗ"6?HzKW#7K]AP "4HzK]7a'KT $ A "4HzKU4KVA "ˀ44#7huBӟ4`b4dBrHzKU4KBU A`@"H4HzKVK\Hx8A X "04Hd4hxKw@_ 7?HzK_"6@KYA ` ? !4HzKY7b'KS D A  y !4HzKT4KUA !44K?YK?@O? 4K|1?@HK|1?@HzK|1?e@%HzK|1?=@-4 \4\K|1>@HzK|1>@HdK|1>@HzK|1>@5HzK|1>]@M4 |54|k?ok? k?k?k?!KW47Ck?1B7%"44?!4_#:4%4! @@4z 87HyK34K=  44K>K?!K?K?K? @O?Kg1?4HKg1?4 HKg1?g44z4z@H4?%7?44Kg1#@HH4X   A84?@46h|4z_e4>]7HzHA X4T>o+4H4 4K?1_4z=746ha4z_4=7HzHA 4L=+4H45 6hv^4z= 7@4z<7^4zHzC_4 (7K?14z_44 "4z@x4@@84z h7^4z H@HzK_4@KUA  Kg1HaH4H?  <@#HzHAP7P<_+4HzHA4 H@HH4X   @t44Kg1HvJ#7 J  HzK]KWAP :+44z@ 4:-7H4_ k?ok> k>k>^7Ck>!Hx4z4C_ k>k>)4``з4r@4 4"j7>@4z"(74@$407^4z"k>14z@ P4HzK_4KU@ $H9^4z@44HzKY4@KBY A8@$44?^-4z_4z#7K>1^4zK>K>!^4z#P7(4zHzKT"6K_A( $4H|7h_4z"7??K>4z4‚@J4`:4䀶 *@4z"P7Ȁ(4z6?4? 4P +Kf1#\7F`4@4z>74@04z!7Hb@Z4U>@K>K>!^e4z!(7@4z>M74He@@0@` 4r@ 4!7>@4z x7Ha@94 *@4z=}70444z^-K>)44K=K>K>K> @O>Kf1?4HvKf1?4X4zKf1H9^4z@4??4HzKf1?454?@ 4z>7H|4;@Ȁ4zK>!7>_4z>}7ȀU4zKf1>_4UH|HzKS#7KF@, >7+4Hv6hf_4z=7@He4hw_ Y4z=u7HzK]4@KE@ =+44z_E@=77#<7&k?oKW7CB4X x4‚@ 4@ \4\K?Y@O?K|1 @K?Y@O?6h|_ 4z04K?Y@O?7}$  " <K?Y4<`@O?HzK_KY@ ? ?+4HsK?Y6tˀhtk?ok? k?k?k?!k?)k?1KT7C7$B4 4@4H4 44@4!Hs6aha@?! b HaH6? !4@@<4!hK|1Ha"H7? !4@@4 K|1@4K>K?1K?)K?!K?K?K? @O?H^4H7? >_44@@4>?4EK|15K|144 @4>HsK|144@@4=HsK|1k?o7Ck?^4!HtB4: rK} H@HzK_#7PKW@  p4Hs6uhuK?@p4z J4z^404 K?YK|1?HsK?Y@O?k?ok? k?k?k?!k?)k?1k?9k?Ak?I7DKZ(4?KAKF7% @4P!z4 HC"4" 4'4!<4 @!^ e4 4 _4!@^ 4Ka7I7? U!4@@l50Kk175|K>K?IK?AK?9K?1K?)K?!K?K?K? @O?Kk1`?5|mH|m5|IH 5@   H!"7hHC 4c>@HKB4RKH  @ @!J4 !b!\u5K4 8@HH@5>@Kk1@ 5`?H5|`:HK_58pK]@  :4 4_ @>}7}5|Kk1`?4U5|Kk1`>@-5|` !<`05+5|k?7^@04K?Y@7?k?ok?k?k?7%7D^E44!4HC]Ӻ4 pӿ4`A4ra @ L4!7444_4y7! !j!"`# 044K?YK?K?K?@O?Kf1?@@Kf1?u@(H^4 @@4 p@^474^]4ܞ@ܞ4Kf1ܞ4ܞ4_ U4>}7 P@HK_"6KS@   Kf1HH=H? 6?= HKY4KE@ =+4`>@HKW4xKBW @ |@=+4HK\4KS@ |  @`K? @O?HzK_KY@d ?  4ˀK>K|1?@}K>k?ok? k?k?k?!k?)k?1^7C4 7K|1K>K?1K?)K?!K?K?K? @O? @HzKW4pKT@ "ˀ4zH|8k?A@4 h|8%K|14^4z>@4x^Y4z>@4& 444z^U@>@@H4z>m@^4zHzK_77K]@  44^}59HuB>%@4|^94z=@Hb4AhaK?A@\Hz8he84z^}4ˀ]K>K|1>4z5K>K|1?4 K>k?ok? k?Kt7CK_ C4€@b4`RKe26?? 4!z4ăD!4҃"4؂"HzKU4PK]@| #44z_-@"7HzKT4RKY@ 4 #Z44@@#Xk?)Ke1Ke1 4Ke1 h4Ke1@K?!!:Ƞ84 47hb@_4` p@HzKS#<78 KW@ ?+4Hu6Ƞxhv4b? RHzK]#70K_@$ >+ȠHu |4e@4K>K?K? @O?7h|@4k?!444z^m7 H7HzK_KVK?!@  ȠKe14 d8 HzKWИKU@ =o+@HK?!m4Ke1>4M4zKe1>w44444z^7 x7HzKAKBK?)A @H@ (@@XK?)4Ƞ4Ke1@(K?)?@4k?oK_4C!7C4 Z7hC4 j7h}^4z b(K?Y_4z04K?Y@O?_E4z?@4z^ 4?@47hs@H4z?e@4z^4?=@-4k?ok? K_47CC 4"@4z!744^4z"7?94^4z"h@^4zk?K?9BP@HzK_4PKV@ 0Kd1"@_4z7!@HzK]4RKY@H = !4HzKYKWK?@@ #@@PK?h44>_4@4z2D44K>K? @O?Kd1?404zKd1?4xK?9Kd1?44z4=4?C4Ȝ%4Ȝ4Kd1>]@@K?>4HzKT4PKU@@ >+44z_@>e7HzKS4RKT@ >w+4K?9&>4HzKU 4K]@0 >7+44z_=@=7HzK_4RKC@  ȀE4EKd1Kd1='4 4k?o7C^4拀 4^4z @_4z p@HzK_#7 PKW@  @44z^@04K?Y@O?K|1?@4zk?oK_4C 7C_ 4z BHK?Y_4z "4z^q404K?Y@O?47 Z7hsBz4?m@^4z?@]4z"e6k?ok>k>7$7C^4!He@4 Z4?k?K?4Y4z^4'(7#<7<4`` 4r@4b"4B47?4H^4z?5@K>YK>K>@O>K|1?@4K|1?@4K|1?u@ 4PK|1?M@04K|1?%@4K|1>@4K|1>@04K|1>@@4PK|1>@4K|1>]@4 K|1>5@Hd7??4?#\7_ `4HzKU#7KA@`5 ?U@ˀHHdHzKT 4KU@ =o+44 4HzKS 4KT@ ='+44 `4HzK KVKW 8 @40<+44P*@4`<+44 HzKx KAKY @ ! @h4YHzK\KW@ p  844z^404 K>YK|1?4zK>Yk?o7C^!4!@^A4z!b4^4z!@@HzKY"6 PK]@ !4HC4V HzK_"6KS@ x   44H|7ha@4z JPK>7?^4z "4z@x404K>@O?K|1?@HK|1?@4k?oK_4C!7C7haKt BHzKW#7KV@ "4HuB4`?@4r_`47?i4^4z!K} "K?iHy]6!ZK|!@@HzK]4KC@ (}  jˀ4Ks`?@HzK_4bKU@  ˀE+`K|1 K>و jKv ZHzKS#7 KBS @ @ ˀ K|104K>@O?K|1?@HuK|1?@=+`k?ok?7CJ k?A2@4!@w4!^4z 7Kd1^I4z 7^a4z4^ 4z X7^i4zk?K?@@7 hKd1@K?^4z@4K?@4y Kd1@44K?YK?@O?k?7"k?6 O4 P4K?Y@7?H? @@K?ˀK?Y@04k?K?_m7?+@K?]K?YKa?#4:@J7 KI@K?Yk?ok?7$ 047C]4 d74  `K?YK?@O?k?7k?]4k?K?_%7K?YK?@7?k?o7CKKZK4zK?Y@O?k?7K_k?K@K?YK?@7?k?oK_777C`7 Y7@  y]Hz |K?Y4|@O?K_@@k?ok?7CY H7$H_4z B4K?YK?@O?KY@HHzJHHς k?ok?7C7:Jek?74z_-7 "4K?YK?@O?HzJ=K?ς dk?ok?k?7C7X @7%HH  _m4z *ˀK?YK@HHwA`@ "_P4_?HvH 7   _6?` H|H w <  6?7?HtH    U7?77?HzH  z X HsH S y  4HwH JHHHt 4hsK?YK?K?@O?k?ok? k?7C7%k?!J7Hu7 _4z0ˀHwA2 }P7?Hb W   B  9_6?` Hsw   VHt6?   !7?H}   Hs6? D z   \=7W?HvK?! J4H| ha4K>K?K? @O?k?ok?k?KU7$7C7_60ˀzHwA2 }P7?Hb W 6 B  9_6?` Hsw 6 VHt6?7  !7?H} 6 Hs6?7Tz   \=7W?Hv  4Ha4"hbK?YK?K?@O?k?ok?7C7:Jk?Hx7  _4z "4K?YK?@O?HHw J K?Hy $ ςhzk?ok?KT7$7C_60ˀbHwHy 4Hs6Hz _ H}7huK?YK?@O?k?ok?k?k?77C7&` H x` Ju@4z_40ˀ4?AZY?P7??HHz  W  Y \_6?` HH}  t 6? HHv 7?  " E 7X?HHa:   } 7?HH|  Hs d 4 dK?YK?K?K?@O?k?7@@K?Y@7?@ @K?@ @k?7@@K?Y@7?k?7@0@K?Y@7?k?ok? k?k?k?!7D@"7%@"Kc @4&HyJ4 bHc`?Hy" ZHyJ4#j( 4$`4J4 āHz]4"@7J47]4 |"74N=4( 4'`4J4 gJA47]4!`744N4Hz @J5@ fJ47]i4 | 74N4K (@KJ4@@K 0kcˀ0K>`u@ ( 4<`H|ˀK>ˀK>ˀK>ˀK>KeH jKJ4`H@HH (@KJa4_@H x H|K>K?!K?K?K? @O? _ : W ]  SV@ \CT x4@ӿ< 77Z<  @?@@Ku4Ks4 k?k?o7hd>he>hf>hg>hh>hi>hj>hk>hl>hm>hn>Ka?H&7$7H7 %4%0Kh2Kj %IYJ5 eIJ@?IY@%zIG@4^"!@J1475s4 K?K?g~4` k?k?77h_5 @H4 D 4`5@ K?K?~  k?k?77h_]5 H?w5@$4Ja4!| 5y@ 07IY@ 7@ 5:75:@ 77JA5z7J)5 5 K?K?~4`  k?k?5y7@ @7!| 5y@ 77@ 55y@ 7JQ5:7K?K?~4`  k?k?A774 tp4 `55775)76 7,?5yJ5!5yJ5!45@ H5X 75@4!I  @5 @x4!X@ ?5!2A7 ("5)A7 ?5)>E@  ˀ84~4 ! M5`h44~Hb>YHn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>˄}hmhk?ok? k?k?k?!k?)KG7C k?1@84zHc`#Hh( H0"jHf$4HsHw d Hg$XH: GJK?1DRĄX@H}7G? ܋ #D!HHt( Hu0 刀 6# @#*Hx7G? Ջ#D?Ht(Hh  Hh#Jz HJiK?1?-HHa Hy' Hc "Hx C HwH Hh!J HJ K?1>HHb H}G Hc!H C J K?1K?1_7Hs(76y1Ht76y?Hb0 7 E 7@=Hyˀ8K>Hx Hc!H CK>K?)K?!K?K?K? @O?ˀK>_M@\E@_-@\@_ @\ H _@\E@_@\Hˀ K>_@\H_}@\ H _]@\@_=@\ G @4ś7 Ş'H| ˀMK>_@\% C L҇L HzH ZD:D  " @6# @7 #< @7<@#\ @7\`# @7"| @6|# @7" @6k?o | k?\4zЀ C @\4z C `@\}K? C 0@\M4z C04|K?Y@O?C8X7? (7W6 ?7@6?k?ok? k?k?@ 7E@ 8Kc2( 4$4J4 @( 4$`kd2JY47] k?! 7K?!4N4kf2 JU4zK|2K>K?K?K? @O?k?ok>k>k>7#7Jqk>k?K>4k?7z7k>k?k?k?yk?qk?ik?ak?Y@k?Q!7@4z X7J47]i4"`74z4N4k?Y7?7? k?7?7?!k?7?7>k?7>7>k?y4z@k?K>J7K>k?47k?QK>4k?K?k?K? k?K>k?yK?k?qK?k?iK?!k?aK>@K>! 7Ƞ4H @@H4H H 4 `4 KX @@ J 4c ? ``4@44K>YK>K>K>@O>H @@84H jH  X4 K_ @@ K:@  ?4?4J4z4 _ : W ]  SV@ \Ku5AKs5I k?k?ok> k>k>k>!7D4@KZ@" K4"p77>_=4 K>48bb@]K>7" K>4g44KE4!@ _ Km4H B4% # 7 *!]48 !H7 H(4 !hHz"H!hHz H!hHzH C   !`Hz H C h !XHz(h(H!XHz0 Ch0Kg2!40kw2!K4K=K4K=K>!K>K>K> @O>J4zK=_%@\}@_@\ _@\H_@\H_@\h(_@\ C J4zJ4 Ku3Ks3 k?k?ok? k?k?k?!Kd04%7C4&4tk?qKx29!:4K2AC 4 "7k2AC?7 8077k2AC ?7_ @( _?'k?qK2AC?=@>k?q4K>K?!K?K?K? @O?k?Ky 7?q_4>K2AKKu3Ks3 k?Ku5QKs5Y k?k?o 7hd6he6hf6hg6hh6hi6hj6hk6hl6hm6hn6ho6757$K?K?~`4`  ~k?k?7Y77Ny4#  7NQ4 < 49`I 4#P7DvF04Ka?4&4'4(4 4 F44z7q_4%H@u7q4k7q"Һ ߀ H@H5kA}"Ӻ |ߋ?5kA _85l5kAbZ zH"B ߈ RH5kA|Ӛ@ *"@ \߃?5kAa ` 5kHAx! Ѽ߀ BH5kAv! <ߋ?5kA|#25m5kAw rH!b <߈ JH5kAw@ "!: Ҽ߃?5kA!* `5k0 iȀ04_@-@_@UH_@@_@H_@%@_u@EH_U@@_5@H ` 5kKy29Ks21y @h@I57\}5!755M%5Kx29Kt 5IM7\5!0755M5Kb29K 4Ko295kw295zIM4 R44z7q_]40`i7q4I4z7q?4Dz4I4 "Kz Ky29Kw0J 444~Hb6YHo6Hn6Hm6Hl6Hk6Hj6Hi6Hh6Hg6Hf6He6Hd6@O6k?ok?K21 A04#\ ڃ `7K29Ky  M4Kw21 +`J Kz kd kc21K?YK?@O?@P@K?@ @Ku4Ks4 k?k?7KZ_K9K?Y@7?k?ok?k?7#7D 84I 47  `?44K?YK?K?@O?k?ok?k?7#7D h74 44I @7 `? ?4K?YK?K?@O?k?o X7\ x4I 77x7K?Y 04K?Y@O?"}6vT"6*  " < 6"6&g?  Y p _ 4  @k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=64 k>4K=ak>K=iI =k>K>K=q K=yK=K=CCK=4xk>cC 4yk>ǃC 4 `_#ªI}57J (@I 5!e6 J?@R4K=Y I56O \ 7#7K>K>5M54^K>K>4t_%566? 6@ 4CC*cCZǃCq> #ǣCr@$"K>7@ 5J>M@$jK=Q`$ZK>_K>7_4z@7>p֟t&a&i8G&qFq \ 4:(#7P64ǣ@ 4@ `4 @47`4 4eK=YIM5zM7I-5ZU7I 5:]7I4%7I457I45746K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>47@(5ycܥ@4\7@5Yǃq>4\7@59Eq>z?@ V47@h5ǣr4V7@04r4X77@4`47@4eK=QI56K>_K> 4 @K> @K> (K>J I K>K>_]4 0o4oAj6 o!:4  40 ! Ǐ@K>K>_=4 7k?I6Zk?K>76Yk?5k?k?yk?qk?ik?ak?Y_k?Q - K>6X_uK>5?575?~@6 M Ku3Ks3 k?Ku6Ks6 k?Ku4AKs4I k?k?ok? k?k?k?!k?)k?17$7C4 4Ka?H?4'4h " <߀ : 4! \ 4"?5 4 \5!7!4 Ka?4'H `Ӻ! \ 0@ `_Ӛ `@H `!2 < `  4?%4c 4K>K?1K?)K?!K?K?K? @O?_@H_@H!< 59p@H4ܞ=@_@m@MU@C8X7? (7W6 ?7@6?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK>76K>7I4K>4 K> K>y ` @ :C_ 4 4 r4V_ b4X R5)A? 8 (@ ( _8 ?5)K:: I94K?IK?AK?9K?1K?)K?!K?K?K? @O?? crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)? crt0: errno: tsd{}`{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{|{{|{}{{}|{{||{{}X{}H{{{{{{{{{{{|{{|{{{{{{{}0}8{{|{{}P{}@{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{}8P@H`(PH<@XD~$$$$ (@lH$discard-alldiscard-localsformathelpinput-formatinput-targetkeep-symboloutput-formatoutput-targetpreserve-datesremove-sectionstrip-allstrip-debugstrip-unneededstrip-symboltargetverboseversionadd-sectionadjust-startadjust-vmaadjust-section-vmaadjust-warningsbytechange-addresseschange-leading-charchange-section-addresschange-section-lmachange-section-vmachange-startchange-warningsdebuggingonly-sectiongap-fillinterleaveno-adjust-warningsno-change-warningspad-tolocalize-symbolkeep-global-symbolremove-leading-charset-section-flagsset-startweakenweaken-symbolredefine-symsrec-lensrec-forceS3keep-symbolsstrip-symbolskeep-global-symbolslocalize-symbolsweaken-symbolsUsage: %s in-file [out-file] The switches are: -I --input-target Assume input file is in format -O --output-target Create an output file in format -F --target Set both input and output format to --debugging Convert debugging information, if possible -p --preserve-dates Copy modified/access timestamps to the output -j --only-section Only copy section into the output -R --remove-section Remove section from the output -S --strip-all Remove all symbol and relocation information -g --strip-debug Remove all debugging symbols --strip-unneeded Remove all symbols not needed by relocations -N --strip-symbol Do not copy symbol -K --keep-symbol Only copy symbol -L --localize-symbol Force symbol to be marked as a local -G --keep-global-symbol Localize all symbols except -W --weaken-symbol Force symbol to be marked as a weak --weaken Force all global symbols to be marked as weak -x --discard-all Remove all non-global symbols -X --discard-locals Remove any compiler-generated symbols -i --interleave Only copy one out of every bytes -b --byte Select byte in every interleaved block --gap-fill Fill gaps between sections with --pad-to Pad the last section up to address --set-start Set the start address to {--change-start|--adjust-start} Add to the start address {--change-addresses|--adjust-vma} Add to LMA, VMA and start addresses {--change-section-address|--adjust-section-vma} {=|+|-} Change LMA and VMA of section by --change-section-lma {=|+|-} Change the LMA of section by --change-section-vma {=|+|-} Change the VMA of section by {--[no-]change-warnings|--[no-]adjust-warnings} Warn if a named section does not exist --set-section-flags = Set section 's properties to --add-section = Add section found in to output --change-leading-char Force output format's leading character style --remove-leading-char Remove leading character from global symbols --redefine-sym = Redefine symbol name to --srec-len Restrict the length of generated Srecords --srec-forceS3 Restrict the type of generated Srecords to S3 --strip-symbols -N for all symbols listed in --keep-symbols -K for all symbols listed in --localize-symbols -L for all symbols listed in --keep-global-symbols -G for all symbols listed in --weaken-symbols -W for all symbols listed in -v --verbose List all object files modified -V --version Display this program's version number -h --help Display this output Report bugs to %s Usage: %s in-file(s) -I --input-target Assume input file is in format -O --output-target Create an output file in format -F --target Set both input and output format to -p --preserve-dates Copy modified/access timestamps to the output -R --remove-section Remove section from the output -s --strip-all Remove all symbol and relocation information -g -S --strip-debug Remove all debugging symbols --strip-unneeded Remove all symbols not needed by relocations -N --strip-symbol Do not copy symbol -K --keep-symbol Only copy symbol -x --discard-all Remove all non-global symbols -X --discard-locals Remove any compiler-generated symbols -v --verbose List all object files modified -V --version Display this program's version number -h --help Display this output -o Place stripped output into allocloadnoloadreadonlydebugcodedataromsharecontentsunrecognized section flag `%s'supported flags: %scannot stat: %s: %srcannot open: %s: %s%s: fread failedIgnoring rubbish found on line %d of %s%s: Multiple redefinition of symbol "%s"%s: Symbol "%s" is target of more than one redefinitionUnable to change endianness of input file(s)copy from %s(%s) to %s(%s) Warning: Output file cannot represent architecture %scan't create section `%s': %sCan't fill gap after %s: %sCan't add padding to %s: %s%s: error copying private BFD data: %scannot mkdir %s for archive copying (error: %s)internal stat error on %smakingsizevmaalignmentflagsprivate data%s: section `%s': error in %s: %s.stab.stabstr%s: can't create debugging section: %s%s: can't set debugging section contents: %s%s: don't know how to write debugging information for %sb:i:I:j:K:N:s:O:d:F:L:G:R:SpgxXVvW:strip%s: cannot stat: %sb:i:I:j:K:N:s:O:d:F:L:R:SpgxXVvW:byte number must be non-negativeinterleave must be positive%s both copied and removedbad format for %s--change-start--change-addresses--gap-fill%08lxWarning: truncating gap-fill from 0x%s to 0x%x--pad-to--set-start--srec-lenobjcopybyte number must be less than interleaveCannot stat: %s: %s%s %s%c0x%s never usedbinutils/opt/binutils/share/locale%s: cannot set time: %s%s: rename: %s%s: simple_copy: %s?UUUUU\%s: no recognized debugging information.stab.stabstr%s: %s: %s %s: %s: stab entry %d is corrupt, strx = 0x%x, type = %d .debugLast stabs entries before error: n_type n_desc n_value string %-6sHdrSym%-6d %-6d %08lx %s ,`8TT h$°$h4PѴ@0HH%s debug_add_to_current_namespace: no current filedebug_start_source: no debug_set_filename calldebug_record_function: no debug_set_filename calldebug_record_parameter: no current functiondebug_end_function: no current functiondebug_end_function: some blocks were not closeddebug_start_block: no current blockdebug_end_block: no current blockdebug_end_block: attempt to close top level blockdebug_record_line: no current unitdebug_start_common_block: not implementeddebug_end_common_block: not implementeddebug_record_label not implementeddebug_record_variable: no current filedebug_record_variable: no current blockdebug_make_undefined_type: unsupported kinddebug_name_type: no current filedebug_tag_type: no current filedebug_tag_type: extra tag attemptedWarning: changing type size from %d to %d debug_find_named_type: no current compilation unitdebug_get_real_type: circular debug information for %s debug_write_type: illegal type encountered 8 ވ ߀ ۼ  < h ` ܐ ߤ ,Ph,DLDhhh@hhhhhhhhhhhhhhhhhhhhhhhhhhhh8hhhhhhhhhhhhhhhhlhhhhhhhhhhhhh       0Pp ,<\t <Hd ,Ll/0D//0D//////0D/0D0<0L0<0D0T0D0D///////////0l0t0|/0|//0d//0d///0</0|0d//0\0d0d:5x:94::9::::::7:78:8:8t:::::::::::::::::::::::::::8@l0? @l?H@l@l=T@l@l=@l@l@l@l@l>=?@l<numeric overflowBad stab: %s Warning: %s: %s N_LBRAC not within function Too many N_RBRACs gcc2_compiled.gcc_compiled.unknown C++ encoded nameunrecognized cross reference type01000000000000000000000;0777777777777777777777;01777777777777777777777;long long intlong long unsigned intmissing index typeunknown virtual character for baseclassunknown visibility character for baseclass_vptr$unnamed $vb typeFOO_vb$unrecognized C++ abbreviationINVALID_CPLUSPLUS_ABBREVunknown visibility character for fieldconst/volatile indicator missingmember function type missing__ct__dt__%s%s__%s%s%dNo mangling for "%s" intUndefined N_EXCLType file number %d out of range Type index number %d out of range Unrecognized XCOFF type %d charshortlongunsigned charsigned charunsigned shortunsigned intunsignedunsigned longvoidfloatdoublelong doubleintegerbooleanshort realrealstringptrcharacterlogical*1logical*2logical*4logicalcomplexdouble complexinteger*1integer*2integer*4wcharlong longunsigned long longlogical*8integer*8bad mangled name `%s' no argument types in mangled string ___typeNoSuchStrinG__::NoSuchStrinGbool__wchar_tI,HIXIlIIIIIJJ4JPJhJJJKK K<HlKXKtKKKKLgdgggggggggggggggggggggggggggggggbggg]gdgggggghddgb,eeLeipg^gcggggggbgelelgic(ggggggcggggdDggggamnnnoomopPppq|qmmmr|mms<mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmkkk݈݀ݤXޜT߀ߜ߸݀݀ޜݤޜX%s: 0x%lx: %s (0x%x) %s: %s unexpected end of debugging informationinvalid numberinvalid string lengthexpression stack overflowunsupported IEEE expression operatorunknown sectionexpression stack underflowexpression stack mismatchunknown builtin typevoidsigned charunsigned charsigned short intunsigned short intsigned longunsigned longsigned long longunsigned long longfloatdoublelong doublelong long doubleQUOTED STRINGinstruction addressintunsignedunsigned intcharlongshortunsigned shortshort intsigned shortBCD float type not supportedunexpected numberunexpected record typeblocks left on stack at end*global*__XRYCPPunknown BB typestack overflowstack underflowillegal variable indexillegal type indexunknown TY codeundefined variable in TYPascal file name not supportedunsupported qualiferundefined variable in ATNunknown ATN typeunsupported ATN11unsupported ATN12unexpected string in C++ miscbad misc recordunrecognized C++ misc recordundefined C++ objectunrecognized C++ object specunsupported C++ object typeC++ base class not definedC++ object has no fieldsC++ base class not found in containerC++ data member not found in containerunknown C++ visibilitybad C++ field bit pos or sizebad type for C++ method functionno type information for C++ method functionC++ static virtual methodunrecognized C++ object overhead specundefined C++ vtableC++ default values not in a functionunrecognized C++ default typereference parameter is not a pointerunrecognized C++ reference typeC++ reference in class with no fieldsC++ reference not foundC++ reference is not pointermissing required ASNmissing required ATN65bad ATN65 recordIEEE numeric overflow: 0x%08lx IEEE string length overflow: %u .debugbfd_make_sectionbfd_set_section_flagsbfd_set_section_sizebfd_set_section_contents%s: %s: %s GNU objcopyIEEE unsupported integer type size %u IEEE unsupported float type size %u IEEE unsupported complex type size %u __anon%u_vb$%s_b$%sshort unsigned intlong intlong unsigned intlong long intlong long unsigned int$<<lTparse_coff_type: Bad type code 0x%xvoidcharshortintlongfloatdoublelong doubleunsigned charunsigned shortunsigned intunsigned longbfd_coff_get_syment failed: %sbfd_coff_get_auxent failed: %s*globals*.bf%ld: .bf without preceding function.ef%ld: unexpected .ef .bb.ebstring_hash_lookup failed: %s%ldbfd_hash_table_init_failed: %s%ld=%ldstab_int_type: bad size %u%ld=r%ld;0;%ld;-1;01777777777777777777777;%ld;%ld;01000000000000000000000;0777777777777777777777;%ld=r%s;%u;0;%ld=r%ld;%u;0;xe%s:e%s:T%ld=e%s:%ld,;%c%s%ld=%c%s:t%sr%s;%ld;%ld;%ld=@S;ar%s;%ld;%ld;%sS%s@%s,%s#%s,%s,%ld=%c%u/0/1%s: warning: unknown size for field `%s' in struct%s%s:%s%s,%ld,%ld;%s%s;~%%%ld~%%%s%s%s:%s%s:%s;%ld,%s;%s::%s:%s;%c%c%c%ld;%s;!%u,%s:t%s%s:t%ld=%s%s:T%s%s:c=i%ld%s:c=f%g%s:c=e%s,%ldGSV%ld=%sr%s:%s%s%s:%c%s%s: %s: %s %s: %s %s: hppa2.0n-hp-hpux11.00can't set BFD default target to `%s': %s%s: Matching formats: %sSupported targets:%s: supported targets: %.12s %.4s%s %ld/%ld %6ld %s %s /%s: bad number: %s2.11.2GNU %s %s Copyright 1997, 98, 99, 2000, 2001 Free Software Foundation, Inc. This program is free software; you may redistribute it under the terms of the GNU General Public License. This program has absolutely no warranty. ? VSSSSSSSSSSVVVVVVVVTSDVVTdVVLVVRSpVVVVRVS,VVSDVVVVVVVVUVVVVVVVVVVVVVVVVVVVVTSDpd00\pp$@Dp4nw newdl deletenewdeletevn new []vd delete []as=ne!=eq==ge>=gt>le<=lt<plus+plapl+=minus-miami-=mult*mlamu*=amlconvertnegatetrunc_mod%mdamd%=trunc_div/dvadv/=truth_andif&&aatruth_orif||ootruth_not!ntpostincrement++pppostdecrement--mmbit_ior|oraor|=bit_xor^eraer^=bit_and&adaad&=bit_not~cocall()clalshift<<lsals<<=arshift>>rsars>>=component->ptrfindirectmethod_call->()addrarray[]vccompound, cmcond?:cnmax>?mxmin*szsizeof autoAutomatic selection based on executablegnuGNU (g++) style demanglinglucidLucid (lcc) style demanglingarmARM style demanglinghpHP (aCC) style demanglingedgEDG style demanglinggnu-v3GNU (g++) V3 ABI-style demanglingjavaJava style demanglinggnatGNAT style demanglingconstvolatile__restrictconst volatileconst __restrictvolatile __restrictconst volatile __restrictoperator operatorassign_type_ada____<%s>global constructors keyed to global destructors keyed to import stub for statictemplate <class> class()%d.e'falsetrue0JArray1Z__pt____tm____ps____S,_GLOBAL_{anonymous}___imp____imp___std____sti___ virtual table0123456789Qt__thunk_virtual function thunk (delta:%d) for __t__vtbl__::[]unsignedsigned__complexvoidlong longlongintshortboolcharwchar_tlong doubledoublefloat%xint%u_t-2147483648U...__ct__dtT%d--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument %s%sCannot allocate %lu bytes after allocating %lu bytes undocumented error #%d???UUUUU\Ф<ԈӠTP ոdްX0߀|`0Allocation failed.Expected ?std::Unexpected end of name in .::Unexpected character in .Unexpected character in .Zero length in .Internal error.Unexpected end of name in ._GLOBAL_(anonymous namespace)aN&=aS=aa&&ad&ancl()cm,co~dV/=da delete[]de*dl deletedv/eO^=eo^eq==ge>=gt>ix[]lS<<=le<=ls<<lt<mI-=mL*=mi-mlmm--na new[]ne!=ngnt!nw newoR|=oo||or|pL+=pl+pm->*pp++pspt->qu?rM%=rS>>=rm%rs>>sz sizeofoperator operatorUnknown code in . [nv: [v:Unrecognized .guard variable for vtable for VTT for typeinfo for typeinfo fn for typeinfo name for java Class for non-virtual thunk to virtual thunkcovariant return thunkconstruction vtable for -in-Unrecognized .Error.in-chargenot-in-chargeallocatingin-charge deletingUnrecognized constructor.[Unrecognized destructor. [::*Non-pointer or -reference function type.complex imaginary Unexpected character in .signed charboolchardoublelong doublefloat__float128unsigned charintunsignedlongunsigned long__int128unsigned __int128shortunsigned shortvoidwchar_tlong longunsigned long long...Unrecognized code.Non-alphabetic code.restrictvolatileconst [extern "C"] , Missing function return type.Missing function parameter. () Template parameter outside of template.Template parameter number out of bounds.ibi iii ll ii i Unimplemented.falsetrueUnrecognized bool constant.:(stdstd::allocatorallocatorstd::basic_stringbasic_stringstd::stringstringstd::basic_string, std::allocator >std::istreamistreamstd::basic_istream >basic_istreamstd::ostreamostreamstd::basic_ostream >basic_ostreamstd::iostreamiostreamstd::basic_iostream >basic_iostreamUnrecognized .Substitution number out of range.string literal [# [#0]_ZMemory allocation failed. /opt/binutils/share/localemessages/.moCPOSIXLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_ALLLC_XXXLANGUAGELANG/locale.alias/opt/binutils/share/locale:.riso8:X:;@;;P;;X<<< <4<8L>P>p>t>>>?,??????@@4@\@`@@A<A@BBBBC$C(C\C`CCDDDDEHELEpEtEEFFFFFFFFFFG8G<GGGGHHHHIPITIIJJL@LDMMN NNNPlPpQQQ<Q@QQW WW WYHYLY`YdZp Zt[4 [8\\ \\^4^8aaddflfpgghhlllxl|mmmmo\o`oot(t,t8tlv v zp zt{${(||} }l p    (,x|04     48hlx|LP 04ptPT8<\xX @\$LP0 $\b`bLP`d48pt(,DHLP\`8<X\,0 @DHLX\8<ǴǸ $X\LP\`LPhl\`̴̰ ϐϔ $< @  ڈڌdhh l  $8<\`|48 P Ttx,0PT@D(,<@$(8<$(|,0x|HLX\\`x||TX<@hl d  h t  x   X \                PT,0X \ (T Xhl $   ! "`"d""""&p ? ? N P\ R S X, \ ^ ri 0l nX np q q u u vT }  l      D    "L   ,       , l      ,     ˆ  ( D Ŝ Ŵ  , t , H ӄ  $ p  ٘ d       8 p  X  t D 8   \   t      T     X P H " "T # $ & ' ) *h + /t / 0 0| 2 3L 3 5 5 6\  67 7 9 : ; < = = > @ @ B B C G t<    ` \ t   D              @4$Revision: 92453-07 linker linker crt0.o B.11.06 981204 $/usr/lib/dld.slERROR: mmap failed for dldERROR: mmap failed for TSDbug-binutils@gnu.orgbug-binutils@gnu.orgalloc, load, noload, readonly, debug, code, data, rom, share, contents--redefine-sym--redefine-sym/--add-section--change-section-address--change-section-lma--change-section-vma--redefine-sym--set-section-flags--change-section-vma--change-section-lma@4@4@4@4@4-----.b..(.@.X.p...,x,X.j,F.,h,I,I.i-K./-O-(O/-8p/ L/0G/H-HR/`/x-XS-hg-x-N-F-v-V//W//////00 ,x,X,F,h,I,I-K-O-(O-8p-HR-Xs-hS-x-N-F-v-Vinfo->units == NULLdebug.cname->kind == DEBUG_OBJECT_TAGdebug.ctype->u.kclass->id > info->base_iddebug.ctype->u.kclass->id > info->base_iddebug.ctype->kind == DEBUG_KIND_STRUCT || type->kind == DEBUG_KIND_UNION || type->kind == DEBUG_KIND_CLASS || type->kind == DEBUG_KIND_UNION_CLASSdebug.cthiseh_throwCVlong long unsigned intlong long intlong unsigned intlong intunsigned intintshort unsigned intshort intunsigned charsigned charcharindx < BUILTIN_TYPE_COUNTieee.cindx < BUILTIN_TYPE_COUNTieee.cts != NULLieee.cinfo->pending_ranges != NULLieee.c! ieee_buffer_emptyp (&info->vars)ieee.clocalp == nt->type.localpieee.cinfo->type_stack != NULL && info->type_stack->next != NULL && ! ieee_buffer_emptyp (&info->type_stack->next->type.strdef)ieee.cinfo->type_stack != NULL && ! ieee_buffer_emptyp (&info->type_stack->type.strdef)ieee.cvclass != NULLieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULLieee.cinfo->type_stack != NULL && info->type_stack->type.name != NULL && info->type_stack->next != NULL && info->type_stack->next->type.classdef != NULL && ! ieee_buffer_emptyp (&info->type_stack->next->type.strdef)ieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULL && info->type_stack->type.classdef->method == NULLieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULL && info->type_stack->type.classdef->method != NULLieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULL && info->type_stack->type.classdef->method != NULLieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULLieee.ch != NULLieee.c! ieee_buffer_emptyp (&info->vars)ieee.c! ieee_buffer_emptyp (&info->vars)ieee.cinfo->block_depth == 1ieee.cinfo->block_depth == 1ieee.cinfo->filename != NULLieee.c@4@4@4@4@5@5 @5@5@5"@5*@52@5:@5B@5J@5R@5Z@5b@5j@5r@5z@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@6@6 @6@6@6"@6*@62@6:@6B@6J@6Rs != NULLwrstabs.cinfo.pending_lbrac == (bfd_vma) -1wrstabs.ctag != NULLwrstabs.cinfo->type_stack != NULLwrstabs.cinfo->type_stack->fields != NULLwrstabs.cinfo->type_stack != NULL && info->type_stack->fields != NULLwrstabs.cinfo->type_stack->index > 0wrstabs.cinfo->type_stack->fields != NULLwrstabs.cinfo->type_stack != NULL && info->type_stack->fields != NULLwrstabs.cinfo->type_stack != NULL && info->type_stack->fields != NULLwrstabs.cinfo->type_stack != NULL && info->type_stack->methods != NULLwrstabs.cinfo->type_stack != NULL && info->type_stack->methods != NULLwrstabs.cinfo->type_stack != NULL && info->type_stack->fields != NULLwrstabs.ch != NULL && h->index > 0wrstabs.cinfo->nesting == 0 && info->fun_offset == -1wrstabs.cinfo->nesting > 0wrstabs.cinfo->lineno_filename != NULLwrstabs.c@6Z@6b@6j@6r@6z@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@7@7 @7@7@7"@7*@72@7:@7B@7J@7R@7Z@7b@7j@7r@7z@7@7@7@7@7@7@7@7stXXXXXX{H{P{x{{{{{{{| ||0@|8|`|h||.::.::.::.::.:: type_info node type_info function.::.::.::.::vvwwwvwww w(w0w8wHwPwXw`whwpwxwwwwwwwwwwwwwwwwwwxxxxxx x(x0x(x8wx@wxHxXx`xXxhxpxxxxxxxxxxxxxxxxxyxyyy yy(y8y@y8yHyPyXyPy`yhypyxyyxyyyyyyyyyyyyyyyyyyzyzzzz z(z z0z8z@zPzXzPz`zPzhxzxzzyzzzzzzzzzzzzzzzz{{{{{{ {({0{8{@POSIXLY_CORRECT:  08@HPX`hpx (088@HPX`h(px (08@HPX`hp@  0 08@HX`p(  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000@7@7IIr$.$?H`PSGlitS}X,RP\?PtD SNNii , P_\>DP?^4B@t<} _<"dStT  _T"L^X\_l^D^|r Ŵ_$_^d^XDB,lq_ iHi0ix,\^q^q^i`i_np@^L_T?nXuuvTq,l ,ˆ(DŜ,t,Hӄ$p٘d8pXtD8 \tTXPH""T#$&')*h+/t/00|23L3556\779:;<==@:@:@:@:OSSSS0S0>binutils/binutils-RUN/opt/binutils/bin/objdump010075500000000000003000010000000732753200000203150ustar000300000000000000@Gk@7XxxP((((G4@(\*@Gh  92453-07B11.17;^ 92453-07B11.046g0@  X"(*(*LX 0,@,tX!78@G8@X!5x,Ex,X -b,=b,X 86@6@X H@@X IXXX XXX(>(@`>(@<>( @P>( @ h>(@0t>(&@0 >('P$@7P$>((x@7x>(P@7@>(R@8dY \? *@ $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$y 0O l(^\j'P <p(Ohů;A8v˚v)bR 8b [gkD'i0VL /v'6!xy!xD!xry 4'PנuR `aDg6mTL,ש'6JL''̃!xT/}(24!x݌/!xg6OXkQ0k/X\Tk !x/P )'6С8VY//]]3! '/!x/Bj+ 4gyh!xng@M5]E Yœ03tfZtf85}pr͈ +zS)Lr*AZA5axU)qVlGɘɘwqS 0| oN)U,ҸW[>>a9'/!:|JRdJVC ƿǔj'^nP+@k Sϻ$l6Eu%$klhz=Bam"K/7 O=!Op 3MO`*08(F1Gڇcwb}B!/A\G=IVrҽҘoM>fжURa6bY?iB(%y{t57A$=;>t0;_u~klhSOŗ.l9Ҁ;ahslN;\wpan[Nz Gf^<,$"dsxُZD geX}|BK(.Z~_Wd8EjUjKCJ|+V 6YUD,_?A˚v8vhů;An bRY;tltD8rP.Y;2Y;Y;'Us,2K[>j>a% '/!`ɊReJV*C-Tw%" $  & #'@:@:@:@:@:@9@0xU@U@U@0|U@0U@0U@ U@:U @U @UXU!XU0U<UJ@UP(U^UhUnĈU~ UU0U ÌUpUUUTtUG8U!@48U @1hU @40U /@4U =@4U S@4 U !1<L]dkry&.4;CJS^enu !&,3<CJShw#0HVcw!;Mdr|$>K m (5EVhv   0 C Y q   # 5 K Z g w   ! 1 C R a s $ 6 K a z  , 8 A S g { $:x$B|$J$Rvqst$Z$b$j $r $z $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ % %  % % %" %* %2 %: %B %J %R %Z %b %j %r $%z (% ,% 0% 4% 8% <% @% D% H% L%@%D%H%P%T%X%\&`& d&h&l&"p&*t&2x&:|&B&J&R&Z&b&j&r&z&&&&&&&&&&&&&&&&'' '''"'*'2':'B 'J 'J/tmp/libtool-17570/objdump/opt/binutils/lib/opt/binutils/lib/libopcodes-2.11.2.sl/opt/binutils/lib/libbfd-2.11.2.sl/usr/lib/libm.2/usr/lib/libc.2_tepv_ktepverrno__ismt__dld_loc_hex_valueoptopt_SYSTEM_ID_CPU_REVISIONopterroptindoptarg_FPU_MODEL_end_environ$RECOVER_END$RECOVER_START$UNWIND_END$UNWIND_START$ARGV__text_startmemcmpgetpidaccessmalloc_isupperfopenctimestrrchrsprintfstrcpystrcmpreadstrchr_startcalloctolower_isdigitfgetsfclosebsearchfprintfexitopenunlinkvsprintfrealloc_isalphastrcatstrncpyqsortstrtolstrncmpstrdupvfprintfstrcasecmpgetcwd_islowergetenvsetlocalestrtoulfstatgettimeofday_isspacestrlenstrncat__flsbufprintfmktemp_isprintfputcstrpbrkatoiatof__assertabssscanf_isalnumfreestrstrstrcspnclosesbrkabortmemcpystrerrorstrspnmemsetbfd_initbfd_set_section_sizebfd_set_formatbfd_get_stab_namebfd_hash_traversebfd_set_section_contentsbfd_scan_archbfd_get_section_contentsbfd_octets_per_bytebfd_hash_lookupbfd_hash_newfuncbfd_close_all_donebfd_get_machbfd_printable_arch_machbfd_get_errorbfd_scan_vmabfd_hash_table_initbfd_check_format_matchesbfd_get_archbfd_check_formatbfd_get_section_by_namebfd_openwbfd_openrbfd_coff_get_symentbfd_coff_get_auxentbfd_hash_table_freebfd_errmsgbfd_get_reloc_upper_boundbfd_hash_allocatebfd_canonicalize_relocbfd_set_errorbfd_closebfd_openr_next_archived_filebfd_set_section_flagsbfd_set_default_targetbfd_map_over_sectionsbfd_make_sectionperror_memorydisassembler_usagegeneric_print_addressgeneric_symbol_at_addressdisassemblerbuffer_read_memoryxstrerrorxexitobjalloc_create_objalloc_allocobjalloc_freemainhex_initobjalloc_free_blockfnmatchdcgettextconcat__d_trapdump_section_headerobjdump_sprintffprintfcompare_symbolsbuffer_read_memoryperror_memorygeneric_print_addressgeneric_symbol_at_addressobjdump_print_addressobjdump_symbol_at_addresscompare_relocspr_start_compilation_unitpr_start_sourcepr_empty_typepr_void_typepr_int_typepr_float_typepr_complex_typepr_bool_typepr_enum_typepr_pointer_typepr_function_typepr_reference_typepr_range_typepr_array_typepr_set_typepr_offset_typepr_method_typepr_const_typepr_volatile_typepr_start_struct_typepr_struct_fieldpr_end_struct_typepr_start_class_typepr_class_static_memberpr_class_baseclasspr_class_start_methodpr_class_method_variantpr_class_static_method_variantpr_class_end_methodpr_end_class_typepr_typedef_typepr_tag_typepr_typdefpr_tagpr_int_constantpr_float_constantpr_typed_constantpr_variablepr_start_functionpr_function_parameterpr_start_blockpr_end_blockpr_end_functionpr_linenoieee_name_type_newfuncieee_write_undefined_tagieee_add_bb11_blocksieee_start_compilation_unitieee_start_sourceieee_empty_typeieee_void_typeieee_int_typeieee_float_typeieee_complex_typeieee_bool_typeieee_enum_typeieee_pointer_typeieee_function_typeieee_reference_typeieee_range_typeieee_array_typeieee_set_typeieee_offset_typeieee_method_typeieee_const_typeieee_volatile_typeieee_start_struct_typeieee_struct_fieldieee_end_struct_typeieee_start_class_typeieee_class_static_memberieee_class_baseclassieee_class_start_methodieee_class_method_variantieee_class_static_method_variantieee_class_end_methodieee_end_class_typeieee_typedef_typeieee_tag_typeieee_typdefieee_tagieee_int_constantieee_float_constantieee_typed_constantieee_variableieee_start_functionieee_function_parameterieee_start_blockieee_end_blockieee_end_functionieee_linenoalias_compareerrno__ismt_ktepv_tepv__iobbfd_und_section__SB_masksbfd_abs_sectionbfd_target_vector7!?9" 7]!9ӽ9Y4!:ӽ9Y4T ;|ӽd Y"ӽ9"ӽ@>B! @ Z A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  a@@@ @7]]@]2@@ @] @@ @@ @ @*@ :7!?9" : B*= @ Z ]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]` =@ :7]@ k? k?k?XZ]XZ]XZ]XZ]d@"Z]> ZZ]> ZZ]9 Z8 =@Y :Z @Z@ ZZZ] ZZ @"ZY :ZZ@= ZZZ@= Z ZY :Z]ya: =]: =]  : =@4ZBu ZZZZ ZZ]ya: =]: =]  : = @4ZB ZZZM ZZY :}@4Be]yZZ5@*Z@ya AZ@ya AZ]ya A @Z@] Z]: =] y a: =4Y(ZYY8Z@] Z]: =] y a: =4Y(Z YY8Z]Y Z @*Z@YA AZ@YA AZ]YA A @ ZZmZ@@K?@ @Ku3QKs3Y k?#a(7{7 +~h#+~h8 'y 4yEe'y 7D7%767+4># ! 744445 rנjb+~h%+~h% (4Ц @Ц D(43 H? P(ਃ 43 ` 7+4>7D7%7744z#(74444@H@7D7%7# +7444+~H8 7D7%77Kv 24]74444#.7@@@@ 7K?@ @@@@k?7k?#Y0k? 7Y pk?4@4 @@K?K?7@4K? *@K? K? 7@4K? rKa?H:@7?!#07 4@04@x7?!7?!7@4#9079 4@4Ka?@ H:K>@7? 44@B7?@B?7?B?@k?ok?7?"0'E' 86 P0.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?ok)4`@44` G>- ""046 @_4K>9K>Qk<+~H<K>i *K>y4ߟ444K>IKa_k? k?54@p44? 7+~ Y04Y 4:p_4h4k?4K>a5k?4@44?"p74@ 4K+~k>44k>Kk>v k>+~H3k>+~4'k>y 4 c?+~K?4=k>Ka?43k? Ka?44k?֠ k?Ka?45k?7vk?1+~4<!0k?!(k?)#07 4_47=)"06 4_4G=-+~"06 4:p_M4_+~"y06y 4:p_4 9049 +~4:p_4] k?)Kk?9k?A k?Ik?Q@k?QKqK>Akf` k?q( k?4? Pk?(0k?47k?k>  k>7uk?y7>7>444?U7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4!4! <4?@@k?7k?#Y0k? 7Y k?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?!#07 4_-4@x7?!7?!7_4#9079 4_4Ka?_H:K>@7? 44@B7?@B?7?B?@k?ok?7?"0'E' 86 0.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?7Kv+~ H4?44477K?Y@7?K?Yk?4?k?474_4$4?7 k|_M@eK?Y#0+~7 4:_M4%K?YKu3Ks3 k?Ku9Ks9 k?Ku3Ks3 k?k?ok?7# k?44V4 KxK?_744@Vx4 K?_744V@4 K?_744V4 K?_]7d 44 V4 K?_744 `V4 K?_7KzO4K?_K?` B440V(4 +~K?480_m7_4zK?YK?@O?k?7O@4k1qK?Y@7?@@K?@ @Ku71Ks79 k?Ku5aKs5i k?Ku6aKs6i k?k?ok? k?k?+~7#4&_%4$`k?9@t(Hz4CPk?AHzHK?9 HyK?A4P_74k?)Ka?Hx04: _=k?!4_k?1Hx8K?!_K?)HyHx`_U4Kv"@_-K?1H Bp@Hb @Ha BHx 4" "H "a6z _"@Hw փ  "H| BHv ǶC Hu uC*Ht TCJHs 3CjH} CHz C@Hy ƹCHx ŸCHw ŗDH ğD @Hb bD:Ha DX@H| ļDrH @B4_e@K>K?K?K? @O?& ?$rע߃$Rb$2$ 4H4_@B@_4g44_4pe444_U4E444_%4%444_44 44_404`44_4p444_e4444_54444_4444_44 44_40e4@44_u4PE4`44_E4p-444_4 444_4444_4444_4 4044_U4@4P44_%4`}444_4]4_@4404`@44_4H:4KK_M44Ku8Ks8 k?k?o zk?44yU4 _744y U4 _7K *44yU4 _M7_=4z+~H9 K?_4K?Y@O?k?ok?KXp7Cx@x4#47U4 HyO7k`1!44K?YK?@O?HzKV4z 7`7 @S877HyK64z4 )7`k|1!Kw1!?/4#47U4 HyO74HzOk? K?O`HzU+k?ok?k?7CKZ4KV4z 7@(7Hp?@OHz @S47HyK64z4 7`k|1Kx1 "46U4 HyO7X4#47U4 HyO7k`144K?YK?K?@O?OhHz+77=?7Yb7_P6?Ka?48747J79 6C"J7?_@a 799K RBu BKǜ@2K x "Ju Ҡ^Ҡ^7 K RBt BKǖ@2K x "Jt Ҁ^Ҁ^7(K h@Bs RKǕ@@@K x (@Js `^`^70K X79 Ba BKǔ@2K x "Ja ^ ^7~@ _R_7@7?Jǜ]k?J =k?H! k? ^ ^6=7?@@K?@ @Ku51Ks59 k?Ku6!Ks6) k?Ku3!Ks3) k?k?ok? k?k?k?!k?)k?1KGK%H H K0HJ0 # H y 828:BJHH_4z7_4 Z4Y@k?A7_4z(4  * :49`_U4z(4 K?A_-4(4 *#7`_4(4 : _:H?@`?5? t 0\425? w 04 04H7@`?4? 0\424? Y04 Y04 J_ J4  !:4  !B!R4  !Z@w4\ @! @!4z_4K>ςK>ϟK>ςK>ϟK>ςK>ϟK>ςK>ϟK>ߟ4?pK>4HK>4? K>ߴ4K>K?1K?)K?!K?K?K? @O?ςK>ϟK>@ @K?@ @K_K7KJ @4 @4? @4 4@Ku3Ks3  k?k?ok? k?77$7?Q#7X7_u4z P@C?Q4` 4c@w?4c@z@04c?#:HH794x7K>K?K? @O?Ku6Ks6 k?k?ok?k?K7$K `4@ JKXC0 844O 47 4e :"HH647#Z7Z_=4` @_4zK?YK?K?@O?k?ok? k?k?k?!k?)Kh17F7%7_]6k?1Kw1d4@x@Kx RS6sw H8 K0H9 8 R64t  `+`Kx 4w? J KV J|0JJ0\ KU  6@r4a? 4w? H!  K H:0JHY0 K Y ?6Kxx K: " RHpH0r@("BHHK?1 :K14w`x@Kxx K6 J0K<  I J0I  6_ 6?@+`Kxx K b z6? K: E X@Jv0K KS0K<  6?m@@6Kwx J J4x`: K: E 7_@@7 J R!"Hp:H0*@(6@HH @K> Kdx K>K?)K?!K?K?K? @O?ˀK>و64t_@B@_@ ˀMK>k?ok? k?k?K>7&7k?!K>66_54yHv!2#:HHz797H0Z#HvHz774_4y`"zJ :HvHz49U74_-4y"zHvHz6y7K>"Hz67K?!4y_4H KB0H z"zHvHz6yU7H K7044yH _ #j"HvHz67H K044yH _ _ #HvHz7]7K>K?K?K? @O?k?ok? k?Kw17$k?!``7#HH77K?!4_4xxK>k?H7XHH_Hk?H7k?K?!_mHK>K?K? @O?@ @K?@ @k?7K04_]@K?Y@7?@ @K?@ @k?oKx17C`ˀk?K?4xKK_uK7(4 0@K K70K W }84K>@O?Ku3Ks3 k?Ku3AKs3I k?Ku3Ks3 k?k?ok>k>k>7$KY7C$7 Hx4_7>у  4_7>7>_4 Hw6hxHm@K>YK>K>K>@O>_Hz `Ku2Ks2 k?Ku3Ks3 k?k?ok? k?k?Ku7 4#Kv؂&:7?Ik?7?AK_k?7?QK k?Kx 7%@K?A C0k?AK?I C0k?IKy K?I H@KyH _u@ "K?I_A6K?Q H@K|@ 2K?A+~" 049_6 Kz؀#K?A#K?Q#7d8H BK_K?A @HH?KH!@Kz8!8@H_k?!K?!  Z7?4Y _@ HK?Q6?`4H *"zH_M6y  H 44_4Ky8K: @_m@Kx8H!@K?Q4_U4H Kd8 ke8#K?A_E7 !Xk?)R4 K?A_7Rd7 K?A_ 7 K?) K8 0@K _@Ka8 Kb8 kd8Ke1A K?Q6? `44_4H @K?Q4_4K?I @KyH _@ bKzH @_ @_-K?IR7k|HK?I_e7K?Q Kv@ (k@K>K?K?K? @O?@P@K?@ @Ku6qKs6y k?k?ok? k?75k>7>k>k>7?Rk>K?!@_K?K>J77JJ   SAjK> JRJK> \K>K K>JJ  J Yg AK?_E4xK>J # jK>Jt_MK?4|K>K?K? @O?"46 0U4 N<7/Ku5QKs5Y k?Ku5Ks5 k?k?/,/-o`kk=a Ka?k=0n 4&Ak=4@4 `k=K=q7=AK='9G'E85j  @K=5J ?@Kl +R@m @n+2 j K= j8 _I4 `K=K=Հ ( J  j p4 LHk=5?H 7?`mh H(7h(4K= l J05K= 4_i7>K=C7 "7C?0c?K=_4 pK= Lh5L l :@H} @85  q @_I4 ?_6R?H 7?@l8h H(6h( `2K=  _4 B_61H 6? kh H(7h( @}H Ku%H 6?`kh H(7h(4K=`J 7=A*K=qK=yK= '900N0' G  BK=qK=y 77=A V$H9G$PE P j nh5o Ka?H? v7>%  <%@ p4rK= h 5LKo0K=Hm l 04 nX5ok=5?@Hu @86  @_4 ?_6R?H 6?@gh H(75h(( `2K=  _!4 B_61H 6y? g(h H(7h( @K=L@ `"5_4_@H 4T?fh H(40h( (K= ,_u@K=&H 6?fhh H(4Rh(4 AK=4K=4 K:04yK=q_ \ K=H 7? bh H(5h( K=`%4^K?_YK?Ku肠7KГP4@K=4 k=J ǼBKv(2K=J?K=KH_K=q7=AK=qK= &00N0&G  k=K=KnJZ%PKLH 6?eh H(7h(4^]@B@4 _4@K=_@Ka?:H?4\596 o7>  @K9KwВP4Kt4  4 Ku؀ "K=KK=_=K=qKs`K=q_ K=C7 "7C?0c?K=^E4 pK=7WK=4RXk?!k?K=7?4yk?)K= |K=q }K=ih`h`h`PJ0 2 7HK=74 q k=@} aK?)K? #^7 _K?xKEKu4 _ 4mK=4 _ }4@U 4 _ U4@- 4 4_ %K=J 4 _ 4K=^-4 K=K044yI_Y IH9@^4 I K @^K=aIK :C *K=J_4yPIK HY C7 @K=a^4I 0@^4I4_4y^4K=J5K=*KIK=q 븗K=(K=K= @^47=AK=qK=yK= '00N0'G" k=qbGk=K Kz19+~7>k>H" Ka?44 k=+~H1 +~k=H( +~k>QH? +~k>YH2 +~k>H5 0+~k>H7 (k>ak>!k>k>)k>1k>9k>Ik>qk>yk>k>Ak>k>k>c>k>k>@ (k>i_@$7hKa1)$ JR`4H74_-7Ku1)  _M4#k=!45!0T4 7_-44_E74N7 kg1qH* 7?A7=7?!k?!4 4 k?AH jKv K|0_BKz _H*H ǭJKp!:4_e4cP7a@Rh7Kw744_57c7+~H7 854_5zk?!K1Y5w l ' JJJt26 k?!JK]644!T44 H^ 7@(.B2HH(bk?R67444_7k>Kw1Yk>qH0k>yk>'Kw1Q#:479 4 T47Ky196_N7h^ 4k=H4K_Mk> k>_%4k>K=k>Kz11k>HJ k>!k>H;k>!k>!k>HHN074NH+~^ @k? Kw1Q "K=6Pk?  4/K=6 7k?H0 . 44_4ϥ 7!J J0JH0 !  @K?AKy1?@7KzxW HR JS0H] B67@2W J K0JA 6Kxx  k>1 k>9Kqk>1Kq Zk?^ m4k?H0 N 44_ 6^ %4!!bJ K0JH0\  n V*6J K0JH0 X  נ  5Ky 00J KA0JH0A  jJ@JJ^4@ (@J^4` @Jbk? 4!BO KyK?AKw1@Kxx K: :J J0K]0K5 J 5z7`hk?A K: F?7J J}0K\0K2 \ J = Կ7 H Kux >@J J! H90J=H0   5Ky4k?K=5:5k?6N60k?_k?O@^5 @^5zH5Wk?!^KzxKK?K?K? @O?@("B*HHks`4%@(4BBHHkvPKz`R@k|hRhKzPk|XK}`44zk?Kxh_ U4 #;479"1T4 _k?1_7HxK?17N K?!^Kzh^KzX4ˀmk1qKPk?44zKxX_ m4!ς%K>K?)_4z>%7#47"T4 HyK?)N 74ˀkw1q^}@4%4ka`@(4HH^=@Kz`4k|P#7"4T4 _k?9_ 7HxK?974N K?)^Kzh^KzXˀ}kf1qKu6Ks6 k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>Kgh7CK}`7*!44&5" T\4 5Y^7^ 5#44'4 ?Ka?4+!HzKV47Hw@74 @ Jկ հ 7HK4Ӓ775#^ 5Y_5 7^5#5#6^6X5z 5^)685#^5! 4`4 x@^A5#5#6^!6X5z 5^685#^5m45#^55#6^6X5z 5^685#^i5KxP 0@KyX ^)5#4^ 5$4'%5Jg?^5$K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ku4qKs4y k?Ku3Ks3 k?k?ok? k?k?k?!KD7Ck?1!(k?94%Ka?4&^ K?1HK?17_7 H  (@H   jHK?9_m4z @@HK?9_4z^Kzh^ KzXH>@K>K?!K?K?K? @O?_ @k?ok? k?k?+~7C 44%4$!4&T4 k?!_E4zk?)_4zK?)_E7K?!^I744$QTP4 Hyp^7Hvp2HupAZHtpǴAHspǓAH}p}AHzpZA@Hyp9BHxpBBHwpBjHpB44$qTp4 ^97HxKa? z4: ^4y^4zK>K?K?K? @O?"z46z^44#47^i4m4#Z47Z^14 E4@#:7:4^4P4p#74^44"46^44#47^Q44 Z44Z^4 4  :44:^4 ]4 0#74 @^4=4k?7K_Ka?Kx49 7K?Y@7?k?ok?k?Kt1I7D h4#H RK0Ks1I  k0K8K}1I = k8K?K0"{46y$T4 HK7^IHKx (4%Ka?4: 4N4Ky  @_4Kz @_%4Ka?H4 6?h: @aKa?H?(7h7(4Kb( @^14Kw *Ky Ks Ku ^4k|K| @Kb@ @^4k|pK!Kv!@Kȋ!*Kx!:Ka !bKw0!p@Kz@!zKt!@Kz@" @Kzp@"(@K?YK?K?@O?49 _A4-Kb(4@4Kv4@ 4K_ u4KxK}>Ka@4Ka@4Kw0@4}Kz_Y4mKtKyKx1!B 4>M7Ka?@4: >%@"46$T 4 HM474ku1q^E@k`^%@k`pKu7Ks7 k?k?o7C4_7? @_4zK?Y@O?_ @ 4z7?_54 @_]4zK?Y_@?}@^ HzMDK?^K?-K?Y^ qHz K?Y^ QHz_%@>@MK?^EK?K?YKu8Ks8 k?Ku7Ks7 k?Ku8Ks8 k?Ku8Ks8 k?Ku8Ks8 k?k?ok? k?4_k?!!(74_4z!:#47%ATP4 Hy^ 784_4 @_44_44z_4?7_@ J h@_4H@^K?!@K>^qHz_4z_4zK>K?K? @O?k?/,ok>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yk>k>^k>k>K>7>\K`%'A K>Ka?4$Ka?4% 49Kz ^Hy%2Hq "44%aT x4 Hy^97@(?B@HH$@r(2BHzHQ 4@@n(.B7@m(-BHHk?K>44y_5XK1Y @Hw0`+ Q $4% #:8 Q   6@u(5BHzHiK>0@@b("AHzH1K>7l"7>&&9G&F9G&GHs0 k ^ 4%5 ϡ5Z P ^4 P  K1Q>Hw0@|(<@HzHK>ɝ@^@E@r(^i@B5@^I@E@m(^)@=k?^ @BE@^@B@^@B@^y4 @^Q4%6>M@4%^!6o`5q-H^6 614\^6Z61/?@H 7?@ah H(7h(k 5 ^5ZHc`:+`K=K>K>K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>O>@/0,^m@W4 ^45k k?ok? k?k?k?!k?) @+Kd1"Kcp"^6%0@Kd1!"Kc"^6&b* `"K!KwK 0@4@!*HB044@ 85N5 ` h7HKa?49 KV `447 `HKa?49 KV `447 `pHKa?KV49 `44)7 ` ^4"]}6]4c#7]M4z]=4zK>K?)K?!K?K?K? @O?k?ok? k?k?k?!k?)k?1k?9KD"P7CKa?4%Ka?4&4'!(8H AKz!^)H!4z_4`7H]5&! @]5&aPHQ5:Kw74z4_7`p7 @]=5&a5:ǿ_4zHMTHzHM4HzX5:#]74z458@5W]}5$5:^@H=@K>K?9K?1K?)K?!K?K?K? @O?k?ok?KY7CK6)7`7"]6& "#[]u7Z&aHK?YQ4k?H4zKxpK77`P7 b#]7&aK?MHz"MHz`K?#]}7K?44z@P4"{]=6z$K?^@K?YK?@O?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yKhp7C7$76 H4'!Z5Y4?^Q7?^ 7?7?kip+~4" k?Kyp!5&48 ]44 4 $X4H$B4)!Z5A k>+~4< k>7?iK1Y I@K1Q IKu 0k?7?Y7?aHk?K 4z4k?KxI 7!H@K?a r ^A5 P@K?a]5Z @^y5QK?a7K?i :K?Y@ `0^5y h@K?Y 5Z K>]UK?i K?i^5zK?Y@ 4 I @K K K KRKa?40 I5Q6]-69IK@!@]m5'IQ@|-I44Ka?40 I5Q6]69@0K>I5'AK9@]6XI 0@]5ZI6]69]e5Z 4H<K1YK=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>K]5'!IK4^ !4zI #@7'aB #@7'"@6'Ku8Ks8  k?Ku6Ks6 k?Ku7aKs7i k?Ku3Ks3 k?k?ok? k?k?k?!k?)k?1M4k?AKa?H?4K!4$ 4^ I_K?AI_7I_7I4'58]57 b4_E4 x@_ )@ @@_54H] K?AH]I44HKX457 *4^ 54(]754_M4H4c >' _EK?A^)K?AK>K?1K?)K?!K?K?K? @O?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?i+~7C7$ 48 4(!] 4@p4fKa?H? H4'K] U4(14`H ?KKa?H9 78?h8 d(4&H(5h(4 M4k?qKa?44 ^4*4 Z4 @4^M54(A]]7"4^54(a7] 4db@4mIA - ""IK?q_4! 7] I4 BIKX4557!4]I7 JH 7? bh H(6h(?H H 6?b`h H(7Sh(L?=@4_5>@_@!4>@I] 4(1 @_]55` @I\ =IH 5?a`h H(6h(5(\4_K?q^K?qK>K?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?4 ^a44]IE44 ^4Zo4 ^4@'4 ^45Ku4Ks4 k?Ku5Ks5 k?k?ok? k?k?k?!"{_]6z(q4 7_e@7Ka?H?K`044@ 4% K4]47 g@jH  RK]E@ 7'`"4H ?K4_4H ?/ K>K?!K?K?K? @O?k?7#47(S 4 +~49 ]7_E@_@K?Y@7?@@K?@ @Ku4Ks4 k?Ku6Ks6 k?k?ok>k>k>k>k>k>k>k>k>k> Kd1ik?7E7&4#4(_4 4(4(S 5:S T5:HkzQ4_@M@4)1k>+~47 @k>4P4!@Ka?4)4*#Y07K (4,4 4? | kmKz2!"MT@"7M7k?Kz2]4*1#bkm1)]Kz2Kz24*_ 7#pkm1)`7k}1 _Q4K17K|1q5:@]4k?K>44PK>>e@Ks1a` @M4*с$Kt$@_M@K|1qK>YK>K>K>K>K>K>K>K>K>K>@O>k?K2k19Kx2kx11Kw2kwkmKd2k>44)SL4 K>Ky27M k>K>kmKz2M4)k|1IKz2M4)k|1YKz2M4*k|1QKz2]U4*!<@ek`1)44*AS44 M H75:@]4k?]mKz2Kz24*q_Y7<@k`1)44*S4 Ky2M75:@]Q4ek?Mkm =km-kmkm4kmkmkm kmkm(kmkmkmkmkm4kmkm4mkm]kmMkm=km0-kmkm kmkm(4]5: km1aKa?4:@]4+`K1:4'+~4: _y4K|1qk?7+k?7?490k?7?7k?B k?K?Y@7?k?ok?k?KT7C4 r4@HxK7?@`pHK6kHs4dHxK?YK?K?@O?Hy^ a4@HsKu6Ks6 k?k?ok?k?7% 07C4K?YK?K?@O?PD4 744 _57P|4 74 4 Hw E dKu5Ks5 k?k?ok?7CKZ@ k?] K?HxK] 7 P 7Hw# J7K?7 ]7Hy]K:Hsd4K?YK?@O?+~4:49_4k?ok?k?7$7C 0ˀHs "+~4:490_4H}] K7] 4Hw JP47H4HzKT^ 4K?YK?K?@O?Ku41Ks49 k?k?ok?k?k?K\7C!7$HvJ]u4!74]M4 HtJ]%4 "HsJz]4P J 4 _U4z!b 4 _m4z!:@!bς0K?Y+~4:@49p_4:HvH}]K7]4P HwJ7 %^7HK  & ]}44_4Hu] JHׂ4K?YK?K?K?@O? Z 4Y _4z7 4@?@4z_4 4]K?Yk?ok?k?KW7C P4 4 _ 4z P@H44 4K?YK?K?@O?ˀK?Yk?oKX P7CHzKW wKY] k?K?YK?@O?+~4:49_4Hzk?77_ 87:#: 79 ] 7K?Y@7? *" 6 0] 7K?Y# 7 @] m7K?Y@ @K?@ @k?oK_7C Hk?" HzK?] )6 `K?Y4@O?+~4:49_4" @ @K?@ @k?oK_7C Hk?" HzK?] I6 pK?Y4@O?+~4:490_4." @ @K?@ @k?7# _7 K?Y@7?@ @K?@ @k?7# _-7 K?Y@7?@ @K?@ @k?7+~k? 48@ # 2@48P7 ]%7?K?_e7?K>@7?@ @K?@ @k?77?( 0k?#: _79 K>@7? "# _7 K>" 6  ]7?K?_U7?uK>@ @K?@ @k?7_k? 4K?Y@7?# K?_7 K?Y@ @K?@ @k?7 k?# 7 ]7?K?_7?K>@7?@ @K?@ @k?ok? k?k?k?!7& z k?176_e4y ! HK?1_4!@K?1_4y !K?1_e4y 0!!@K?1_54y @!4y _K?1K>K?!K?K?K? @O? "K?1_4y `!H@ _K?1!0@ j44_m7?qK?1_=4y p @K?1_7?q 4 ? 44y ˀK>ˀK>ˀK>ˀK>H4>4E4y ˀMK>ˀ=K>ˀ-K>@ @K?@ @k?oKY x7CHxK]4 C4 j# 7 _4zK?Y@O?+~4:`49_ 4t]Hx#Z 7Y _u4zK?Y@ @K?@ @k?ok? k?k?k?!k?)k?1k?97KX7C"@7$`442Pt 4?@7 !Z 5Y _U4z!@_54z <" 7]I5)?7_  4 P4! 75 ]U7A5 _]45 @5 `_-4 _45)$@ 2 `5 `_ 45 _ 4`@]45 _ 44z_ 4 ˀ@K>+~4:49_ 44K>K?9K?1K?)K?!K?K?K? @O?ˀK>و^4 } ]4ςmK>@ @K?@ @k?oK_ 87C" 6 _ 54zK?Y@O?+~4:49_ 4." @ @K?@ @k?oKW7Ck? 8k?# 7 _ ]4z BˀK>+~4: 49P_E4N# K?44_7?AK?44_m7?q#Z 7Y _4z7 4 *# 7 _4z 44z_7?A 4Z#: 79 0_4z 4"4z_]7?q 4K>@O?@ @K?@ @k?ok>k>k>7&7k>_ 6!7 :! 7?14 @]4K>444_ M7>444_ %7? 7?14 `7>7?] 4K>_%4!J4 ]4 H@K>_u4 0!@K>_M4  @K>_4 4K>YK>K>K>@O>ˀK>Y444_ 7? 7?14 P7?]4K>ˀUK>YˀEK>Yˀ5K>Y@ @K?@ @k?ok?7# k?_-4 K?_e4 @K?_}4 b @K?_M4 B4K?YK?@O?ˀK?YˀK?YˀK?Y@ @K?@ @k?7" k?6 _k?0ˀ_K?k?0ˀK?_K?7 4 *# K?_7  4`@K?_}K? 4*#: K?_79 4K?Y@7?@ @K?@ @k?ok? k?k?k?!k?)k?1k?9k?A7%7k?Q6!H4P@P 4i? @7 !z K?Q_5y #@_K?Q \#H7] 5J?7?_  5 P5#7  4 _5B4 _5P4 _4 !h@_K?Q!X74 4 ^4!:4 ]4@!b@4 `_5 _54@ 2`4 `_54 _u5`@]44 _=5K?Q_U5!jˀK>ˀK>ˀK>44^I4 "4]4@04]47`\@U54K>K?AK?9K?1K?)K?!K?K?K? @O?ˀK>5]4 `^ 4 ]5ς=K>@ @K?@ @k?7# _a70K?Y@7?@ @K?@ @k?7# _7@K?Y@7?@ @K?@ @k?ok>k>k>K_+~7$k>7 49`kX7C049p_A4z! *4z_4 RˀK>Y#: K>79`] 7?14z_17?1!J 4_ 4z!2K>0 4_4z!  :44] 7?a7?a_4z ʀ :K>4] 7?a7?a_A4z 4_!4z 4_4z ˀHK>Yˀ8K>Yˀ(K>YˀK>Y׀4K>YK>K>K>@O>ˀK>YˀK>YHz@_4zK>Yk?ok? k?k?k?!k?)K]7D!x7#HK_!!ff *bb!ˆ`! 4 40HK]47? 4@!  4_4!4P_4!p@_Q4!RHc4K>K?)K?!K?K?K? @O?+~4:49_4]HςK>+~4:490_y4/ m4 U4\@ˀK>+~4:@49p_4E  ˀK>@ @K?@ @k?ok? 6k?_Ik?! z K?_4y`! 444_7?qK?_i4yp!x@K?_A7?q!P@K?_4y `!*K?44_7?qK?_4y @K?_7?q @K?_4y @_K? x@_K?2CˀZK>_K? Zˀ8K>ˀ(K>ˀK>׀4K>K? @O?K?_4yK>@ @K?@ @k?oKS` 7CHtHwH6?hyK\4z @x?4@ @@z?_ @u "+~4:49`_ 4 `4K?Y4`}?@O?+~4:49_4Ht+~4:49_q4Hw@ @K?@ @k?ok>k>k>k>k>k>K>67Ck>K> 7$4KW6 kX_Q4z# 7+~ 49p049_14z" *4z_y4 RˀhK>Y# K>7`]q7?4z_!7?"z! 5_4z"bK> 0 0!B5_4z"" Z558\7?15_a4z!4z_A7?1!ʀ B5_4z!!5_4z! :K>5\7?a7?a_4z!5_4z!@Hy4:5_I4z7 4 @_4z 4K>YK>K>K>K>K>K>@O>ˀK>YˀK>YˀK>YˀK>YˀuK>YˀeK>YˀUK>YˀEK>Y4z_ !4 "5 _ 4z> @ˀK>YˀK>YˀK>Y@ @K?@ @k?ok?k?_ k?!! z K?_ 4y @K?_ 4y` @K?_ K? @K?_ 4y x@_9K? X@_K?2Cˀ:K?_5K?! 2ˀK>׀4K>@O?K?_ 4yK>@ @K?@ @k?ok? k?k?k?!k?)K_7C7$7 6K "+~4:49_4 4 _ i4z"@_I4z"p74 4 ^i505 4z_5"* 4_!4z"Ă*"040 4@_4z! 444_7?a4_4z!4z_7?a!4_4z!rHfH4HZ]@!7HeH4?J *4tC 7?@+~849P(49`_q4z0ˀ_ 4z 7ˀxK>ˀhK>ˀXK>ˀHK>ˀ8K>4`4׀4K>K?)K?!K?K?K? @O?+~4: 49@_)4 ,UHeH|\K7\4 P4:HzKY7 $]I7HyK3 d ]44_4Hv\=JHc f\4ςK>@ @K?@ @k?ok?K_7D 87#H4K?YK?@O?+~4:p49_I4 vH@ @K?@ @k?ok? k?k?k?!k?)6KW7Ck?1K>#Pk?9HyK:@#h@K> ""z 6y_4z#b "" 6_4z#BK>H KKK@K_4z"@_y4z"7"4K?9_ 4z"4z_4" 4_4z"@K?1_i4z"4 4z_A5"j0 ʀ Z4 _ 4z"B4z_4""4z_5"444_7?q4@_4z!4z_a7?q!4`_A4z 4 @_4z 47K>K?)K?!K?K?K? @O?+~4:49^%4 Hy+~4:490^4 mK>E757%77_a4z<777777@ @K?@ @k?ok? K]7C6k? k?HzKT HyK3Ju! K> "" 6^4z!  "# 7^4z 4^%4z ˀK>+~4:@49p^4 DHz+~4:49^}4 FHy+~4:49 ^E4 HK>׀4K>K? @O?H|K4z^J ˀK>_4z k?!ˀ}K>K?_4z ˀMK>K?!^4z7 4 * : 49^}4z 4@K?^E4z 4@ Z 4Y`^4z 4U@_i4z 4-K>@ @K?@ @K_@4@ @K?@ @k?7_@K?Y@7?@ @K?@ @k?7^=@K?Y@7?@ @K?@ @k?ok? k?k?67$k?!pk?)v 2rBr!"nn!B 4p 4 ^EK?!!"!*4K?!^4!: `0:K?)4\ }7?qK?!^-7?q 4K>K?K?K? @O? 4 4 4\@ˀuK>ˀeK>7?qK?)4`\4K?!ˀK>ˀ K>@ @K?@ @k?o^57C @K?Y4@O?^4z k?ˀK?Y^4z# HzK?\ 7\K?K?Y4@O?@ @K?@ @k?ok?^7D (74K?YK?@O?^4# H7\ 4x\4zςK?Y@ @K?@ @k?o7Ck?^k?K?44^7?q# HzK?7\ 7?qK>4@O?/0'@@@K?@ @/0'k?/,o0H k?!^7C7?. # HzK?!\74K>O?@/0,@ @K?@ @k?ok? 7Dk?^Ek? (74K>K? @O?^4K?44^7?a7?ak?" H6@K?\4x\4zςUK>@ @K?@ @k?ok? 7C7^ k? "4K>K? @O?^4z k?ˀK>^4z :4?J# Hz\7(K?" Hz\Y6pK?44^7?q#: HzK?79\7?q\K?ςK>@ @K?@ @k?ok?7C^]7 "4K?YK?@O?^4z k?ˀK?Y^ 4z " Hz\6# HzK?\74ς= x@ @K?@ @k?ok? k?77Ck?!k?)  _y4z!RK?!^4z!@@^4z!07Hw # Hz\7 `  #: Hz\i79pK?)44^7?q# 7Hz7?q\4\4Hz7]h}4K>K?K? @O?ˀK>ˀK>ˀK>@ @K?@ @k?oKX7C@(k?" Hz\ 6 `^ 4zK?44^U7?q# Hz7\7?qHy7:hz4K>@O?@ @K?@ @k?o7Ck?k?^k?!K?!44^e7?a7?ak?" HzK?6\K?K>4@O?@ @K?@ @k?oK_7?k?7C^kWK?44^m7?q# 7PHz[7?qK>4@O?@ @K?@ @@4k?ok? k?7C7@k?!7!7?k?K?!4z4@4!@HwJ" :7?k?K?!4z4@ 4!:HK *4z4@`7?!@K? bH}K`0@:K?!4z4Kh4 4k?K? :0449R4 HyK 7ȀH4Ȁ84Ȁ(4Ȁ4Ԁ44K>K?K? @O?k?/,ok>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yk>k>K= 0k>4p, 7e1k>7k17Ck>44k>k>k> k>K> k>4zK>]K>K>7S]4z7 0@(8CHHk?O5Z744z4] 7#A(?DIHk?O\4k>44z5] Q7#ڈ BK>k?44yK>BpK>$7K>42 44 F4HpJP5z7HoIh75z AlY7HnIP75z)7 75(.5k  4k?7>K>K>Ka?4:@k? :07?Hx49 '00N8D[m'D5kjHp@@\)4K>6р K>BX4$*4K=K>K>K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>O>@/0,[@Bk?]K>7]K>k?Ka? Z0 .Hx4:@4Y[@ˀK=[=@k?]!K>]A7k?K>Ka?4:@ :0 MHx[%49ˀ=K=ˀ-K=K>   0 \ 67? !b5_R7\ 6 b@?Hw5zJPA74 K6bE?\ 96 b@?Hw5zJP74 K6bE? 7\5\ 67? % 65/7k?55k?5@6K>45B 5;5k@@@ X@ˀK=ˀK=k?ok>k>k>k>k>k>k>k>k>k>k>k> 8 7#k>77E4 ك 7+K>4Z4 4 HI7?I4Iy 7C?QH" :k?K>44B4w#(7 K?Y5\94 7? *!5߁5O77\77?  IK4K\57\i55Ox77\Q77?  IK4K 57\ 5 @\ 55\57?  555k?G?eҹ5C?a@K?IK?Ik?5G?eK>BC?a 5kfH@X@ K>B5 4K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>ˀK>Y@(@@@ˀUK>YˀEK>Yk?ok? k?7#0k?!k?)] 7 074K>K?K? @O?@(?@HHk?O4k?1K?!44\7 ˀmK>K?)K?!4E [@̂Mk?\ QK?14ς yk?ok? k?k?Kbk?!7F7cB z7%@ 7\ @KK?!7} f7y7x  OKw6RA4! 6ku  <K>K?K?K? @O?k?ok? k?k?k?! z044yQ4 Ka?4:@k?1[ ]7K?1[ E4y4$Kf7eצ H !])H (7K?1[ 4y@PHH K?1[ 4yPH[ }4y`HK?1[ ]4ypHK?1[ =4yH@ @HK?1[ 4yK?1[ 4y4RX7K >צK>K?!K?K?K? @O?k?ok?7c4? `@ \!@ `_4c k`K?YK?@O?k?7Ka?7X#04:@[7K?Y@7?k?ok?k?k?7#76O 4@744@^7 K? h He H@O 4744^y7  eH4 K?YK?K?K?@O?k?77KX h7?KX Rk?KY 9(77_=7K?Y@7?#:0479 Q$4 _7ˀK?Yk?7O 4hk?44h^7K?YK?@7?k?ok?k?7$"07C 06O `4744^Q7 O 4744^7 H  e@H "+4:49^4 d d4 `h` h`(K?YK?K?@O?k?ok?k?7CH7$"z0 06d!*K bHC_@ *CW@ [M4!H?@O X4744^ I7 HK 6J?64 eK?YK?K?@O?#047Q l4 _7ˀK?Yς ek?ok? k?k?k?!k?)7C7$7#Z0 07D H64K>K?)K?!K?K?K? @O?Hy B#047Q D4 _7ˀuK>O04 4k?744^ 7 O407440^ 7K> 4?4zi 4 Hw64hh _ e ˀ]K>k0ςEK>k?ok? k?k?k?!77'7D 06H! H Ox4(744(^i7 gK>h e fH7_K] @KK ?@4K>K?!K?K?K? @O?ˀK>"z046y`QD4 _7ˀ}K>k?7K] bK_ RKW BK k K?Y4@k@ @7?"046Qt4 _7K?Y4@7?"z046y Q4 _7ˀK?Yk?ok?k?KS7C` 7%Ht O407440^7Hy 4?h Hx 7K @KK?@4hd K?YK?K?@O?"046 pQ4 _ 7ˀK?Yk?7K_ RKW @@J j K?Y4k_ @7?#07 4Q4 _M7K?Y4@7?"046 Q4 _7ˀK?Yk?ok?k?k?KU7C7%!7H( JKH}] 247 ?!6?@N4744^7Hs 4?48 47h`4k H(0Hv 07Hhf(K?YK?K?K?@O? Z044Y QL4 _7ˀK?Y7`  ς] $k?7#047 Q4 _57K?Y4@7?k?7#047 0Q\4 _7K?Y4@7?k?o7 0ˀ:4_ 4 k004K?Y@O?k?/,7p (0H 4K?Y7?@/0,4 _e4 ˀK?Y7 ς/ k?ok?k?k?7 0064 _4 @7׀4K?YK?K?K?@O?Nl4744]]7 4 uh0k?7#047 Q4 _ 57K?Y4@7?k?ok? k?k?77? `06KW @KW ʐ  Z604k?7_ 4!7ˀ8K>KX 47(4K>K?K?K? @O?#:0479 Q4 _ 7ˀK>#07 4Q4 _ E7ˀMK>N4744]7 K>4  h0k?ok?k?7$7N$4 744 ]7 4 K?YK?K?@O?k?ok?k?k?7#74_ 4 @744K?YK?K?K?@O?N 4744]7  u k?74_=4K?Y@7?k?o778_40K?Y@O?k?778_4K?Y@7?k?778_]4 K?Y@7?k?778_4 K?Y@7?k?ok?k? 46_7 8744K?YK?K?@O?N407440]7  k?ok?k? 46_72C`N 407440]7 K? K?K? h h(K? h( d4|K?YK?K?@O?k?ok?k?k?7#74_4 @744K?YK?K?K?@O?N4744]7  u k?o2CˀJH| :4_4 0 |K?Y@O?k?ok? k?k?k?!7#7 H644K>K?!K?K?K? @O?4_4 74N4744]7   - k?o2Cˀ*4_ 40K?Y@O?k?ok? k?k?k?!7#7 H644K>K?!K?K?K? @O?4_-4 74N\4744]M7   - k?ok? k?k?k?!77' 0064_54 P7Ԡ44K>K?!K?K?K? @O?N$4(744(]7 K> K>  h E k?ok? k?7# 8744K>K?K? @O?4_4" 7Ƞ4N 4k?!44]7K?!= k?ok?k?k?7 007#4_4$ H7Ԡ44K?YK?K?K?@O?N 4744]7  u k?ok? k?k?k?!7%7 H644K>K?!K?K?K? @O?4_4& 74N 4 744 ] 7 K>    k?o2Cˀ*4_4(0K?Y@O?k?o2Cˀ*4_U4*0K?Y@O?k?o7#k? P74K?Y@O?_4 p7ˀK?Y7??蟽@"046 pQ 4 _7ˀeK?YK?@h4y=K?Yk?ok?k?k?7&76N,4 744 ] 7 K?4   K?YK?K?K?@O?k?ok?k?k?7&76NT407440] E7 K?4 K?h h(  K?YK?K?K?@O?k?ok?k?k?7&76Nd407440] U7 K?44  h K?YK?K?K?@O?k?ok?k?7$7N4744]}7 4 K?YK?K?@O?k?ok?k?k?7&76N487448]7 fK?4| eK? dK? K?hw hx(hy0K?YK?K?K?@O?k?ok?k?k?7&76N487448]7 fK?4?4| eK? d hw hx(K?YK?K?K?@O?k?ok? k?k?k?!77% 0X7DH@ H z44,_ %4 7`44|K>K?!K?K?K? @O?"z046y Q4 _I7`4|N4744]7 44 fH44k?_ 79 `4|k0 k?ok? k?k?77# 07FH B 044 Qp4 _7Ƞ`4H4.u HH64y[J BԤ44K>K?K?K? @O? z044y `Q4 _ 7Ƞ444._4 7ȠM4NH4k?!44]=7K?!44 H4x4k?_6 Ƞ4k0K?!} \k?ok?K?7 8X7##047 Q4 Ka?Hx4:@7Z=4 d4K?YK?@O?k?ok?k?k?KS7D`!7#H H( rK bH 8@HC_@w [ 4y!ZH?@H?e@HJ H jK ZH 2HCX@y [ 4y H?@H?m@4K?YK?K?K?@O?"046P4 _ 7ˀK?Y}H0mH0k?ok? k?k?k?!KE7# 7H H K H Z H0K: 8@HC_@w [ Q4y H?}@H?E@H?@4K>K?!K?K?K? @O?H0k?oK?7#k?7?Փ !" 07K @K?@k?k?Hs6t?ՎHuJJ K?_%7?|4|#047P4 k?K?4y@4Ka?K?4:@Z74|K>@O?H|K7?_UK?|4|k?7 4K?Y@7?_4 ˀK?YKK? 8@K?KJ ?@@K4, 4. @4K=K@J| ZK< RK?7?ՎR :K8KK ?K<׀4@ˀ@K9eK9k?7 4K?Y@7?_M4 ˀK?YK4& * ˀK?YK}KKeK<k?o 7K?Y4@O?_4 ˀK?YK4& R ˀK?YKK zKK?YJ|@O?KK= }KK?YJ@O?k?7 4K?Y@7?_u4 ˀK?YK4* Z4( : " ˀK?YmK]KMK=Kk?7 4K?Y@7?_4 ˀK?YK7? ˀK?YKK 0ˀK<@ 0ˀK<@ K? @K< @4? K? @K<(@4?k?ok? k?k?k?!k?)7C7$k@XKZ8k?1Hx07hz@He!0hy0HhwHh`PHK?1KH7!"H 44H RK B4zK?14@H5!I?4zH K?14?4z@4 H>H4K>K?)K?!K?K?K? @O?ˀK>و>4HHK?1I7>@ˀeK>ˀUK>ˀEK>k?ok? J67$0k?!j""҇  hk?Hw04@K? *HHyK?A7 ˀK>Hw04@K? ˀxK>k?Hw04K?@`J ˀ0K>k?H}04@ K!ˀK>ςK>HHyK?17K>H0H(K?HyKK7XK>Ht k?4Hs0k?@pHwK>HHy7Hx0Y7K>4v .7?/HHy7K?K?7hK>Hu0JK?H Hy7 K>Z M@4K>K? @O?k?ok? k?k?k?!6J4,k?1K>7D7# 44. :HJKH0Y%Z4. 78%B jH0 H ( 78:H "+4:49]I4HH`4?"06 H @K K 4k? 44yK?1_H(Hk?K?1HvHH H(%7(@HJ4 ?Gk?HvK?17K>K)4k? 44y_ K?1)HK4 ?k? 8H ,84k? 44y_K?1,RHH4 ?k? Hk?H44y_ K?1'ˀ`K>k?H44y_K?1(zˀK>k?H44yK?1_uK(ZˀK>k?H44yK?1_%J)*ˀxK>k?H44y_K?1+ˀ0K>k?H44y_K?1+ˀK>HH0K$KH@JHJ4K?1HvHe7 `K>ي 2HvKK?1%7 K>44_ 4 07HvK?17 K>H 04  zH jKH@@@HK344@Jy0ˀ HHHH$K?1HHvH7 K>"046P<4 ^7ˀpK>HKHW *HvK?1%7 K>k?K?14_4yK>HvK?17K>Hv HK?1H}7xK>Hv(HK?1E7@K>Hv0HK?1 7K>Hv8HK?17K>H KH@S@44@4;Hˀ`K>+4: 49p]I4 HH HvK@4Hk?4H04K?176@ˀK>ˀxK>k?K?144y@x48K>H @Hv@K?14447K>KK4K?17K>HvHK?1u7pK>k?H44yK?1_H0ˀHJ6M@4?HH4K?1HvP7K>ˀK>HvXK?1}7xK>HHv`K?1HYHX570K>k?H44yK?1_H :k?H44yK?1_MK0ˀHHvhK?1KKK ]7XK>HKK?1Hvp7K>k?H44yK?1HW_m@ :k?H44yK?1_-H70ˀzHvxK?1]7XK>k?H44yK?1_H70ˀHJ3K4?HK Jk?K?14_=4y ˀK>ˀK>HK(4K?1Hv4K%7 K>HvK?17K>HvK?17K>k?H44yK?1HW_@pK>HK44yk?K_K?1 K>Z@4K>K?!K?K?K? @O?k?ok>k>k>k>k>k>J67Ek>K>%7$44H|k?(4k?h84Hvk?04K>H447&@H$@K!:K`!(4k? 44K>_ H&`@H JHHK>H H 7 ZˀK>YHk?K>HHH H( u7%HaH?4 >k?HgH K 4k? 44K>_ uH%*HHK>HH 7$@H|K4 ?Wk?HfH "jK"X4 HK>H 7$h@HK!4 I70 0k?K>4_ %4$ k?I744_ K>#I?( k?I8 k?I90(4k?K>HI9I8I7 7 bˀK>YI= k?K>HI9I8I7 e7#@H5 @>w HK> 7"@HvJ 4 = HK> 7K>YK>K>K>K>K>K>@O>KH@="44@4x! HH0K HxK( h8Kk?K>44_=59U@ˀK>YKH@BZHhI4K>HHw%7uK>YˀeK>Y+4:49\4juHhˀK>Yˀ K>YˀK>YˀK>YˀK>YˀK>YˀK>YˀK>YˀK>YˀK>Yk?ok? k?K>7#k?1Hk?!K@k?)!k?H4yK?!_5K?)!@K>04Hv0K?)K?1E7!ZH k?H4yK?!_K?)!"Hv8HK?)HH 7 H?k?H BK?!K?)4y@4 H?K?!HvPK?)%7K>K?K? @O?ˀK>ˀK>ˀK>ˀK>ˀK>k?ok? k?6J7$k?!@Pk?)!H( @Hw 2H@HyK?)7!@H( RK BK?!K?)4_4!RH?K?!He H@K?!K?)4_4!H?K?!Hw K?!4@K?) @Hx( @Hy *HHHy K?)7 z4K>K?K? @O?ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>k?ok? k?k?k?!k?)KFH7C7$k?1 6HyP444`HP  p@  @HKK?1HX7 HxP7uhwPHhzH7F@?-h`P4K>K?)K?!K?K?K? @O?ςK>ˀK>k?ok? k?k?k?!K77C 0@7% 0"+4:49 \4|HHHu@jHgX HJxH  XH H4z@H4 bHH"HC  2C_@ Zi4?u@H?%@Hv86h}84M T 744\ E7  H|X hfX4K>K?!K?K?K? @O?k?ok? k?k?k?!7%7C "7"H :HHEH!@H"?@H :HHH!@HB?@!H4, H4.!z4. H!H!HH&!7?ā!!H` 2K K!K?@k?A7?9 0k?IHb`4k?9hf`H6?󶠇4?u 84 XK>ˀHK>ˀ8K>ˀ(K>ςK>HK4z_-4 K>HK84z_4 K>ˀK>ςK>HH _84 XK>ςHK>Z@ˀK?9H H84K?90ˀJHz@@K 8ς4z4@4hK?9H H840K?90ˀJHKJ KH C_C8 rHH ZZi@ B4H44@ 4H ?C_H84' @H84K?9HH_-4zK?9HHJK p@JK_4z BHHJeJ0404 (ˀ0ς H bH R4z_-@ 24H 4H?4zH84%rH84XK?9HH_4z(K?9HHJK 84 JK 84*JK_4z 4HHKJ 84 KJ=84*K J S84KJ_=4z 4K?9HHKJ 84u#KJ_4z 4XK?9HH4zH9_uK7 4"HH4zH_%H 4K?9HHJK JK_4z @HH4zK_}J BHHJK0404 4(ˀʐ0ςH bH R4z_@ 24H 4H?4zH84!"H84K?9HH_54zK?9HH_4zK?9HHKGKHZ 9J704 BHH4zHHX_e@ 4K?9hw`K>K?!K?K?K? @O?k?ok? k?k?k?!k?)K$k?1KHHe0404&HH|0404&zH Ha u049045&BH(Hb(8484V& !H!rH!bIHCCB"%IH%@IH%I %H Z @%p@IZ H%@IK?1^4HK?17^}4K?15_7%4H 4H>IH$H@$H( Hx(_K?1$H H HeH JK5$rJKV$ZJK$BJK_]K?1$4H 4H?gJH#@H#H "@H"Hc Hg"rHHCAC3a#rZ@#ZHH0404#"!@H!H!rHIC]C!"HIb"HI"H I "H(I("zH0I08484"BZ@"*HI_ K?1"@H0 @I0_ K?1!4H 4H>HH!H !4H 4cHg=HH!P@Hg!:4K>K?)K?!K?K?K? @O?ˀK>ˀK>ˀK>ًY I(H(:gIˀeK>ˀUK>ˀEK>ˀ5K>ˀ%K>ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>k?ok?7$k?MH7:K?77Z4d 4|K?YK?@O?Ku4Ks4 k?k?ok?7$ KCKa?4h 7Y_mKZ7 X@Ka?H7 : B4 4K?YK?@O?@x#47O4 7@4z4k?7#k?47O$4 Ka?K?4:@Y e7K?Y@7?k?7#k?44 k?O7Ka?K?K?4:@Y 7K?Y@7?k?ok?k?k?7&76M 4744\7 fK?44 d e Mhxh|74?4|hypK?YK?K?K?@O?k?oK?h7# Xk?A,4y @Hyp^ K? h`h4?hwpHc` RHx04Hy^ K? H |Hc`?Hx4K?Y@O?ˀK?YˀK?Yk?ok? k?k?k?!k?)7#K9 7k?1K>6 K>4Ȉ "@ Hz( @^K?1%h`@Ha 4haPH|0Hb(h`H0hb0hzM 4h|h` 4?O4?"06X HeH &Hh$Ha0Hv8$  ^ 1K?1$@K?1A<4y$Htx6(huxHfh @@ 4Hp ߘ7K?1A4y$h@K?1^)4$Bh`h4?hgp@$(@Hf $"M 4ph| @!Hh% Hh Hy8 $ K?1A4y$@K?1^94#h`h4?hdpHbH@ $bK?1A<4y"@H|0Hu8  ^IK?1"Hsx6}?Ch}x ;449PO t4 Ka?4:@Y7ˀK>ـ @Hp'hdp4tZ4 @C4̂ 4 Hxh @Hp 4 7K?1A4y"@K?1^!5!4?h}pHh4hyh hd8k?K?14y4k?@4" ˀK>ˀK>4 [44YO l4 Ka?4:@Y7ˀK>ˀK>ˀxK>ˀhK>ˀXK>ˀHK>ς8K>4^ MH4(h| 44I4h| Y4hd(ˀK>ˀK>ـ r 4Y4 4Hhe@4Y4 4hv@4h|H4K>K?)K?!K?K?K? @O?K?1]=4?4ˀK>4z4A \4K?1]4?G4ˀ=K>A D4zK?1]7>4ˀK>4z4A l4>4ˀK>Hz8 D K?1^4>w4ˀmK>K?1^4>?4ˀ5K>K?1^)4>4ˀK>Ku5Ks5 k?_@/0$@k?ok>k>k>k>k>k>K>7#7k>4t4ZK>k?!/@4tC B7k?!Zy4t/k?!C?7@4HHz@ /4@4?.4_.4ʃ.4.4."46O4 7_4K?! (@@4@V%24%"Ȁ@K?!k?K>44y@7?!/7k?704K>]4/rK?!C4v$*k?7K>4k?!4y@7?!/K?!C?k?4(8@K?!C4v#k?7K>4k?!7?!@04y/K?!C?k?47?Yk?K?!7?!C 0k?!K>4y@4.7.HgK>^4.7K?Y (H|(4cHxKCA@' Y%4(HcHw?Hx@K?!C4z+z77k?!C4_+4Ҁ+4ʋ+Jk?K>47?!@ 4y+7K?!C]4X+[@K>74^4x ˀK>Y7?Yk?K>7?!4y@ 84,X7,ZK>^4,JK?Y 4K>YK>K>K>K>K>K>@O>_47K?!Ka?H?7k?!(C  *K?!C4P 4Z(4 k?K>47?!@ 4y)7K>4^ 4>4ˀK>Yk?K>47?!@ 84y)7H}HgKB0`xHiI! H:C] 87ZCW@ Y 4 4?_5)4k?PI9PK3 PK4PJv0P k?K>4y4A 4=4ˀK>Yk?K>47?!@ 4y(7k?4 K>4yk?At4Y74k?!K>7?!@ 4y'@K>44^7K>^7'k?K>47]4;4ˀK>Yk?K>47?!@(4y'7k?K>4]}4;4ˀK>Yk?K>47?!@4y&7k?4 K>4yk?At4:o4ˀeK>Yk?K>47?!@4y&7k?4K>4yk?A494ˀK>YHvHuJ |94K>4^4%K?Y =4k?K>47?!@4y%x7k?4K>4yk?A484ˀK>Yk?K>47?!@P4y$7k?K>4]48/4ˀ%K>Yk?K>47?!@4y$x7k?K>4]474ˀK>Yk?K>47?!@@4y$7k?4K>4yk?A474ˀK>YςK>Y_4ˀK>Y+4$ 7K?!K?!+4$ Z@7k?!C87?{4?"6( _4ˀK>Y_4ˀK>Y_@0HK>]U454ˀK>Y[@K>7]45G4ˀ=K>Yˀ-K>Y_ 4ˀ K>YˀK>YˀK>YˀK>YˀK>YˀK>YˀK>YK?!C4h8%k?K>47?!@04y8k?ˀ=K>Yˀ-K>YˀK>Yˀ K>YˀK>YˀK>YςK>YˀK>YˀK>YςK>YˀK>YˀK>Yˀ}K>YˀmK>Yˀ]K>YˀMK>Y_)4ˀ-K>Yk?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>iK= 6H7#h`Ka?H?7k>qH44(k>yAz4 ?4?*  HC4 P z4Z jk>k>HA5ҷ 6?U4?#[7X 4@7>*H@04z0* :K>@*K>ɀ@4zAX7> <H7 4 Bb">H4 P4 Z4 v4 4HI6)pB <>HB W( w8>M@ 05A)"5A?@5 C) 84HCi?HHK>q44y_4,07HC4 X,k?7K>q4 4y_4+7L $4PHC4 v4 7 4 +5M7m( 5k L \57k?K>q44y_4 +@HC?M5H5l ( 5E?  ^K>q*k?k?K>q44y_4)7HC4Xp)k?7K>q4 4y_4)x7K>q]m4܀X@C4+b7 K>q4y4A 47+K> *K>q7>4yAh4+ 0@K>q4^ 4044K=K>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>C4F;k?7K>q4 4y_4'7HC4v'zk?7K>q4 ]M4ܞ%@C4 ꁿ#4 #4ʁ#!45O H4 K>y_Q7H44: Y 4xH7Y 4t4 x4 t#`7` g@, rAx4 H5g4| X8 #7?4@?@@I#  ZH 'Z4 0@H ' 4  0hlk?H 4yA0K>q4ܛ 7? 7?1@4"H@K>K?1\":K>K?9" @] UK>q7K>;M@K>q7>4yA4;@4Z=@m4K>q4yA7>ܛ=4Z@@_K>y4[7RT6҄VH̟HHu4H]4HE4_K>yM4 <4<@4_K>y44 K>q44yk?_54=74k?K>q44y_4K>q] 7ܘ@k?K>q44y_4K>q]m7ܘU@k?K>q44y_54K>q44]7ܗ@k?K>q44y_4K>q]7ܗ@k?K>q44y_u4K>q] 7ܗ=@4_AK>y44}4_K>y]4M4_ K>y-44_ K>y4444k? K>q4 @4]%5ܕ@7>k?K>q4y4@H4ܕ@K>q@ 4ܕ@K>q@4ܕe@K>q@4ܕ=@04k?K>q7>k?4y4@4ܔ@_ K>yM4k?K>q44y_ 4K>q7]e4ܔ]@_ qK>y444k?ok?k?KD7%4P@ 07C 4_ 4z 4 s4_ a4z H4XC 7 }4_ 4z H4RCU Z7 v4K?YK?K?@O?_ 4ˀK?Y_ 4ˀK?Yk?ok>k>k>k>k>k>k>k>J67k>64k>_7?A$K>KK?A 84} KK?I K84I?C4zH B #K>457k?_ EK>ك#x7I?C4 vt 7 'I<k>7?_5:I?C #77 *7?_q5:I?C7"7 9K? K?  !;K>59PZ40 *594.Z5Z"p@K?@0 "595ZZ40"R ;449N4 7_4z!R"0""  B*0BB0"Z r4#" ZcB4#b# K>4]4K>Y0pЀ_7J 5 *4h#ן#?#҈_4zˀK>YˀK>YˀK>Y_4zˀK>Y_4zˀK>YK>4]a4pK>YK>4]14@K>Y]K> K>YK>]4K>YK>]!4K>Y {4yY4 0@K>4]Y4hK>Y4y Yq4 0K>4] 4K>YK>4]4K>YK>4]4K>YK>ѕ]y4K>YK>4]I4XK>YK>4]4(K>YK>є]4K>YK>K>K>K>K>K>K>K>@O>K>4]q4K>YK>4]A4UK>YK>4]4%K>YK>K>A7?A Z#47PN4 7_4zK>4]y4K>74]5eK>Yk?ok? k?K%47#k?!@ 4 Ԁ44 C4Ƌ 7 b4^M4zHC4v `@^M4ˀ K>^-44K>K?K? @O?7 v4^4zHC4v @^4ˀuK>7 |4^-4zHC7 0v a @]K?!K>K?!ә]4K>k?ok?7$H4k?4^Uk?HC4v 74^4HCW4v p7f ` `0 j]QK?K?YK?@O?^K?ˀK?Y^K?ˀK?Y]aK?K?Yk?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?aK$4 Z7#k?q@7 R4t *He4 b@F?@Hj5K kL 4P7L 4PHzC_47!4 4v!z4 X?!j4 tCSs 7M5A?5^ M5 t74^M4zHC!75N7P x4 4L P574L 057 , Hz5C_ 8 >CS  K?q H74C0v g]Y4K>K?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?^4ˀuK>k?oK>k?6k?!4k?1k?)^k?k?9K?7?QK?!@K?1!7?ak?K?7?YK?!@K?1!rK>k?7?ik?K?K?!K?)@K?1!"7?qk?7?yK?k?K?!4w@K?1 @K?a :K?Q *K?i K?q K?y K?Qk?K?ik?K?qk?K?yk?K?K?K?9]iK?YK>@O?ˀK>K?YK?K?]1K?9K>k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>4 B6K7k?@i"k? 4 4^4HC4X7"7 4L@ 7!4 4 b4 d!4 v4`HB_"B"@H45N 4 7^44H7 4^4HC7"zk?7K?4 K? _i4"P7k?K?68]Q5 " HC"5)7&}  4 hK>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>ςuK>Y^54ˀUK>YH46} C띟4 נj=4H45N4 7^4HU4MH=H^54ˀUK>YˀEK>Yˀ5K>Yˀ%K>Yk?ok>k>k>k>k>k>k>k>k>k>k>k>K>674v4 K4k>4Pk>Lk?HA 74 H4 4 t4 \5̀"4 L47A ?(! AY H7]  K>K>@4!JHA?=54 gK>YK>K>K>K>K>K>K>K>K>K>K>K>@O>5Y4t 7Bx?7 k? K>4k?@XK>>HˀK>YˀK>Y^ K?ˀK>Yk?ok? k?k?46K7k?!@ k?)^ -4ˀPK>k?44_ @F44_ 2Yˀ4̀ 4Ā #47N4 7^ 4H [C4F4t @^ 4ˀ@K>HC 40]K?! P7"46@N4 7^ 4 ;49p#[4H7ZHܞCk?7K?!4 K?)_ 4k?1H4XC5 @^ 4ˀK>7 4^ M4HC4vt 7^ M4ˀpK>k?74K?! K?14]k? |04K>K?K?K? @O?k?ok? k?k?k?!K7&7k?16^54k?944^ @ (Ƞ7 wB4dZ B4` :Hbx4Hb`4ȠPHb#47N4 7^4Hb44G gk?K?144_ 4w @74K>K?!K?K?K? @O?HC4t 7 zX4v 7^-4ˀeK>k?Hz^ G4 K?17K?9]4K>|44K>:4Xw ^m4ˀK>7 v4^4zk?AH4XC= @^4ˀ-K>7 u4^4zHC4v @^4ˀK>K?A7  a04k?K?14k?K?9]K?AK>ς5K>k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=K=4v6k> Jk>C]k>1k>Ak>Ik>)k>!'8k>"6 k>94tX5@&7@4t&HzCU4ވ5 *CV4V C\4H!J^5 F4ȼ x!5 4Hs6z zXU4v'(7K> k>5Y]4&< 04 K>7?Q]15Y04 Hz^M M5 A4 b&70` 4 74 f@4\ (0*4@4 \ ?44\%Hz^a F4 7K4P474 4k?K> 44w_K>%(7H}C4t=Hs^K>ˀ8K=Y"46`N4 K>^7HC4~7 44\W&J4TW& 7 x4^4zHC%"7 Cӑ(%@5%`47 u7 yX%475zY444%X44 K=K>@xK>%7K>]5Y%k?K>17?I5k?K>4k?K>k?k?y@k?q$7ˀK=YK>5X] i5 \ 4@%HyC? 5i:@ I  H7CK>)6 wK>AѠ2K>A5k>A K\K>Ik>IK>45X]K>IK>)k>) |HzCRD84tK>IK>) 4K>IK>!@ K>I (K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=^K>ˀ]K=YˀMK=Y^K>ˀ-K=Y4 7 CӳK>96w?4?W 447 |7⚝ b7š a7 oše4]H^K>ˀ-K=Yk?K>44w^=K>HC4t:7@p@^ K>ˀK=Y"K>^Y6 47 v44 :@k?I5+ˀ"4 K 47k?K?I;k?k?K>5X5]ik? G ˀK=Y^K>ˀeK=YˀUK=YKu4AKs4I k?k?ok>k>k>k>k>k>k>k>k>k>K> 6k>@04 k>K>k>K=k> K>@04  Ka?H?$@ \ 4  @@)04  R@ 04  2!54Y 404  @5'(4 "4zX404@04J@0H4 0\4@(04B [4Y 4Y 404_ : k?![7?Q5Y 55X5:4 X)5:  X 4@4 "@6@w4""@4H_ 4\!4H@4z"7Xi4K 74y4_75ZX 45ZZ 59 5ZZ u45ZZ ]4 @ HK>7?1@ K>#7ˀ K>Y 4 K>K=+` 4, @ 4- ``04, P04- p ![7?Q5Y 55XA5:]@K45z7] @Y@@XA4|K>YK>K>K>K>K>K>K>K>K>K>@O>5ZX -4y5Zk?K<4K>7K>\}K>%K>YK?1k?K>K>\=K>K>Yk?ok? k?k?k?!k?)k?1K>4v7 K>6 Kk?A@% k?I4 iHC4!7 C4zw 4V 4Z 7 bHC4J!r7 i7?q_4z!RK?qI_ *K?yI< 4  iK?A44wk?^-K?IHC 2 "7C ?7 7 4K>K?1K?)K?!K?K?K? @O?ςK>ςK>ˀK>^ I4ˀuK>k?ok>k>k>k>k>k>K76k>7?Ik>7?Q_qk?I!P@K?Q!K?Y!HB4z?!b"K>]6 p 07K>4\4 7K?I 0C Ka?H?CZ!84 07 Ka?H?!B \׀4K>YK>K>K>K>K>K>@O>k?K>44^ K>HC74v>7^ 4ˀEK>YY@ 2HC4Z 7 44^4HC4v>U7^ 4ˀK>YY@ 2HC4Z 7 44^)4HC4v 7^ )4ˀK>Yk?7K>4 K>^ 4 7ˀK>Yk? 4k?K>4\ 5%K>Yk?ok?k?k?7C7%7K40H`7HwXHzk k(Hy78 hxHzh|`Kh|Xh|H `K?YK?K?K?@O?K_X @K\PKkYXKWK  k(K_X @K\P@Kk?ok? k?7KX7k?!7CKZ Kxhh|Hd` H HXAK?! H?@ `@HyHz75? U H(4K>K?K? @O?"46 M4 K?!^7H}Hs7? | e @k?ok? k?k?k?!k?)K>7#76 0K>Hh Hw@ HxH K4(744(Z7Hy 4   i hhK>K?)K?!K?K?K? @O?k?44\I4K>k?ok? k?K$7# hk?!H k?K?!HH\H ZHX 4?4h`4K>K?K? @O?ˀK>k?ok?k?K$`xK#KXb@#47 Md4 Ka?4:@7W 4xˀ`K?Y"{46y M4 Ka?4:@7W E44K?YK?K?@O?KW4 e`` H 2K4 47Zy44c?ሣ_HH 2K(4 47Z4H6 k?7K7 k?K`27:_7 87ˀK?Y@@K?Y@7?K<?@K?\Y4K?Yk?o7:6_7 04K?Y@O?k?ok? k?7`hk?!4?D@R7# d 4?4?#7 h  ;449 PM4 Ka?4:@7W 44K>K?K? @O?"K?!46 p\4K?!#K?!47 \4HK?!K?!4\Q4 4 [K?!44E \ 4K?!#K?!7 4\4K?! ;K?!44% \4PK?!"K?!6 4\I4K?!"K?!6 4\ 4K?!K?!4\4"K?!6 `4\4pK?!"{K?!\96e @K?!#K?!7 \4K?!#[7E K?!\i4K?!#;7% K?!\14K?!#K?!47 \4XK?!#K?!7 \4 K?!"K?!6 \4K?!#K?!7 \I4K?!"ˀ6 K?!4\4 X4 @ [K?!4E `\4(K?! ;K?!4% \4K?!#K?!7 \4K?!"K?!6 \Y4K?!"K?!6 \a4HK?!"K?!6 \)4 K?!"K?!46 \ 4K?!"K?!46 \4K?!"{K?!46e @\4PK?!#K?!47 `\I4K?!#[7E pK?!4\ 4K?!"{K?!6e 4\4K?!#K?!7 \14XK?!#;7% K?!4\Q4K?!W@K?!4\u7d  \k?ok? k?7#6k?!]7K?!74\ 7 7W-44He!bHC_@ W]4 H?@4(K`@744(Z Q7Ht 44 K> K?!\1 h heH 4K>K?K? @O?HK>0 W4H ?}@4(k?7#k?47M4 Ka?K?4:@W!7K?Y@7?k?ok?k?Ka?H?7CKTB4 4$ < zHvB6 S wH s 75?B p  Ӝ?Hv4K?YK?K?@O?Y)@-@Y @k?ok?k?k?Ka?H?7CKUB7$!* <!2ˀK?YYi@ Ka?HHeH?@4 X@  73?! }  Ӝ?@@40 b0 4K?YK?K?K?@O?Ya@>@Hf@6? He4Ka? tH?>}B uY@Ka?H?k?77_k>4k?qk>4k>k>k?k?ak?iKk?yk?7?a7>@hk? :K>Bt j7?a@`7> H@K? @WE@K>4@7?WK?k?K?q B#470Mt4 Ka?4:@W7K>K?yK>K?q@7?Ku6Ks6 k?k?ok? k?7#4k?!K:X47 7C?7@!z7E?#7_%47?Hu 4% h@Ka?H?! @ <! @@4!4 Ht X@Ka?H?!@ Ӝ @4X @@!@K?!4y@4`K>_Hzˀ@K>Yq@>@4 z4K>K?K? @O?Y@@@D 4@d?4#;79W 4 7C @_Hzˀ-K>K?!@04yK>_UHzˀK>k?oK#7k?`? [4Y4X4z j@4H 4\ B4a k?K?4@7? ˀK>@w4 x@@z_ b@x4ފ J@y4 24|k?K?4@\7? 4K>@O?ˀK>k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?YK.7#7Dk?aA4 4 !4 44444 4 "r#"!?#Z_#6?B444@4y"4 ˀ(K>44@x4y05"@Hz 4@5"z4 4 444@4y"4 HnA>@ *444@4y"4K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?44@4y H} 4@5 ɀ4 44@4y05!(@Hy 4@5 ɀ 4 ˀK>5 x05>Hn45 w05ˀ-K>5 s444@`4y4 ?]4 ˀK>ˀK>_K?aˀK>ˀK>ˀ}K>k?ok>k>k>k>k>k>k>k>k>k>k>k>k>K#47$@7E$@77?B@u 5?4k H5M 4 #85(?4 4 5 HC 7 HC== Q44@p4%"k?WMK?QHH7_ MK?QK?QW 7 "*ˀPK>Y_ 4HW7z!ʀ 4H\q57 4 H]5I 75\H$7H\6 7WM5 @  ?5@6 W5  JH]5H7\977W%5 J 4k?HHH_ %5"7H  <5? 4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ka?H?@z4*!4h <! @v4` @Y%5I_@z 7 Ӝ :I_5 A Ҝ?5A 5 _ e4zˀUK>YX%@>@v_ %4zˀK>YX@@X@-I__4zˀK>YˀK>Y_4zˀK>YˀuK>YˀeK>Yk?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK#4n7$k>7:k>_.(k? WHK? H  7? _ 4(K? #(4!{Ka?5g 4&44 4 \4 HA&z5 K>4@4"rˀK=ـ" HC0 7 HH)x@:  JH7S H)PBz |?HHCO 7 H)B Ѽ JH7= H(C ќ?HHCn 7 H(B \ H7 H(CZ <?HXK? B7?a_%4(@@HK?a  K? 4@K>#Hr]4z 744F77W44G p47W4'j4W4'J4!4 \ 4@4|Jah5Y?C] *CA 8CF? 77ZC] *C\ 8CE? 77ZC] *CV 8CC?x 77ZC] *CU 8CB?X 79^7Z79 C] *CH 8CI?8 7?7ZK>]4WY44K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>K>4@ 44 4444!4A? Z7?{4? 44  @?7?{!@HC2 7 HH!`@Z :K? H7 H!0B Ҝ?HK? _4zˀK=_i4zˀK=ˀK=B4  B4W1@W!@BU4BE4B54B%4X@@Xm@ǀ bHC1 7 _49/K? _!4zˀMK=ق6@_q4 0@_4zˀK=X@}@Xe@@XE@@X%@ @X@M@X@u@_4zˀ K=_4z @W!4ˀK=k?ok? k?7K87#k?!_7:HzW7 @_ K?!ˀHK>ِ H Hw  y4K>K?K? @O?k?ok>k>k>k>k>k>k>k>k>K)4 7#k>77Fk?Y 6J 4P  k?aH4C(0z4ʁ!j4 4 7?Y4  7("7 vX"k?q7?y_4z""K?yH(*K?q6a?` k?qk?K?y 7?H W7?a4k?@84!K?q7??k?qHC(0 >@ HK?a Hl4 A *4 Hx7 y4K>YK>K>K>K>K>K>K>K>K>@O>7?q_4z=7?y_K>ˀeK>Y_K>ˀEK>Y_K>ˀ%K>YˀK>Yk?7?a44y@ 4>HˀK>Yk?ok? k?k?707?k?!K%7&64@HK?!!@HK?!@4  K? K>Hz7XK*6HJ HHv K?tH|7 a4K>K?K?K? @O?ˀK>ˀK>k?ok>k>k>k>k>k>K&#78@Ҷ6?`4? 7%7D74 @? 44 @Ka?4)HI?'B <'HB6 X C?  7\?  ?oHHC4 '27 44_4x'$R#H[7 p @H4[4k?H47k?[5Hy |7?97?A4_54&HC4&7 44_4x&#(@HHyK?9[K?A |7?i7?q4_e4&HC4&7 44_%4x&"ZHK?a[Hx( |A44%Ґ`07?a4_4%HC4#7 k?aHKa?@Sk?ig04k?qH5 H?$B \>H_4HW7jH  `> 4k?H5_ yH>k?aˀxK>Y4 44_4x"j @H[Hy |4K>YK>K>K>K>K>K>@O>4 7?)_4"JK?)H(RH  7?1k?14_4x?'4ˀK>Y4 44_4x!`>4H[uHy |4 7 HC4":7`;U U44 44_4x"ʀ`=4H[Hy |ˀK>YˀK>YX@8oH_ 4ˀuK>Y_ y4ˀUK>YˀEK>Y_ I4ˀ%K>Y_ )4ˀK>Y4`9 4ˀK>Y_ 4ˀK>YˀK>YX@U@_ 4ˀ]K>YˀMK>Y_ Q4ˀ-K>Y_ 14ˀ K>YˀK>Y_ 4ˀK>YˀK>YK?qk?HyK?a[eK?i} |4 44_4x;G4ˀ=K>Yˀ-K>Y44_4x:4ˀK>Y44@ 4x:4ˀK>Yk?ok? k?k?k?!k?)7'7DK:k?17444444444HBt!!b!r!6s 6 Ka?H?)XA )Z7?q4_ 4)R'@K?qH\ Sk?9H[7 |WyK?9Hu'"k?K?qHH _yH& |ˀ@K>6u8 6t 6v Ԣ4>@HB4? [4A < _K?1  J [H4Y [ %@  |[H |H7  p@+ 49 049 [ H ( |H5[4 |H6  p@+ 49 Б049 [ H ( |H5[4 |H6X  p@+ 49 049 @[ UH ( |H5[a4 |H6  p@+ 49 P049 [ H ( |H5[4 |H6y  J ;H[ 549 |H[4 |H7   H+(49 + 49 049 [ }@ | "H5[4 |H7W  R#H[7 ( |H4[ 4 |H7?`  J"H[}6  |H[4 |H7  J"H[6  |H[y4 |H6p  J"H[6  |H[4 |H7  R H[Hy | @H[Hy |4K>K?)K?!K?K?K? @O?` 44_4 `?4VeK?4k?H7H^UK? |VK?H|>@ˀK>X@67?q^K?1ˀK>ˀK>ˀK>^K?1ˀ}K>k?ok?k?KW(7C7%K_0077h0Hz JH h| Hy Hs( 3 4EHx H}(  Hu(6hv(K?YK?K?@O?k?77?7] p7k?CKa?"{ k?K4:@6yKJV @K?YKKa?" J4:@Vq6K?Y@7?k?7# k?47L4 K?4_7K?Y@7?k?ok?7$k?J`7:K?77W)4d 4|K?YK?@O?k?7@4K?Y@7?k?ok?7CK:HuUrC_47Z@:4@ 4@#7D?$4` ςH_4zˀ0K?Y4 4K?YK?@O?H}7? _ 4?]_U4zˀK?Y!P6?]Ks 7?K!@"S K!4"_"HaR@ Kւ 7?K3B| K$45Kׁ K=C K#4t4K K$@ K"4S3Kֶ K#@t K!4=Y~=4 ςK?Y# 47 L4 74z_4ˀ-K?Yk?7@k?K?Y@7?k?ok?K=7CKZhK?C47:`x=Ht!7?$4_4z4K?YK?@O?4Z P@C7=Ht \_]4zˀK?Y4?@CC7u 6Ht˶} S " 46@L4 74z_4ˀK?Y4K3 z 5 ςK?Yk?ok>k>k>k>k>k>k>k>k>K"7?7%k>7C7444  4 !{ 4z_4#HsJ# K?yKЃ @K?@"RZ7ZTbK0 47?aH7?i4z_4!K?i H@RU6ҵaK?a u7?aHB`6 >w7?y7>J45yL4 74z_57?aRV6a4?H?HT?  \m4G4?!H? 4K>YK>K>K>K>K>K>K>K>K>@O> 44pLx4 74z_}5ˀUK>YˀEK>Y 44L4 74z_5ˀK>Y 44pL4 74z_5ˀK>Y 44 L`4 74z_e5ˀ=K>Y! 45`L4 K>7_ 4zˀK>Yk?ok? k?k?4x7k?!7C4}X !rHsk?)4@ 444?#7(_ @K?)4Z4 [ 4Y 7 @K?)[4܀K?!4?_4zK?)[1774|X @ ZK?)474vX f4K>K?K?K? @O?+4: 49 0X4=4|X ; 449L`4 K?!7_e4zE4ZK?)#; ܞ=79K?)4Z4# ܞ7K?)4ZU4" ܝ6K?)4Z4# ܝ7 K?)4Z4 [ ܝ]4YPK?)4Z4 ; ܝ%49K?)4Zu47# 7K?)4Z54" ܜ6K?)4Z4" ܜu6K?)Z-4" ܜE6 K?)Z4"{ ܜ6y 0K?)Z4# ܛ7 @K?)Z4 #[ ܛ7Y `K?!4&_4zk?1K?!4z_e4 4?k?4K?1k?K?)4Z 7#; ܛ 79 K?)4Z]4# ܚ7 K?)4Z%4" ܚ6 K?)4Z4# ܚe7 K?)4Z4 ; ܚ-49 0K?)4Z}47# 7 @K?)4Z=4" ܙ6 PK?)4Z4" ܙ}6 `K?)4Z4" ܙE6 K?)4Z4"{ ܙ 6y [ 44Y L4 K?!7_ 4z4+4: @49 X4*E4vXk?ok?k?k?KFH7C7$ـ704@ Fğ@HzPI &h|PHzH F4 X HsHHPצ3  ? 7 hfH rHtP H JI 4 4HzZH 8 4K?YK?K?K?@O?ˀK?Yk?ok? K777Dk?_ 7?0ˀJK?4RK?_4 |04K>K? @O?7>k?4_ 4 ˀK>K?HP4m }k?ok:k:k:k:k:k:k:k:  7>qk;I7;Y7j?4xj?!j?)j?1j?9K;Ij?Aj?Ij?Qj?Yj?aj?ij?qj?yj?j?j?j?j?j?j?j?j?j?j?j?j j(j0j8j@jHjPjXj`jhjpjxjjjjjjjjjjjjjjj6k=Yk;1k;9k;Ak;Qk=ak=ik=qk=yk=k?ik?q k?"6#4444 4 4 4wk?@ "6k?B?  _@"* B?!_!ڋ!27;1@7? *ˀK:Y7;1@7?!rK?/4wK;Q7;Y!ςXK:Y" 46 L4 7;17_4y4K:YK:K:K:K:K:K:K:K:@O:" 46 0L4 7;17_ 4yˀ]K:Y7;1@7?>K?ˀ%K:YˀK:Y7;1@p7?>_K?ˀK:Y7;1@7?>'K?ˀK:Y [ 44Y `L4 47;1_7ˀMK:Yk?ok> k>k>k>!k>)k>1K)587(A&87C_m7>(P47>7>4z_]5(4)4? „̊""Ȃ4?7>7?4z_5(K? ?7>K>_K>'7HzZ!4$ˀK=Hu( RK>_K>(7HzZ94(4h|(7?)7?94z_5(R7?I4z_5(*7?Qk?7?17?A4z_5'4 ?7?a4z5_I7?Q'@K?Q@#J"?7?a8H 7? 4z_5&"7?4z_5%7?4z_ 5%@K>&@HzZ K?%h4 !JĂR" 'rK>_9K>$7HzZ4$@Hz84 ha(V@h`8HzP h`0Vy@h`PH8!xh`HKhiHIIh|PHw87HxHJV H 7>4z_5#7>4z_i5#7>4z_5#h@K>44z_ 59!X7ˀpK= [ Hz4Y Z@"4h}(H 4t(j 44 KD4 47_A4zˀK=7>k>4_4z"BK>HwP%Hz[5 @Hz[!57K>_K>!7K>k?45HzZ4>H ˀK=k?4_4z"ZK?HPEHz[5 @Hz[57K>_K>!7K?k?44HzZ5=}@ˀK=ˀK=ˀxK=ˀhK=ˀXK=ˀHK=ˀ8K=ˀ(K=ˀK=׀4K=K>1K>)K>!K>K>K> @O>ˀK=#; K>Wq79  ̂UH K?47>4z_59>7ˀ%K=ˀK=ˀK=ˀK=ˀK=ˀK=ˀK=7?i4z_5 7?q4z_5 Z7?y4z_i5 27?7?4z_5:H ˀK=" 46 K,4 74z_)59ˀK=0 Hs 0 gHu 4Ht Ha 4" 5hb k?ok?KW 7_(7C7$6?hw J4 "Z#j !R!!rI4h|@Ha0Hz0 I Hb@ \H|0Hz@  KZVuHy8Ip4h|8HHH}HI@]Hw8H}8HdHKVHyPHs846zX484"6?Jj!?6?4K?YK?@O?7?4z_4! @Hy K4?4K?HzZ6?g4ˀ]K?Y7?4z_i4 K?HzZ6>4ˀK?Y" 46 K44 H7_14zˀK?YˀK?Yˀ}K?YHzZJ>O4ˀEK?Y7?4z_Q4>4ˀK?Yk?ok? K77$7Ck?_A7?y 7?7?4z_94 bK?y4@r" 46 @K4 K?7_4z׀4K>K? @O?7?k?yHd004@ D@ Hz8I h|8H}0  s  4 X  hd0K?yHz8 K? T4K?yHy8 s K?9 5k?ok< k<k<kk<4_4z7HC4D77 7<4z_ 48 K<4@7?kI4_e4z:K>IHwP K>QJ J0k>Q5p"5k I 57k?K>1k?_ yK>9K>QK17>94z_49K>A97>I4z_ a49r7>Q4z_ 949H@K>I /7>4z_5YK>Q k>Qܞe4,"5) I `57k?K=y_ K=K=k?7K5lˀ0K;ق67=4z_ !46K=р 5MJ5J 5I 575:I h57K=_K= 6 <K= , 5k?7=7=4z_ 4>K=ˀK;7=4z_43P@I4P744PX 74 4 7=Qk?7=A7=I4z_ 42K=Q`25,5*"5J I57K=A_QK=I <?Ok?ˀK;7>q4z_45J7>y4z_45"7>4z_I447>k?7>7>4z_ i44@K>?k?KyZ UKy4KyK>yK4z^=4-7> 4z^4,@K>X04K> ZQK4z^4,7>4z^m4,H7>7>4z^m4,K> ,K>ɑ04K%K<7>4z^4,z7>4z_!4,RK>,,JK>ZK4z_4+ 7>4z^4*k?4z5Y_4 K>k?47K>Z K4z^4'@H4P4 74  7>A7<4z_4'K<47>7>4z^-4(K<0ƴ4Z)KKˀ K;ˀK;#; 479 @K4 74z^ 5yˀK;K>ZKk>k>k>K'7$7C^}7?%27?!4z_4% H7?)4z^%4$K?!k?i"{ 6z pk?a(Hf7?94z^ 41R7?A4z^ 41*7?yk?4z47?a^7?i0K?)4| K?940K?A 44H@_ :1"7?I4z@4 :ˀXK>Y4z47?a@|7?i1K?A4Y4@7?k?Hf0߀ @Hv8  !K?)4|#J߀04߀@ F@ Hz8H , h|8Hu0 !   4W= hf0K?Hf8  # @7 pYK?Hg8 9 K?! G  Hk?aHk?i HfK?! Z4 K?) " 0 7?dRH 4 K?!44Y Hk?! K?)7?`4?#; 78 4z4@7?I%ˀK>YˀK>YˀK>YK?) *7?94z^4K>Y 44 @K 4 74z^4ˀ8K>Y 44 K 84 74z^=4ˀK>Y ; 449 K 4 74z^4ˀK>Y7?94z^40ˀJK?a^K?iK?! 7Y4k?!4 h K?9k?K?!44yY ]4K>Y7?94z^40ˀrK?a^K?iK?! 7Y4k?!4 h Hz@K?9k?K?!44Y u4 K>Y7?94z@$40ˀK?a^5K?iK?! 7Y4k?!H 4w( K?   "4h (K?!4h K?!0 4K?9k?4Y -4K>Y4 h ςXK>Y4 h ς0K>Y7?94z^]4 R7?A4z^54 *4z47?I^=7?y0ˀK?y:w4z7?Q4z4^7?y:?4zˀHK>YK?9K?IY4K>Y7?94z@t40ˀK?a^K?iK?! 7Y 54k?!4 h K?9k?K?!44yY4@K>Y7?94z^m404K>YK>K>K>K>@O>7?94z^4 *7?A7?y4z^4 ˀmK>YK?a^K?iK?! 7Y 4k?!4 h K?9k?K?!44yYm4 K>Y [ 44Y K4 74z^4ςmK>Yk?I47?9k?Q4z4^uk?Y R7?A4z^M4 *7?I4z4^U7?y ˀK>YK?y 7?Q4z4^7?y ˀmK>YK?y :7?Y4z4^7?y ˀK>Y# 47 K4 74z^4ςK>Y7?94z^4 *4z47?A^7?y ˀ]K>YK?y 4z47?A^7?y ˀ K>YK?y J7?yk?7?a7?i4z^m4 ˀK>YHC4Ĉ 27?I4z@4 ˀUK>YςEK>Yk?A7?94z^a4 R7?A7?y4z^i4 "7?I4z@<4 ˀK>YK?a^AK?i7Y4K?Ik?47K?A 44Y4wK>YˀK>YK?y R" 46PJ4 74z^4ˀK>YK?A4z@x4mK>Y" 46Jl4 H7^i4zˀK>YˀK>Yk?ok? k?K?77$k?!7C@ $7?I"(@K?I4 p4?4?"Z4_"4!"4!4z@4 ˀK>7?i7?4z@ ,4"7?q7?4z@ 4!7?y7?4z@ 4!7?4z@ 4!4K>K?K? @O?7?Q4z@ |4!"HHu4C4?w47?Y7?a4z@ 4??4ˀ5K>ˀ%K># 47Jd4 K?!7^a4zˀK>4z@x4>4ˀK>ˀK>ˀuK>4z@<4>G4ˀ=K>k?ok;k;k;k;k;k;k;k;k;k;k;k;k;k;k;K<77Ck<7<@4k<4zK<7<7<@ 4z4ZHd@4X4?HK7 01bK>k?5K< YH71zK>Yr&1_K<7?17?A@4z2@K<7?Q@4z2h@K<7?97?I@4z20@K<7?Y@4z2@K?I15?4k<K<7=@(4z,4 K<7=7=@4z,@K<7=7=@4z,p@K=K=^ 5?K=? 487H|0Hp8 1 P JK=ي JV9K=Ƀ 6(0@0eJYK< IK< Y7'7-*k?K< 568k?Yu57-:K<)5.ՠ2K<)6k<) H p47   .K<7>Y@4z,@K<7>q7>@04z,p@K<7>y7>@4z,8@K=9L 5?k>aK<7?@4z-K?ǿ@K<7? 7?@X4z-@K<7?@X4z-ZK<7>a@(4z+J5?K<7>i@4z+*K>YmD 5?Ha0Hm8 P@IK> IV K>y 5(͟@͘@K<4^4zK< 44Y7ɼe@ǟ K<7?!7?)@4z+ʭ4_?K>yK>P 4 4^@K>YK=9ǡ7*k?K< 55Yk?ɼX@Hk?K>a55k?K< k?YMk?7*rK<9 P4IK> IV K>q 5?5(K<1BKq4 K>   i II 73*7i IH II ] I6"iI B `/7=90`4K<9HH 746I 9^  (K< Y17h )h \55)(h TK<9k?Hk?Y eK< KK?K?K? @O?" 46J4 K?!7]4zˀK>ˀuK>ˀeK>ˀUK>ˀEK>" 46J04 K?!7]54zˀK>ˀK>"{ 46y0J4 K?!7]4zˀK>ˀuK>k?ok>k>k>k>k>k>k>K%7$7Ck>@`7?$ K? *7?!7?14z@4#7?)7?94z@4#K?"444f04 4H6?Bz H Y I8"*I?K?9"I:U}K?)!K?4!#I7 !⁘@H #@HzYH#X@K#47Y=Hz#P7K?)K?9U}5 @TM5K?9# 4 ?u44![ 5YJp4 K>7]u4zˀK>Y=4Hg@=Hp@I7 04 5?}5J?فa4w4 4He@!HK?!C]C5 BUK?1 (@THK?1<=@H?}@m4ˀxK>YˀhK>YˀXK>Y# 47J4 K>7]4z4K>YK>K>K>K>K>K>K>@O> >%@@XI$" K>6] 4zˀMK>Yˀ=K>YH  <4HzYaH R!; 459@J@4 K>7] E4zˀK>YHzYqHHzXe7 04EK>Yk?ok? K#47$k?@w k?" 46J84 K?7] =4y4K>K? @O? K?7?] 4 ˀK>4 CW "g Y6}?7" 46J@4 K?7] E4yˀ K>K?K?]4K>k?ok? K#47$k?!@wk?!Pk?4 CW "h Y6}#!b7 K?7?] =4!@K?7?] 4!P@K?7?] 4! @K?!K?4!K?K?4]K?!K>K? @O?# 47J4 K?7] 4yˀK> 44J4 K?7]4yˀ=K>ˀ-K> [ 44YJP4 K?7]U4yˀK>k?oU7#  `p 4c@4c?K?Y4|@O?k?oU7#  `p$4c?@4cK?Y4|@O? 4@ k?ok?K77$ 07CG4   dH4 K?YK?@O?K BK7 K:0? _K=@4k?ok?KV7C4JUx7$G4HK H}K|H} |HyK?74  DHx4K4#kK?YK?@O?k?ok?KW47DJ7#7j6 4u 4HH\4ԃ@HH44K7k  hy_47 4?M@0K?Yy_e4 4K?YK?@O?k?ok? k?k?47%8H7C4 7?`??4?7?ЁjHwJ4ԃ7j6 44 ZHxK@6k7 W 4?44K>K?K?K? @O?HwJ4ԃ*7j6 ς%4z_=4eK> { 44yJ4 Ka?4$@7SU44yP4S544y`S4ˀK>4_}4z>-@ˀK>@_E4z>M@ˀ]K>k?ok?k?k?7C7&Ti7:47HwJ4ԃ7j6  ςHwJ4ԃZ7j6? 444z_-4"*@ b4HxKj6k7 4 ?44K?YK?K?K?@O?4žןHwJ4ԃ䠲7j6 44HwJ䠒7j6_ ςe4z_u4>u@ˀK?Y4_=4z?gHw"4z_ 4> @ˀK?Y4_4z=4zˀMK?Y ; 449pJ4 Ka?4:@7S4ˀK?Y_=4z= ˀK?Yk?7"k?k?6_ k?7 4 "K?_uK? 4(@K?_=K? 4K?Y@7?k?7"k?k?6#_5k?7 4 "K?_K? 4@K?_e4 4`@K?_-4 4(@K?_K? 4K?Y@7?k?ok? k?k?k?!7C7'76G4P744PV7 @H  K> 4`HHy hdK>K?!K?K?K? @O?k?7@P4K?Y@7?k?7@4K?Y@7?k?ok?k?KD7C#7%"H "@H\2HbP!4yP_4z#2HwJ4ԃ7j6  4 34HwJ4ԃ7j6 _ 4 44_4z"`@Hy(_4z":04yPHe0!4y0_4z"2HwJ4ԃ7j6 44HwJ4ԃ7j6 ? 4 U44_4z!b# 7 p_4z!:4y04 _4z!ZHH4Th4K?YK?K?@O?+4: 49 Vq4"04_4z=_Hw"4_4z=4ȠE44_u4z>/HwȠ 44_=4z?@=4Ƞ4k?ok?k?k?7!6'8 E7EH` 2H HwHc`?@Gp4744Va7 f dH 0@K7K?@  4K?YK?K?K?@O?Hs 昀 f dH?4KHw4HzKW wHzT QKD?% dHHHz4k?ok?k?7C7%G4744V7 H4 hdK?YK?K?@O?k?o7Ck?KY jHzKXk?K_T hK?K?4_]4zK?Y@O?+4: 49 V4#:eHzk?77k?673k?46wk?@4?K?Y@7?k?ok? k?k?k?!K>77Ck?1$h7&xHd_ 4z&*HwJ4ԃ7j6 ? 44HwJ4ԃ7j6 444_ 4z%Z#; 79 p_4z%2k?K>4z4_K?1!27_4z HwJ4ԃ7j6 _ 4 <4HwJ4ԃz7j6  444_ 4z (@Hy(_ 4z>k?h7HwJ4ԃ7j6 44  44z_4 44z_ 4 4HwJ4ԃ27j6 4ςb4_u4z 4 4z_4 4HwJ4ԃᢲ7j6 4ς He4htHd4hK># 07 p *_]4zK?!K?K?K? @O?4_4z:7Hw74_4z?@E44_4z 4K?QK?IK?AK?9K?1K?)K?!K?K?K? @O?4_4z<@44_4z=4z44_q4z=@44_94zK?K? @O?ˀK>ˀK>4_4z=4ˀK>4_4z?@44_4z>@"4_Q4z>4ˀK>k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?YKUP x7C4yP_4z*HwJ4ԃ說7j6 4 4H|p"P@Hb`@*4e`4z_4*HwJ4ԃ䪂7j6 4 Z4HwJj7j6 4 =44_4z*!; 59 _4z)4_4z)4_4z)Hf4?_i4z)r4xp4z_ 4)J4z_A4)*HwJZ7j6 4 }4Hd4?_4z(Ha` r4y`_4z)*HwJ4ԃ7j6 4 Z4Hex *444?B04z(Hf 4y_4z(HwJ4ԃb7j6? 44Hz S]Hyh BHwJ*7j6 %44xP4d@4z_4'4x`4z_a4'4x4z_94'4z_ q4(HwJ4ԃ7j6 44HwJ7j6  4 44_4z'p@Hy(_q4z'J 4 p4z_A4'4_4z&4_4z&Hg#44 HaH,H #8HI0m"A("FIH I?@ "H K5\ A(K=F`I0IH rHH XHK5S :A(K!FI0IH HI _͢ 4 HwJ7j6 E4HwJ7j6 (44_ 4z%R4z_4%24z_ Y5%@I7_ )4z$4z_ 5y$HwJ"7j6 4 j_ 4z$Z4z5x5W_4$:H<@HwJ7j6 44ςHK>4_ 4z>'44_4z>@R4_4z5e@ˀK>+4: 49 `U4'*M4e`ˀhK>4_)4z5Hwˀ0K>4 _4z?@44_4z?@Hd4_4z77HexˀK>ˀxK>4_94z74ˀ@K>4_4z74xP׀4K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?ˀK>4_I4z84ˀUK>4_4z?@-4S @5 S @♕ S @ 4_y4z:E@ˀK>ˀuK>4z_14;@ˀ=K>@ @K?@ @k?ok? k?k?k?!k?)7$C9(79A(H0HHHe 0 H@H?@4 rHb2"4z4@4 H濕HK>4z44@4 B40 }S a@He4 zK>K?)K?!K?K?K? @O?k?ok? k?k?k?!k?)KS`7C7&7"X64y`_Y4z$:ˀK>4HwJ4ԃ礊7j6 44HwJj7j6 4\44_I4z$:# 7 p_14z$4z_5#H6_4z#4z_4#HwJ磢7j6 44_I4z#:4K>K?)K?!K?K?K? @O?HtJ4^_4 7F 4k?14\_7 4y`^4z!HwJ4ԃr7j6_ 4 (4HwJZ7j6  444_4z @K?1_4z 4 p_a4z 4_14z 4_!4z `@SK?1H _۽@Hw4^4z>HwˀeK>4^4z?@44^u4z;Hw"4^E4z;4ˀK>4^ 4z?@e@ @K?@ @@4@ @K?@ @k?74k?4_I4K?Y@7?@ @K?@ @k?74k?4_4K?Y@7?@ @K?@ @k?o7#0 @7h *d b j$(k?(k?,4k? 79_4xK>@O?# 47I4 Ka?4:@7R4xˀK>@ @K?@ @k?o4 ? @7#x *p h b4(k?6k?84k?4_4xK>@O?" 460Ix4 Ka?4:@7R4xˀK>@ @K?@ @k?ok? k?4 7# @7D` `0"h!zH 4H !444 Y_14!r4^4!R# 7 p^4!*HK`0h` h 4K>K?K? @O?k?4 X_q4K>k?4 X_94uK>#; 479I4 Ka?4:@7RM4xˀK>ˀK>@ @K?@ @k?7_4K?Y@7?@ @K?@ @k?ok? k?k?k?!k?)k?1k?9k?AKC7D7'764 4`$4 ?Hy##Hs`#ڀ H  H 4 K  C_C8 jHs(j JS @ 25J H  ?w  Ht #j *H    #2"4 4k?4k?44k?_ 958# @ 4^u4"ڀ 4^M4"€ @H p4 ^4" @ ^4"j5k ?  ? jF407440U7HK a gH bhhe 4hf( d4K>K?AK?9K?1K?)K?!K?K?K? @O? 2@C5 S 4ˀK>ˀuK>ˀeK>ˀUK>@ @K?@ @k?ok? k?k?KW7D4BH^_4@724_ 4!(7Hy !"444_a4!*4^%4! 4^4 Р_HР_K:Р_ z4K>K?K?K? @O?k?44@4^4K>ˀK>k?44^U4UK>ˀEK>@ @K?@ @k?ok? k?k?k?!k?)k?17&7C74`4F 4?@x7 HtBH4Ҡ_7^M4z <_5)?Ha`4Ha@"H@_4^4z7` 844z_ 59"7H "4z^ 7?i"k?47?ik?44k?4?_Q4z!4^4z!4^}4z!4^]4z!b4^=4z!B4z^59!" 4 ^ 4z `J4 ^ 4z ¤_5S )4 4B^ m4z 4^ M4z ˀ`K>ˀPK>k?44z^54K>׀4K>K?1K?)K?!K?K?K? @O?ˀK>HhK?iK?qi i( Hw J ςMK>@ @K?@ @k?o_7C0ˀ"HCH4cHK?Y@O?@ @K?@ @k?ok? 7Ck?KXk?CH_k?)K4z^ek?!K?)K?!4z^47 4 "4^ u4z 4@K?^ =4z 4@K?^ 4z 4b04^ 4z 4(@K?!^ 4z 4K>K? @O?@ @K?@ @k?ok? k?k?k?!k?)7F7$^m7HCHg_4^Kk?I`P47?Q7&&8G&FrK?I_q4!07H 8@K KE!K?@445^4!*04^m4 @K?I^E4 Ҁ 4^4 4^4 ˀHK>ˀ8K>k?K44^5K>K?)K?!K?K?K? @O?ˀK>ˀK>و x@F 4 744 Uq7HJ   Hv hg ςK>@ @K?@ @k?oKW7CBH_^k?k?K?44^-4z7 4 "4^4z 4Z4^4z 4(@K?^m4z 4K?Y@O?@ @K?@ @k?7^Mk?^=K?K?4_}4K?Y@7?@ @K?@ @k?7k?k? k?^ @K?K?_UK?K?Y@7?@ @K?@ @k?ok? k?KW7D4BHJ_k?)^ k?!8k?14^7!7Hy !K?!K?)4^4! 4^4 4^4 @K?1^4 Р_HР_K]Р_ }4K>K?K? @O?ˀK>k?K?!4^ %K?)K>ˀK>@ @K?@ @k?ok? k?KW7D4BHJ_k?)^ k?!8k?14^U7!7Hy !K?!K?)4^4! 4^4 4^y4 @K?1^Q4 Р_HР_K]Р_ }4K>K?K? @O?ˀK>k?K?!4^K?)K>ˀK>k?7D*D B@ *4K?Y@7?R@ˀK?YςK?Y@P@K?@ @Ku7AKs7I k?k?ok>k>k>k>k>k>k>7%7D7 64 #44444_%4#7I_#(4K3"߂KF4`744`U7 I\h IV  FH H5WhhX4^7?i"k?47?iK>k?H44k?^M5"z 4^4"J4^a5"* bHH 64241Kjh H E4HK?iK?qk0k8HBH# bHK>YK>K>K>K>K>K>K>@O>#; 7?!794R]584ˀmK>YCPҀ__4KK?1K?)K?!K?K?K? @O?4]4z!4 $ 4z] 4!444z5]u4<@ˀ%K>4]!4z!J4 $ 4z] 4!e44]4z 4z]4 =4+4:49@T 47~4y`ˀ-K>4]Y4z: 4ˀK>QE@ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>ˀuK>4]4z;4zˀ=K>@ @K?@ @k?ok? k?k?KS7C7$BtH7]҆?k?!H|8$hd0484k?44?k?4z4]k?$r4]14z$R4]4z$24]4z$4]4z#@K?!]4z#@]4zk?)4yH]i4z#ʈ(h`XHf4ha4yp]A4z#HwJ4ԃr7j6 ? 4 ]44z]4#B# 7 p]4z#"6#]4z"4z]94"4]4z"4|]4z"4]4z"r4]4z"R44z]4"*044z]y4!4z4]-4!@Hz`@!4y`]!4z0"Hu(H64ht(KW6k74 4x 4HyK"4Ԉ:HtJ 4 Hs6j6e ςQ)@5hd047K>K?K?K? @O?74]4z<4z7+4:P49S484y` 4 ]4z 474]4z 474z]4 474]A4z 4g7K?)] 4z 4-74]4z 4>@=Hy@ @K?@ @k?ok? k?k?k?!7'KY(7C7"!x6Dd407440SU7 4z HCH?] h 4` h(H}` @KK@?@4yH]A4z @H]4z HsX6thtX4K>K?!K?K?K? @O?+4:49S49 WˀK>k?ok? k?k?KE`7C!4H  #Ș4 k?H44]4z#HH4zCH cH4H` 4H_ H(#JH?H "@He4h|4y`] 4z#"HwJ4ԃ7j6 444z]Y4" ; 49 p]A4z" H4Y#]i4z"Z4z]4":4]4z"4|]4z!4]4z!4]i4z!44z]Y4!@Hx04z]4!b44z]4!:Hd` P4H "4z4]4 H?4Hz` Q KD?4h``4K>K?K?K? @O?QA@ˀK>ˀK>ˀK>4] 4z=?4zˀeK>ˀUK>@ @K?@ @k?o7Ck?] A7Y`!@Hb(B P@K?] 4z @_m4z!jˀK?YHwJ4ԃz7j6 4|4HwJ4ԃj7j6 4 44] 4z # 7 p]4z 4] 4z 4] y4z @K?] Q4z bK?]4z ˀHK?Yˀ8K?Y4]!4z>Hw4K?Y@O?4 ]4z?44H(7ςhw(@ @K?@ @k?ok?7$7C]!7Y` HwJ4ԃ7j6  4U44?] 4z R4z]4 Zˀ8K?Y4]i4z?4?4K?YK?@O?H}(H7? 䨀hdςht(@ @K?@ @k?oKW(7C"4y8k?H(7?hx(]Y4z"@HyX]4z"4yHk?] 4z"Z4]4z"8@HbP!4yP]4z":HwJ4ԃ7j6 4|4HwJ4ԃ7j6 444]4z!h@Hy(] 4z!B4yPk?!K?]14z!X@K?!K?]4z!*h`0K?]4z!@K?]4z h`X4K>@O?+4:49 S=4:4y8ˀK>4]4z>'HwˀuK>4]Q4z?@54ˀ-K>ˀK>@ @K?@ @k?ok? k?k?k?!K] 7C7%7'(6Htx&Hu&Hv *4y])4z!ˀK>Hahap4y4zHb4X\hx&HwJ4ԃ禒67j  44HwJz7j6 4 44]4z&@Hy ]4z%HwJ7j6_ 44Hyp]Q4z%z# 7 p]94z%P@Hz hzhHzxQHyh#X@Hz QHyh!JHwJ4ԃR7j6 4X4Hz QqHyx @Hyhyp4HyH75huK6k77 44Hyp]4z$ 4 p]4z$@Hz QyHyx!@H|h|p4HsH6whwK"6k7 W 44HwJ7j6 ? 4 44\e4z#@Hyx]I4z#HwJ磢7j6 44Hyp\4z#: [ 4Y p]4z#Hsxhsh"6#\4z# @Hyp\E4z"4\%4z"4\4z"@Hy\4z"4\4z"p@HypHx]4z"Bhex4hdhfK>K?!K?K?K? @O?+4:049`S4:Htx4\ 4z9HwˀeK>4 \4z?@44\4z?@Hyp4\e4z:@ˀK>4\-4z;-@ˀK>4\4z;@"4 \4z<4ˀK>4\4z?@eHypˀK>k?ok?k?4 7#%``7DH 2D,4 47S44c?ሣ_HH 2D4 47S4H7 # K?YK?K?@O?k?ok? k?K>7Dk?)KXk?1K8 k?!K>K>` K> K D k?04K?!k?K?)4k?@K?1K>K?K? @O?KPK@b@мKHмx@ _  : p6Wk?K?!4k?K?)k?K?1_=k?7U -4zK>x@]: zk?K?!4k?K?)k?K?1_k?447U 4zmK>x@!0ȠG4 7G""@79G6 jG!!@79G5 G< <@ 9G4 @k?K?!4k?K?)k?K?1_Mk?k?4K?!4k?9K?)4?k?K?1@k?k?K?947k?U 4zK>"{046y pF4 7@4ˀMK>_%K?)7K<@4U4zK>k?ok? k?k?k?!k?)K>7k?1K>@(K>4 u@4 "4`4?"{06} 44U4܂U4"{0܁6h 44U4#0܁p7 44Uu4#[0܁87H 44U=4#;0܁7( 44U4#0܀7 4U54"0܀6 4U4#0܀h7 4U4"0܀86 044U=4!05 P7544 UW7 ``4 `@ 4K>K?)K?!K?K?K? @O?44UM4 [0ܟ4H p44U4 ;0ܞ4( 44U47#07  2444U4܀8K?1k?44w@k?7K?1_-4= 2444U4܀8K?1k?44w@k?7K?1_4 *44U4܀(K?1k?@47K?1_4%Ku8!Ks8) k?Ku81Ks89 k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=7'6k>H4P4DXk>HK=74 3B4 HHBj4 4 4$4H 7>K>_=6"4H4RhC?H6v HhC?02K>46_7?!"7?!C? :#  *J K0J 4 @!k?G?46Wk?K>k?K>_ k?k?J74zk?U 67"`75p@"5 D47 /HI` 6 HH}4 04D 4zU4K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>"046 F4 R 7R 74z@x7ˀ K="046 F4 R 7R 974z@7ˀK=J J0JG?- 7 ˀ]K=k?ok>k>k>k>k>k>k>k>k>k>k>J7#4k>D4P7D4PHx74 B(4HHwB 4 4 Ha ? 7?y5_K>Ⴠ!Hv6hbC?Hy7 y hmC?_!"!"5-@J4 4D 574D 57I X I J0I -x#047 F,4 R)7RI74z@7ˀK>Y4 8@H` @HH|~Ha  K>4U14K>YK>K>K>K>K>K>K>K>K>K>K>@O>k?o7K>k?C$4k?K>!0K>4"" # 0"" !"  K K04K k?UQK JˀPK>UK"h7K?_ -K?4K>@O?K J04K v k?UK?4ˀK>K K> 4J0K k?U!K?'4ˀK>K H304 K3 k?U K>4ˀK>K HT04KKT Uk?>g4ˀ]K>K Hu04K k?UK>4ˀK>UeK=4ˀK>ˀK>4 _(@0 @4@4k?ok= k=k=k=!k=)k=1k=9k=Ak=Ik=Qk=Yk=ak=ik=qk=y67>ik>4 7Ck=4 4 j?4 4j?4 4j?4?j?K>K=j j(j0j8j@6k=k>k> k>Fk>!44K= 4z5_7? '@C?/K>7: O K>I7k>"k> 26Y pPU6# 'k?H|ѳ7>k?KPb@ѳk?K8   Sk?7>!4z_5'7_5zI H!074IA k?59T-5'B C?/@0 G?9@ 7?I_I  PJ+05J @  Uq4& H?5J4 4 4 H444z5_-7?1$7?1 2C?-' ""[06Y PT4%"C?-4"4?!7?1䂒$4ʃ=7"[04ȃ& "Z 0 B!J!Rk?G?)7>4zk?7>!5k?_k?&rk?7? 4zk?7>!5k?5_k?!ˀK<6Y P6!R$I J04IQ  7T-5$4G?) HxK@v@G?)KH ׽]!H@C?/6 7C6I I0IK?9    HjIV4z577K>K=zK=4K4zk?7>!5k?_k?!k?7? 4zk?7>!5k?5_k?>K>ˀK<#07 4F4 Q7Q74z@7ˀMK<"046 F44 Q57QU74z@ 7ˀK<ˀKˀKI JW04ITU ;K>ˀK<ˀK#;0KxPQ79 PK>@O?k?7_@C4K?Y@7?Ku4Ks4 k?k?7Kxk?#[0Ka?k?7Y `4:@Pik?K?K?_]K?Ka?H9@78?`Hh8@Ka?H?H7h7H4K?Y@7?K?Q4K?Yk?77_k?17?9k?)k?!_k?9C$4K?Y@7?k?77_k?17?9k?)k?!_=k?9K?Y@7?Ku8Ks8 k?k?7#07 p_k? @K?Y@7?"046 F4 k?Q7K?k?Q7K?K?_-7eK?YKu5Ks5 k?k?ok?7C 044 F4 KxKa?4:@k?P!7Hw 8@ `K?P4 0 h?4cK?_4K?YK?@O?k?ok? k?7D {0 Hk?!44y @F4 K?!P!7HKa?44y pF4 K?!7P4Ka?H?K4 P4% K84y 04PqK?!H ?@K?!P94y K>K?K? @O?Ku2Ks2 k?k?o7#!k>HsJv7>14zm7 K>qk?q_U7?q#;077(79 P7?!G>A@7?c?K>7?!#[0k?K>Y7Y 7?k?K>k?P K>"0HxK>P 6K=@O>Ku7Ks7 k?k?74k?k?_7?K?C 7K>7@7?k?"046 F04 K?k?7K?_K?uK?k?oKx17Y {0P4z`44yF4 Pa744yFh4 P17P 4K?Y@O?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Q7C@7&  4 Z w 4 Z x? 4 Z y_ 4 Z z@ 4 Z  } 4Z  u 4Z tߒ 4Z s` 4Z 4z@4K>K?QK?IK?AK?9K?1K?)K?!K?K?K? @O? W 84Z@ƚ2C? =03ƺ2C8 4 05 @Ku2Ks2 k?k?o P7C 4_4z 4K?Y4|@O?yK?YKu6AKs6I k?k?ok? k?k?k?!k?)k?17C R4@4_77R]4P7_47R-4`7_}44p_e7+4: 0_E77z1_-72I4Pa5:`!x744P144  C 6759PU7 :4?  4^  ^?  P4` 5R4y5E4 7_]7 5K>K?1K?)K?!K?K?K? @O?P4zȜ}4P17]@P@]5@ @K?@ @k?ok?k?7?1k?1k?)k?!!0k?944C|@ K?9 7B *7?6`Hw bB *7`?64c?`Hw?@K?YK?K?@O?P4eԠH>7P4?ԠH@? u4k?ok?7#k?P!7:k?@wP K? X7K?4Q 4y 2@P =4?744K?YK?@O?7KYC77- WǷ@44?@7?Ƿ#7.& U KYC87?'00N9F8G'I  J79YC3 X6?Ǹ_M w @7? ]ǽ2KA4<\C XǸ_@4?@7?k?oK_4C7Cx x7 b@Y7v- _ǿ@_4zHC4] 2ϟ@K?Y4``J4r@:6?7 aK?Y@O?ϟK?YϟK?Yk?74_ 24 4X 2ςK?Yׄ4K?Y@7?P@K?Yk?7N:N!JJ ‡FF BbB B@ "P!@K?Y@7?#7"6#7#\7\ #<u7<@#]7`"|E6|"-6k?7_ @_7K?Y@7?Ku2Ks2 k?k?ok? k?k?k?!k?)k?1k?97'4Pk?A+7444(  4*  GP  | B G 7 (@  K?A_4x j4?@4K>K?9K?1K?)K?!K?K?K? @O?+48  +47 PJ 07\6 (@?6@4@k|1k?o+k?4# PHw :HyPIK? :4cH?Hy4K?Y@O?H|k?ok>7#4k>4R7>k>#7>  Kw1  #Zk>K>^?*E TK> p7K>?@Z"K>@ 4yȜ84K>@ 7>7@ 7>4K>YK>@O>k?oK?7Cr Z:7? 87='Hz'8G'FC |K?Y@O?k?ok? k?k?k?!k?) 7Ck?4`4 Qk? 44c 4@4#4x#4pP 4z! @P 4z0 _ w 67B7 @ R4@4 Z@_ 8"@?7044K>K?)K?!K?K?K? @O?C48"Z|4_77?7?_45? b K?7- VǶ5?@J w  TǴ26?` @ w  Yǹ_6?@2 w  "6? x ' (4 w 0H64`4@| S4 y X@ w 6  <]m7 w  Z Y? w }? 5?4\ 7\ w  w < w 6 u < w 4P4z77?7?_4@y4x: (K?4P4y444P 4x4k?ok? k?k?k?!44k>k>KEXk@XKFPKD`KCpK>kPK>k@pK>k xK>!C`!B|7?QK>K_^7>A@7?Q7 (@K>7>A87?Q7 @@K>C "K>7>@ (7?Q7K>KP 2#7B7?QK>jPKX 2"6B7?QK>@jXKxB *#7B\7?QK>jxK>7?Q@`4K>hPK>k%XK>kD`K>kpK>K?!K?K?K? @O?k?oBh7CHz@ @P @Hz@ @P @K?Y@O?k?ok?k?k?7C@7$44zP4HH @H@@4H0!jH Ax4H8" H(B4H"H B4H@#RK?YK?K?K?@O?C  |HP9 7C4Ha% \4HsHe  Pa4H@e_m@H0C8 u |HPq % 7C4H 4HtH  P4H _wHH8Cp  |H E O@7C(4Hx  <4HuH % P4H(_e@EHC -h|HO 7C`4Hz E 4HvH  P4H_wHHC4h|B 7HzBHeK?Yk?ok?B X7CHz@ @P@ `h`HHw H`X4HHw  P!@HwH4_@PHzh`Hz@ (@Bp@PHzh`K?YK?@O?k?7_k?_5K?K?Y@7?k?ok?k?7#_-7 4B4z84#74B4zHd4K?YK?K?@O?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK27D7%B_744444)4 +4, pk>4+ `k>4* Pk>4. @k>!57j-!4 4?47W?u4? w ǚ6\ C(b _ AǡRH6V B((@ _ VǶ_@k?444A4x (7H Y4A6YH^4 rk?444A4xH7^4 6S  06Qh`_@Hp Thp 0HH7 Hy@ 82H6 @? ?@HC0 7  bhh44@T4x 06Q (7H ?4A69H@ ^_HC (4 244A7?Y P7Hǡ K>@K>Bp7?Y4zB7?Y 46B H4^ޟ4^_ B8444B4x$7H^_HC#7 7?A4A847B7?Ak?B7?)k?B7?A 0H447?A@7?) (7H "4A469Hǹ@K>@K>BX7?A4zB7?AHXB5@BP7?)4zB7?)HX7?hXHP HX*4zB7?)HP6?hPB7?)B7?A 4H@ @9 @B7?qH52 44A7?qK?qK?y] 75@B7?q4zBX7?qB7?q P@H^rk?44k?4@@4xHPH4ZҠ_4 H7H^r44A4x47 ! bHƿ@4^_ A444AL4x74 !*HB_@67W? :H^"44A4x7 H H` #7PB`4zHp@ ZHoHp "6@B4z_Hp7B4z5<K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O> %@k?ok? k?k?k?!k?)k?1k?97& k?A74`B77?iA44 !x4K?i A`44x4 7 7 K?A4_4x!7K?i@ 40B 4zHC?m@7 4B 4z`K?iK?A4AX7? 74zB 7?B 7?K?i4_4 HsBz?4| 4@B 4z4B 4z4K>K?9K?1K?)K?!K?K?K? @O?B 7??GHsK?ik?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Y77#k?i 4k?a47B k?qHz7_ 4C4(04+4( 4) 4 4K?aK?i4y@PK?q 7HwB( H}Cf!44K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O??4O Hz474 LO (7 Hy_5x :5? L@>H}UK?a4@K?i4B 4 , B K?iK?i4B 4Hx  yK?i4B P4Ht6 uk?ok>k>k>k>K747#k>B!j4!4!r444!4#K>7 B `4Hy7: z_4z7 "67?QO 4K>BX7?Q@ * "HC7 0 g44K>YK>K>K>K>@O>4y_u4ܟ44k?K>4A4yܟe44? jB J K>4 B4Hx7 } 4̂5@>%@_14z@k?ok?K!7#4k?@?? "4y_4 K?Y4ڋ_ :#K?7 B4Hu6 vHtB7d- YǹX@HyK?B84Ha45 uB Sdz_HyH|C4\ "|K?6yB4Hv6 yC? XǸX@HyK?B`4H|7 tB ]ǽ_HyHuB4ʊ #K?7B4Ht6 xC WǷRHyK?B4Hv6 sBb ZǺ_Hy4K?YK?@O?k?ok? k?k?k?!6K77$k?1B47E!46 _4 87H H`_ 4 4|!4ڊ :#7 K?1B4H4 "6K?14B4_ 4@`4|!r`4|H " BK?14|K?1B4h4|>@K?14_4|(4|\ @ g?aK?17?aB4K?14B44| _ 14>@#\7YK?1B 4 `4|#<K?179B4(4| *K?14_m4|4| !4? B4k?K?144@4|4|_ 477R 2#K?17 A4HB4k?9H7WI4K?9 F _H (k?A"K?16 A<4K?A 0K?1AK?AOK?A@ATK?9OK?9H  4|K>K?!K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>K>77)K87 97CK>6444 $4 AD4z7I?C40#7 ,_5:$7Hy @HzLD_a5:$H$ A,4 $Hx A5z"4z@597A$7?1'r'44z595_5'7 II B 6Hx <6Hw O]IHu 4A5A5K? 5kxd4J>7?17 ?4z59_ 4&7_5:_m7OI:WK? 5@A4I94A\5 p@B 5Ha+ \5Hv OI9Hu I4 u /_5:Ak? OI:K? aHpǰ8 !I:50P 404  @I9K? A4 @I9K? A5zI5K?  ? "6 A47? @5:!"5A7?1YK>K>K>K>K>K>K>K>K>K>K>K>K>@O> zK? B h|K? 4haK? `2Hs  7K? @K? a4 4 4 ! 50A4I?C;@7 74z59@\7?1=74A$7?1=@K?9K?1 YB5Hs k 5H} O5K?1H} o 7?1 @A@K? 7?qAD7O4z @A54 *"6A4`@HBz?4|] "6@A4"6 A4 0]@HH ? 8484zAx4 5k?ok? k?k?k?!K_7G7$K>76^"|6yP^4  b7 }^4z""H   C4X!@H^_ 4`^e4 P 4p^=4 ( 4P^4 H4" b^4z!BH   @C4 7ς z4^e4 ` 7 f^-4z H   C4 4K>K?!K?K?K? @O?ˀK>7ς }ˀK>ˀK>7ςm yk?ok? k?k?k?!k?)k?1k?9KH7#7EK976h 8 & 4#7?Ik?7?A4_4%@A 7?YHyK?A *A\4Hh_ HH hh!5 A |4K?I4 4 7?YA ,@K?IC7#R!47?I@7?Y$*4 t44y@7?Y 4A t7?YHsB 8 4A d4A <7?YHCR" 777! *44yA H7?Y?/44 A 4A 7?YHC70 w0K>7k?I7?IA 7?Y"z847:O4x @Hy <@ @A |4(HyHy4A L4Hy4  hA T7?YHh HH hh 4 A <4444 4 44yA7?Y>4 %47k?I47?I@ 7?y 5A 7?Y7?YA <7?y5A T7?YK?IC j7k?I7?IA X7?Y :4A 7?Y5A4K?Iu7?YA@K?IH4"?h5 Al4Hj@ Hz4P4 zHwB4V ZBB B7z1O1 "4A4@HjHh7hh4HyA4Hj F  K>K?9K?1K?)K?!K?K?K? @O?k?ok? k?7#4k?!7:^k?)77ȠJOQHz@0@K?!K?)4y_u444K>K?K? @O?k?ok? 7C7?k?4Ak?A4zk?!K?4z_7?!@HxPK?HsXrHh K? 'k?K?A7?H}X8@HyP76?hvPk?K? $848A 4zK?K? ? 848K?!A4zHb+@߿49 @_49 A\K?K?A7?4AT7?4K>K? @O?#K?A7@HzX7U?huXk?ok>k>k>k>k>B67#k>K%7D4"H^޿^_"6^ -5"h@Ad7>K>AT7>44Q7>7>^]4A!z44K>4yA(5K>4_!4y! 7 eAK>K>A|7>4^7>5C @C :7C b?7C?7 ("7C ?77?A@>4_7>A7>4K>YK>K>K>K>K>@O>4K>44yA85Ÿ}4k?ok? k?k?k?!7#7DK:N}k?14Z"Hz6PQ4  2#Hz7P!4  @Hy7: z4hx#@7s- VǶH"4(ȠhHPHƟ@ ^_b \Hz4Y PQ4"2H}7 |4hPNHzZ Hz4P4!*HtB7z1YO)@!HCC!bC4 R7 v4K?1hX4@4y!@44 7 u4K?1hP4@4y 4H^ _@ Hz4PI4=HHs6a a4hXHf44Oq47 7C?7 4? 2#70W 4@ 7? <H`ȠHPHz!J@7u- WǷ@:4 *4_ 4? 4 Hƿ@ ^jǷb4 f^%4zHyAK?1N]HzHt x wƿ@:^"^_HP7^_hP4 bHƟr@4v Z@4< BN@K?174_ 4y4_@4 @4ڂ *4 b@4 }( BN@K?174_ 4y4!@7t- VǶ@4 ^޿ ^_K?1@4z!@ 4@?4#\7Y^}4 7B0ȠzK?14_=4yȼ4@ 2K?144y_4ȼx44HP HX BHyK?1A 4NHzHa  b4K>K?!K?K?K? @O??4EHPKu5Ks5 k?Ku61Ks69 k?k?ok>k>k>k>k>k>k>k>k>k>k>K?47#k>C7D4 P4C7z1YO @ HC#@HC C :C4 + "C4 C"4 7 :C4 "C7z1O ҙ"HC `@C!әO 5` *7i1Hz_}59$7 Hz4P4'XHz4P4 *HC4҃'4̂'44K>YK>K>K>K>K>K>K>K>K>K>K>@O>_7y17HyK>AP5Hw  }7_7y1و"*Ƞ4Ha49 y^ 4&7Ƞ47 sHX6hXHC: 7 jJ A_7 iA?5:!+4( 4) 7j-4+4 4 J ( k?K>44@ @4yȼuHzk?K>44k?_4yȼ-Hz _ XǸݽ@^ 4zHzNU7}HyHz_7y14 ZH=@H`߿95AK>Hy7: zHzC_>m@ |A4y@4Hy78 x4 C R4 4 k?K>44@ 4yȼ:k?K>44k?_4y7!rȠ=4^4z@7N=Hz@ Ƞ4@@Hz5P4 HC46 CC rO15: P@K>A 5HbF  z_59@HHyK>A4Hh   H>u@7 yH+߿49 K>_49 A @N HzHyK>7A 7H}  b7W w^4z97Ƞ44Nm7?!K>A 7?!K>A 4N}4N HzHz \ 5 a7 nA+ 84' 4 (4'  R4 4 zk?K>44@ 4yȼjk?K>44k?_ 4yȼ(@K>4@ p4y7 "HtB Ƞ4K>ᐠ A 844k?ok? k?k?7F6k?!7#A<6Hy77O4 H^4 87K?!A X4N4 @HyK?!A 4N4Hw  xK>K?K?K? @O?k?ok? k?k?k?! 7CKZk?14O54" 4H}7k?C 47?^i@!K? k?C C 7k?K?Bv?7?Hx7 wB@ 44z^@!7NHz`HyK?1A 4Hw  C H@CF 0@K?1A4 Ht6 gHuB ?4zK?1AP4@(4Ƞ4Ԡ44K>K?!K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>67D7&@7k>4 4 4 0@HPӀ_HXӇӀ_'A7?9A7?QHB4H#6 ^4 H |@r44K>YK>K>K>K>K>K>K>K>K>K>@O>H A7?9 c5I?+4- @k>4: 0k>4 4 5,Ah7?QHCW 4 7 HCw"k?44k?47?9_7?Q#7K?9< A7?9"4 @ZJ^ 4"744_57?9PK?944@7?Q"877?9A7?QK?9K?A ? 848@ 4 `2Hǵ K>@K>A7?9}5)?K?9 ^ Q4 7Ƞ4B4?67?0 Ƞ4 ` g?1P7?1HC74 7 H7 <}@4=H7 ^ !4 H }'HȠ-@4K?9K?A ? 848K>@ 4 H+߿49 P_49 `@T7?9HX!<59@@$7?97?9@7?QK> "4z@7?9p@HbHfF :H+Ѐ߿49 pЀ_49 @|7?94zA7?9@7?Q@7?94KA@77- S`_ˀ7?5KT6WB ]ǽK=46B S \6? dz_60V0=4@k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7D7&k>@<7?1@,7? @K>+4" k>4- k>!\44447i-5J!|4 4 44T4LHB?7? 4? Q 4*?HHC6?QB4 w)4 )4)K>4@ 47`04@? @K>K? K? R#\7Y@@|K>K>@47? @7? @@7? )`04 4|6 HǴ@5y @ 7? `04?6 5y @7? `046 K? K? H@C ( *5y@T7? 5y@7? 5y0@7? HCM *444^ 7? 7HC 7 5y@@d7? 6 7>_4 K>H@@"4=WK? hK>H 7?!Mk?!6 K? K?_ H@C ( *5y@7? 5y@L7? 44@ \7?  (@HC (0 Ƞ@&J;U@7E 6 045y@|7? HCS 84HǼ K>@K>@\7? HC? ? ]ǽ@^Q4 k>NHK>@ Ƞ@H@7? HK> X 4 4! 7?Y4_ 47?Y@7? 5y@47? @HC4 4 4? *^H6 7H7 4CS!Ƞ5@ k?@7?qk?444^7?q8e7K?qK?y 8@7? @7?q5y Bk?444_ }7? >=7Ƞ-@"44@<7?  HC Ƞ@7 HӠߒ 0/K? K?_ 5y@@|7? ^16:7@T7? 6 HbK? K?Q 5y@@,7? HB^:7@7? H6% k?K>44_ 4ȼU@7 7>_4 K>H(vGHȠxK>7 ]4 87H H`]4 4K>@@@7? 44|K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>H " @K>@K>@|4̢K? Ku5Ks5 k?k?ok>k>k>k>k>k>k>k>k>k>k>k>7G7&k?977?A44@D44 !\4 4 4 44HC ( 8""#B#Hh@HHz_ 5Y@@4zHB]Ӛ7@4zH6 4U4c?%N H4H   4p7?9_}4K?94N4HhHo 4@@ 4z4z@ t44K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>4k?4k?44^7?A74z@ d7?A?47 HyHt 5Y@@ <4z5YP@ $4z7 HxHsx 5Y@@ 4z5Yp@ 4zb7 HwH} 5Y@@ |4z5Y@ d4z@4< HC:@4? <4< @47 HuHi5 "6@@ 4z"|6y@ 4z47 HtHh #7@@ 44z#\7Y@ 4z47 H|Hk| #<79@@4z#7@4z%47 HaHl, "6@@D4z#7@$4z47 HvHjV !5@@4z!5@4z547 HuHf !|5y@@T4z!\5Y@44z̨47 HtHe !<59@@4z!5@4z̪E47 HyHv  4@@d4z 4 @D4z̪47 HzH|\  4@@4z \4Y0@4z̬U47 HsHbS  <49@@t4z#7P@T4z̬47 H}Ha= "6@@4z"6`@4z̬e47 Bt7- X_ȀH4 4C.77?!7" @X 8p47?!HB  6yH6` C9 ?HHA 4Ƞ47?!  H6M NHH@ p47@7?q44^7?q @K?qK?y ? 8484@ 5H}Hb] !5@@T4z4z@ 7?q@4@|7?qȀu@k?ok? k?k?K747#k?!B 4 6 a@7404 *4 K?!@44 Hb4_ C7e- _ǿ@׀4K>K?K?K? @O?4 ˀK>"K?!@|6Hf4ςu ǿp@4&HzC_7y1c1@K?!Hy78 xC Sdz_@ #K?!@7ςK>k?ok? k?K?7#4k?!C7D *4K>K?K? @O?7 s] e4z`7ˀK>#\7Y @K?!A4k?)Hy7N4K?) E ]H 8k?1K?!@07NK?1(H}HyK?!@4H}  tNqK?)ςK>k?ok? k?KW4Z7Ck?!B jc1K?!@H7y1Hv6 aHuB7d- _ǿ@:ˀK>4V?Hu6 |ǿp@4%HzC_7y1c1@K?!Hy78 xC Sdz_@4K>K?K? @O?k?ok? k?k?k?!k?)44HC!7 ]4A8h|@"HC!Z7 444z7CK(7%7@7H_-@Hy7? ph}ˀK>A 4h|@`7Hx4z_Y4 ˀ(K>@ 44K>K?)K?!K?K?K? @O?ˀK>Hz@?@@@-HxHy@p4H 4z@5ς5K>k?ok? k?7CKZ7@ k?!Hx@HH`b *4htHA H40 | WhwHHzA  |A4K?!77N4 `H@7hy@H} K>K?K? @O?k?ok? k?K_077Ck?!KX @b *4 hs0A4(0 | Whw0HzAp |A4K?!77Ni4 H 7hy Hz _ K>K?K? @O?k?o7CKZ(H8@b *4 h}8A4(0 | Yhy8HzA8 |H|(7h(Hx  K?Y@O?k?ok? k?k?7D7k?!6A7K?!77N4f H K>K?K?K? @O?k?ok?KW 7C@jH6?hd   *M5@Hw HHw _6?Hw(@jH6?hd(  *M@H  HHw(_6?K?YK?@O?k?ok?KW@7C@jH6?hd@  *M@H HHw@_6?K?YK?@O?k?ok? k?k?k?!k?)k?1k?9k?AKG7C7$k?Q4X4!|5y@H7HA !\K?Q@5YHC4(0 4ʊ HvcZ4!<4 4 ("B7 C *7?_)4 ˀK>k?H@ ^_Hy@4c]a4k?CH^ޟ ^_K?7?k?K?cHs@czHx`K?4A?Ak?HyK?:  0k?Hs@K?Q@5907?4z_7?a"H}@K?Q@p7?a@7?aHt_-4K?7? k?H "HuK?Q@5904z4_7?a" HtK?Q@7?a@7?a4HC(0 <@Hx\@HC4ʈ" b7 HwB #<K?Q@ 79#K?Q@ 7Hz#K?Q@ 74K>K?AK?9K?1K?)K?!K?K?K? @O?ˀK>7?_4<7HˀmK>ˀ]K>ˀMK>ˀ=K>k?ok? k?KD7Ck@H7hwHe_}h`k?!Hz@ @@ @hdHy78?hxK?!heK>K?K? @O?k?ok? k?k?k?!k?)k?17%K977D6 7@ 4z4@ p4zHz@4 Hs:@4 "444^4wH^ޟ ^_J HzM 4Ѓ&H@HzM 4&HeH `ZC4ދ BC49 *C7z1MM!@HbHz B *`R 4P]4 *HhA 7z1M9#HC4%0@C%C4ފ C4$8$C7x- UǕC ZǚĨ@C"Z+444'  DM5 0@Hb 4Y]4%z4?@K>HsH ` 74@] 4 +444( HxHz X E  M%6?< *H  7]y58#4?}@K>+444' H|Hh D  Mm6? *Hy 79]5#R4?}@@K>4‹""C "+444'  DM 0@Ha 49]4#b4?@K>Hg4 k?7?4_)7?i!0@@4z4@4z4z@7?i@H7?iK>7k?7?4_7?i @@p4z#7@h4z4z@ 7?i@7?i0K>HP7hP@4zK>K?1K?)K?!K?K?K? @O?HX4EhX@4zK>@`4z4 @`4z+4& @84z4 P@ 4zK>@4z#7 @4z+46  @4zK>@4z!<59 @x4z+45  @P4zEK>@4z!5 @4z+44  @4zK>k?ok?7CKZ `7$`@4@@4 |  | dK?YK?@O?HwH _K?Y _k? $  Y@ k? |K? 7 aK? | E bk?o7CKZ@ "M@ ` ` `K?Y@O?@@@@K_@_k?ok?7$ 7C@ jMy4k?4z_7HzK?M4HwK? hyK?YK?@O?k?ok?K?7$7CK7 Z k?_4zHzHM K?HK? hxK?YK?@O?k?ok?77C Pk?4z_M4HzK?M]4H hwK?YK?@O?k?o7# @k?@ *MI4zK?7@p4yK?Y@O?k?77?K9K @ ?K?Y@7?k?ok?77C k?4z_4HyHz7??_2C 7?Hz@K?M4Hz D h}K?YK?@O?k?778k?#7M7?QK?_7?QK>@7?@ @K?@ @k?ok? k?k?k?!k?)CB77$#7W7x+444Z44^4\` _#Z J4~V#4T%jc@ V#"ςpK>@%`߿ ($% @?%B60B4 6046B64A`_ (@B6` @%4%Bc6 `$] jB ZB`_ (6B6 $` B6cĂ B6 ( r4~4^4T @!# @#B6 ( E84!4ˀK>قb :@$B@6 86b?@ ZςK>@ @Bc6 c@ "B4@<]6@#Zǃ 4^#R4K>K?)K?!K?K?K? @O?@!R`!R`߿ (7$ "`/B@??BςUK>6?k?1`_ (@B@7y+`&  @7g+4 `  *4xK?1__%4 4@?@ςeK>ςUK>ςEK>ς5K>ǣoB@4\ςK>ˀK>ςK>ς}K>ςmK>ς]K>ςMK>7@*c  @7%|@b:/4AςK>ˀK>ˀK>CW 07\ *7C?@4@k?ok?k?4?KwKxKy1 h x W W  araX4 P6? D X Ҥ `6 e4c_7`@ V   ֠ 476 m7 ` aH4P6? X ҃7 @67 D_4B`@ X  v 7ր 4\6 m7 7@ } Ku1Ka5kuK| kbK?YK?K?@O?k?ok?4$k`Ky1ky77z#!O kyk|@4Z 4bHkz4V b(k`0k`0k}4|K?YK?@O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K>4'k`2K17Hk?K>7$7k? 6 4%Kt1 J4 0kj145_474k|1K 4#C!0@K1Km hkKn hkKo%KbKwW%% @_54K1 8kkhkh1K1& B4ZU&B&6 (4 0Z4 kv #*K}1 4 ZB :K?"B _4"KmA4 44 84 ?4z "5A ?5I:4!51KyNi - BKJ:M 1 !Z@0 6*61 J:@?}6*ku1 6 kp2kjAW 24z "5JAW ?5JI:* 4 KyNQ * BKwI:M  )`05+5) I:@?}5 6 46* #:@#K?@&Kq1 B &rKrB__4&BKa49ky4@+j_5YKC@0Ka14,@0kl1&4 t&C4= C4vS'"C,C+C+k2Ku16 kj1 (kK1@z C4Z C J7`8k1 C?7C ?7k:K1" M6 :WK1Ks16k1KwKx ( 8_4khKKw (k1̟4Km0̟7kr1 4hkq2Kh1 BK|1Ka? \ H4:@4Y L@MKzKd k}k`1Kd144~kp1Kv16k1A! IW 50kf2Km1 !7? CKa?l 84:@#HIWL7 P@@IWk? <49 CHLMKzKb ksICkc1h4~ "@7kb1 kh2M!KzKeK? k}K? I_ID  44Kz1 :7?Ka? H"4:@L E6 MIKzKx kxIZkz1@0tt4~4Kq1 Kl1 Ka?4:@C 2"HKwL u6 `@+Krk?"6 CHL %k`1K17kz17e#Ake4~Kg1 zKqKa? 84:@!H5 L 5W(+!H5 L U5Wkj1X4~C4 44 04 k2K|17kj1_=kjK157Kp1 8@Ka?"H4:@6 `L u5Wkj1@ 8t4~`4545+ +Kf1 :Kv1Ka?"| H4:@L 6y LKzKa ku4~Kr16Yky1 "AS I 5Iki2Ke1 8@Ka?#<HIw4:@L79LKzKx ki4~ 0@K1A*7ka1 kj2LeKzKd ksK? K? @ -IId  44K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ko1 :7?Ka? H#4:@L7 LKzKn kl@0tt4~4k`4k`2k` "k2Kt16ki1K1 Ky1 8@Ka?!H4:@5 `L5Wkj1@ 8 t4 ~k`d7kn1 km2k?7K?k?_ Ek?K?Y@7?@ @K?@ @7f44_774666x77Y7!4=74 44477w4474 b6b:b8b<b>b@@6 @P@K?@ @Ku2Ks2 k?k?o_4 (744|K?Y@O?_m4 | 274  wL4z`u4|@ @K?@ @k?ok?k?k?4@4744z  | f7C 04Hw7$Ԁ2_4?gHy@7HsHz d  thu7K?YK?K?K?@O?_e4 7Hv7H}m |@ @K?@ @k?ok?7CKZ@ LKD?4L4zK?YK?@O?@ @K?@ @k?ok? k?k?k?!k?)KE7C7$ 4H 44H?H H!2Hz 4KH r F84L-@54?}@]HL@]HK_L@507G5?/KH d04 g4 sHHz LKE?4 dH @HH@?@ g4 vK>K?)K?!K?K?K? @O?@ @K?@ @k?7Kv k?7LQK?K?Y@7?Ku6QKs6Y k?k?7K2 kz2_4k|2K?Y@7?k?oKs2 (7C_E4Kz2( \_4+~4= k?Kx2Ka?k?C4:@ 7w#Q#<2@7w#aLq79p_-4K>@O?k?ok?7C@04_4z 7_4z4K?YK?@O?Ku4Ks4 k?k?ok?7# 04 _E4zȜ@_m4y7 @_4z4K?YK?@O?k?7L k?7_]k?k?K?7M !K?K?YK?@7?@P@K?@ @Ku6Ks6 k?k?o_k? 077cK?#7LE4zK?Y4|@O?Ku5Ks5 k?Ku4Ks4  k?k?ok? k?k?k?!k?)k?1k?9k?Ak?I7D7#k?7L 7:7?74M 4K?C! <4&(4J! 4 T4 \7k?C!*B5 ҙM5 BK?6k?5BMIy?@K?CL,!H@K?7?k?7Yk?_KK?C K?7?֠k?K?4Vk?K?C>7_5z "74K>K?IK?AK?9K?1K?)K?!K?K?K? @O?7?R4K?C J 7k?CA) JK?7? k?7Sk?_K:|(K?7?R54 K?C5 yL5 BK?6k?5CLӹ?@K?Aӵ6?w4? 5kk?77?k?9k?)7?)_}k?1K?Y@7?k?/,/-/.ok?97C4@"(k?@"K?B4Z":cr@x4" 6.`7?a \ &00N8E&E_7?aa"#\ 7T. . 7?aK? ''001n0N 1A 'I9 @B7`!7?a$'('(08G'0G0N9E'8E0 8_7?a4K>K?9O?1/0./0-@/0,7:B4` K|2!ˀK>}K|2!mK|2!k?ok?_ u4(70`"K?B4z04K?Y4|@O?k?o@ L KC `?4zK?Y@O?k?ok?7DKZ7#K]KS } `@K_77? ҕu BH4@ P4HK_4xKVB  H4ˀ K?YK|2!?HK?YK?@O?K|2!?@k?o7C_4 7 K|2!Hwk 4 K?Y@O?K\K @_K_@KK_@K_K @kK_KK  P4@ K6? \0@4@KWJJ@  k?ok? k?7DH7k?!4Bk?)!@7HK4KK?) BK?!!@H H? J@@ _h H(7_- h( HH(6 h4H( @Dԃ DK>K?K? @O?K|2!B4K|2!H(4h 7B`4eK|2! `BKW7`2KZ( Y CӳK@ˀ@k?7_U4 0K?Y@7?k?o7CKZ@ _@L4zK?Y@O?K_ KW0Y j Y@k 0K\K ??@@4@K_0?@kY0k?ok?7CKZ0Y 07$K__h0Hz0D?@K?YK?@O?@K\0k?ok?7D_54@ 0744|K?YK?@O? d44h d ` `Bh`0 h|8`}4|Hw _u ڋ?Mh|(BHz8`54|k?ok?7CKZ0@ _KD?4Hx7?`2H( B04?@LHz(_}HzAHz8Le4zK?YK?@O?Ku4Ks4 k?k?oK_7#C 7ˀHk]Ks2) " _]6@k|2)Ky2)#K|2)K?Y@O?k?74_-k? BK?_ 4 @@(K?04K?Y@7?k?o_E7Ck?Hw4HzC_JJ 8  k?i4 r@4z "@K>AX4z 4z_K?4K>@O?7?a@4z?@H|C?4z4?w4zK?a??47?iA4z?M@%4zk?ok? k?7D_7#k?!H44@_ Pk?I4 b4"4@4y"K>A 4"x `HC@0C4!(@H76hK_KW" 6`B "47?I@4!4H@94  0@K?!4_=4!X@A4!:K?I04 }4A4y?GHK> `7?I@4 @HC<4 p@K?!4_54 P@A4 2K?Iz04 z@ `4K>K?K? @O?K|2!?@7?Ik?ok? k?7Ck?!_%4!7Hd@4䃟 4? 4_!:A40!74z@4HzKW4@KTA  z4HzK_4KSA  !*H_m4zA4P4Ke2!?HzH_4zA,4 jK?!@4z H74z_U47044Ke2!4K>K?K? @O?Ke2!k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>7C_=7$k?aHt4k?B4&44`4 4 4 4 ! 444p4r@4z"B HsBu "HK?_}4z!HtB@!:_(k?a HQ@* ?H@R @ (K!" HzK_5KYA ?  ˀJG!A 4z!"K?a04 4K>7?a4zA`4 ‚K>HtuHs < 4<pK|2!?@pK>YO?@AT4z?u@0K>Y@0# @ 7K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>k?7KB4`@_ @4r`@`@ bhK>4 4! 8?@@04K>@7?4Š44_g44Ƌ :K_C0C4074@7??E@54# 7@k?o7C47?@4 @K? #< p7<Hx8@4z H@HzK_KWHx8A  44K>@O?K|2!?@4Ku4aKs4i k?k?ok? 7#k?4k?Ak?! (7K|2!K>K? @O?K?K?4@HK?!HK?_ 4 |Ad4ˀ}K>k?ok? k?k?k?!k?)k?177D k?A4H! JHC4܋: *7hK?AA 4Z!4`4H444 rHCH @" @H h 7hCA\K?A?HK|2!" 6K>K?1K?)K?!K?K?K? @O?K|2!ˀK>k?ok? k?7D77%A <74zA 4!r@ZHC!b7hC9A 4z!BHKv < 4:Pk?!LHdK?!74M7 r C4\ 4 4Hw 2C4 # 7pA 4z4K>K?K? @O?K|2! \ 4\K|2!k?ok? k?KW67kVB6kBB47D7w#qи"H64`xB24rb"HKA# 7 pKSA a "4_40 `K>ق#@#"ӽc4 7?A \$A00N8E$IE IR\7Ӆ ] HB3Bց ?-֝ ӵ?@ Hg?HKA" 6 K_A  !4HKVKYHA 6 !p4Hˀ a4 8 B" 6].K|2!=@K>HK\" 6 pK]A   `44@\@0 `K>K?K? @O?K|2!?@4K|2!?@]HK|2!?u@uHg? \ E4\ k?ok?k?7DA44 87Ke2!4K?YK?K?@O?444_4yKaȀ!@HK_" 6KYA  ? 0Ke2! HKW4xKTA,  4HKS4K\A  (@A4z4Ƞ4Ke2!4zA@?@e4Ke2!?4z=Hk?ok? k?7CA44 x7Ke2!4K>K?K? @O?Ke2!! A4?4(4444z_=4Kȃ?@HzKW < 48KTA 0Ke2!?=@HzK]4K\A >+4HzK_4XKSA <  A44_4z ȼM4A4 k?!Ke2!444z_7KxȀ @HzKVKDK?!A  4HzKC4KWA  (@AdK?!4Ƞ54Ke2!K?!A,@?@4Ke2!?K?!=Hzk?oK_4C h7C4Ћ7 7hz_4z z4z_4 RXK?Y7h}_4z "4z_q404K?Y@O?"| 6| k?ok> k>K_47CC"7hz4_4z%7HzKY# 7`K]Al %r47>i_=4z%74K},7hsHz# KTKE A7,44z_I@$x7@4z$X7_4zk>!A4#(7444z_e44_ 4z 7@@4z7"@Hz"| K_6x@KSA  "4HzKYK]K>!A *Ƞ`K>!47*7hCҕ6?{4?#\ 7U( Ke2!"RAH4"z4Ke2!"b4zKe2!"B4zKe2!""4zKe2!"4zKe2!!4zKe2!!x4zKe2!!4zKe2!!h4zKe2!!b4zKe2!!BX4zKe2!!"4zKe2!!@4zAK>!Ke2!Ke2!=oHzK>!A`@KtȂ=@HzKV4@KUA =+4HzKU4KTA A444K=K>K> @O>Ke2!?4u7>i7hbHz < KUK_ Ax48<@44z@@?%747hdHz \ KVKW 4XA@<_+44z@@>7u4Hz7hw# KBK] A@7Ѓ;+44z@x@=747hxHz" KDKS d A6;o+44z@@=U7E4Hz7he K\KX  A4 :+44z@H@<747hHz KAKY ! Ax4P:}@44z@@<%74Hz7h| KAKX  A4p:@44z_@;74_4z;e7HzKT4K_AH 9+44z_i@:747hvHz K\KW A49+44z_@:]74_i4z:57HzKS4KEA 8+44z_9@9747haHz KBKY " A4Ѓ8'+44z_@9-7_4z9 7HzK]4KDA 7+44z_@874Ke2!844zKe2!# =7P"| %6ek?ok?K_47CC!7hvB?4bcz4fCh@HzK\KAHx8A< #@4H7hyKxCЗ"6?HzKW# 7pK]A "4HzK]7a(KT $ A "4HzKU4KVA "ˀ44#7huBӟ4`b4dBrHzKU4KBU A@"H4HzKVK\Hx8A "04Hd4hxKw@_ 7?HzK_" 6KYA ? !4HzKY7b'KS D A y !4HzKT4KUA !44K?YK?@O? 40K|2!?@HK|2!?@HzK|2!?e@%HzK|2!?=@-4 \ 4\K|2!>@HzK|2!>@HdK|2!>@HzK|2!>@5HzK|2!>]@M4 | 54|k?ok? k?k?k?!KW47Ck?1B7%"44?!4_#:4%4! @@4z 87HyK34K=  44K>K?!K?K?K? @O?Kg2!?4HKg2!?4 HKg2!?g44z4z@H4?%7?44Kg2!#@HH4X   A4?@46h|4z_e4>]7HzHA4T>o+4H4 4K?1_4z=746ha4z_4=7HzHA84L=+4H45 6hv^U4z= 7@4z<7^4zHzC_4 (7K?14z_44 "4z@x4@@84z h7^U4z H@HzK_4@KUA  Kg2!HaH4H?  <@# HzHA 7Ѓ<_+4HzHA04 H@HH4X   A44Kg2!HvJ# 7@J  HzK]KWA :+44z@ 4:-7H4_ k?ok> k>k>^m7Ck>!Hx4z4C_k>k>)4``з4r@4 4"j7>@4z"(74A407^4z"k>14z@ P4HzK_4KUA $H9^u4zA44HzKY4@KBY A @$44?^4z_4z#7K>1^4zK>K>!^]4z#P7(4zHzKT" 6@K_A $4H|7h_4z"7??K>4z4‚@J4`:4䀶 *@4z"P7Ȁ(4z6?4? 4 +Kf2!#\ 7F4@4z>74@04z!7Hb@Z4U>@K>K>!^54z!(7@4z>M74He@@0@` 4r@ 4!7>@4z x7Ha@94 *@4z=}70444z^K>)44K=K>K>K> @O>Kf2!?4HvKf2!?4X4zKf2!H9^4z@4??4HzKf2!?454?@ 4z>7H|4;@Ȁ4zK>!7>_4z>}7ȀU4zKf2!>_4UH|HzKS# 7`KFA >7+4Hv6hf_4z=7@He4hw_ Y4z=u7HzK]4@KEA@ =+44z_E@=77#< 7&k?oKW7CB4X x4‚@ 4@ \ 4\0K?Y@O?K|2! @K?Y@O?6h|_ 4z04K?Y@O?7}%)  " < K?Y4<@O?HzK_KY@D ? ?+4HsK?Y6tˀhtk?ok? k?k?k?!k?)k?1KT7C7$B4 4@4H4 44A4!Hs6aha@?! b HaH6? !4@A4!hK|2!Ha"H7? !4@A4 K|2!@4K>K?1K?)K?!K?K?K? @O?H^4H7? >_44@A4>?4EK|2!5K|2!44A4>HsK|2!44AX4=HsK|2!k?o7Ck?^4!HtB4: rK}Ȁ H@HzK_# 7KW@T  p4Hs6uhuK?@p4z J4z^404 K?YK|2!?HsK?Y@O?k?ok? k?k?k?!k?)k?1k?9k?Ak?I7DKZ(4?KAKF7% @44P!z4 HC"4" 4'4!< 4 @!^ 54 4 _4!@^ u4Ka7I7? U!4@@50Kk2!75|K>K?IK?AK?9K?1K?)K?!K?K?K? @O?Kk2!`?5|mH|m5|IH 5@  H!"7hHC 4c>@HKB4RKH  @@!J4 !b!\ u5K4 8@HH@5>@Kk2!@5`?H5|`:HK_58K]@  :4 4_ @>}7}5|Kk2!`?4U5|Kk2!`>@-5|` !< `05+@5|k?7^@04K?Y@7?k?ok?k?k?7%7D^E44!4HC]Ӻ4 pӿ4`A4ra @4!7444_4y7! !j!"`# 044K?YK?K?K?@O?Kf2!?@@Kf2!?u@(H^U4 @@4 p@^474^]4ܞ@ܞ4Kf2!ܞ4ܞ4_ U4>}7 P@HK_" 6KS@   Kf2!HH=H? 6?= HKY4KE@L =+4`>@HKW4xKBW @$@=+4HK\4KS@ |  @`K? @O?HzK_KY@ ?  4ˀK>K|2!?@}K>k?ok? k?k?k?!k?)k?1^7C4 7K|2!K>K?1K?)K?!K?K?K? @O? @HzKW4KT@\ "ˀ4zH|8k?A@\4 h|8%K|2!4^4z>@4x^)4z>@4& 444z^%@>@@H4z>m@^e4zHzK_77K]@ t  44^M59HuB>%@4|^ 4z=@Hb4AhaK?A@Hz8he84z^M4ˀ]K>K|2!>4z5K>K|2!?4 K>k?ok? k?Kt7CK_ C4€@b4`RKe216?? 4!z4ăD!4҃"4؂"HzKU4PK]@ $ #44z_-@"7HzKT4RKY@ 4 #Z44@@#Xk?)Ke2!Ke2! 4Ke2! h4Ke2!@K?!!:Ƞ84 47hb@_4` p@HzKS#< 78KW@ L ?+4Hu6Ƞxhv4b? RHzK]# 7K_@ >+ȠHu | 4e4K>K?K? @O?7h|@4k?!444z^m7 H7HzK_KVK?!@L  ȠKe2!4 d8 HzKWИKU@ =o+@K?!m4Ke2!>4M4zKe2!>w44444z^7 x7HzKAKBK?)A @@ (@@K?)4Ƞ4Ke2!@K?)?@4k?oK_4C!7C4 Z7hC4 j7h}^4z b(K?Y_4z04K?Y@O?_E4z?@4z^ 4?@47hs@H4z?e@4z^4?=@-4k?ok? K_47CC 4"@4z!744^q4z"7?94^4z"h@^4zk?K?9BP@HzK_4PKV@l 0Kd2!"@_4z7!@HzK]4RKY@ = !4HzKYKWK?@ #@@K?h44>_4@4z2D44K>K? @O?Kd2!?404zKd2!?4xK?9Kd2!?44z4=4?C4Ȝ%4Ȝ4Kd2!>]@@K?>4HzKT4PKU@ >+44z_@>e7HzKS4RKT@| >w+4K?9&>4HzKU 4K]@ >7+44z_=@=7HzK_4RKC@  ȀE4EKd2!Kd2!='4 4k?o7C^4拀 4^4z @_4z p@HzK_# 7KW@h  @44z^@04K?Y@O?K|2!?@4zk?oK_4C 7C_ 4z BHK?Y_4z "4z^q404K?Y@O?47 Z7hsBz4?m@^4z?@]4z" e6k?ok>k>7$7C^4!He@4 Z4?k?K?4Y4z^Y4'(7#< 7<4`` 4r@4b"4B47?4H^4z?5@K>YK>K>@O>K|2!?@4K|2!?@4K|2!?u@ 4K|2!?M@04K|2!?%@4K|2!>@4K|2!>@04PK|2!>@@4K|2!>@4K|2!>]@4K|2!>5@Hd7??4?#\ 7_h `4HzKU# 7KA@5 ?U@ˀHHdHzKT 4 KU@ =o+44 4@HzKS 4`KT@@ ='+44 `4HzK KVKW 8 @4<+44*@4<+44 HzKx KAKY @ ! @4pYHzK\KW@  844z^404 K>YK|2!?4zK>Yk?o7C^!4!@^A4z!b4^4z!@@HzKY" 6K]@ !4HC4V HzK_" 6PKS@   44H|7ha@4z JPK>7?^4z "4z@x404K>@O?K|2!?@HK|2!?@4k?oK_4C!7C7haKtȀ BHzKW# 7pKV@ "4HuB4`?@4r_`47?i4^4z!K}Ȁ "K?iHy]6!ZK|Ȁ!@@HzK]4KC@}  jˀ4KsȂ`?@HzK_4bKU@p  ˀE+`K|2! K>و jKvȀ ZHzKS# 7KBS @@ ˀ K|2!04K>@O?K|2!?@HuK|2!?@=+`k?ok?7CJ-k?A2@4!@w4!^a4z 7Kd2!^4z 7^14z4^ 4z X7^94zk?K?@ 7 hKd2!@hK?^4z@4K?@ P4y Kd2!@44K?YK?@O?k?7" k?6Ke4 P4K?Y@7?H? @@`K?ˀK?Y@4k?K?_m7?+@PK?]K?YKa?# 4:@J Q7J@K?YKu5Ks5 k?Ku2Ks2 k?Ku3Ks3 k?k?/,/-o`k>k>k>k>7CJa7$4 dZ7?  04 4 K%4$4_7?aK?iK?a _ Kg  G k|#07 `/ ' \0"~4%4F 6g67b$@K0@ Kv0@1` 9`@01,N 7>1 N4 9AD'D400@8@00@0 2N 8G'W0@1lN9!F'F0@018@0 2N0@1LN 8G'X:F'F0@0 1a8@01LN0@8G'X1 N :F'F0@0 1!8@01lN   1 N ]  :F8G'F0@0 'X1A3  1,N4z9E8G'D   8G'E t    _E  `2K7<¤\kw `4?K>YK>K>K>K>O>/0-@/0,k?ok?7$ 047C] 4 d74  `K?YK?@O?k?7k?] 4k?K?_%7K?YK?@7?k?o7CJ]KZJM4zK?Y@O?k?7K_k?J@K?YK?@7?k?oK_777C`7 Y7@  y] Hz |K?Y4|@O?K_@@k?ok?7CY H7$H_4z B4K?YK?@O?JI@HHzJHHς k?ok?7C7:JIk?74z_-7 "4K?YK?@O?HzJMK?ς dk?ok?k?7C7X @7%HH  _m4z *ˀK?YJ@HHwA`@ "_P4_?HvH 7   _6?` H|H w <  6?7?HtH    U7?77?HzH  z X HsH S y  4HwH Q HHHt 4hsK?YK?K?@O?k?ok? k?7C7%k?!J7Hu7 _4z0ˀHwA2 }P7?Hb W   B  9_6?` Hsw   VHt6?   !7?H}   Hs6? D z   \=7W?HvK?! Q4H| ha4K>K?K? @O?k?ok?k?KU7$7C7_60ˀzHwA2 }P7?Hb W 6 B  9_6?` Hsw 6 VHt6?7  !7?H} 6 Hs6?7Tz   \=7W?Hv  4Ha4"hbK?YK?K?@O?k?ok?7C7:Jk?Hx7  _4z "4K?YK?@O?HHw JK?Hy $ ςhzk?ok?KT7$7C_60ˀbHwHy 4Hs6Hz _ H}7huK?YK?@O?k?ok?k?k?77C7&` H x` Ie@4z_40ˀ4?AZY?P7??HHz  W  Y \_6?` HH}  t 6? HHv 7?  " E 7X?HHa:   } 7?HH|  Hs d 4 dK?YK?K?K?@O?k?7@@K?Y@7?@ @K?@ @k?7@@K?Y@7?k?7@0@K?Y@7?k?ok? k?k?k?!7D@"7%@"Kc @4&HyJ 4 bHc`?Hy" ZHyJ 4#j(04$ 4J i4 āHz]4"@7J 47]4 |"74J 4(04' 4J 4 gJ )47]4!`744Ju4Hz @J@ fJ47]a4 | 74J4K (@KJ4@@K 0kcˀ0K>`u@ (04< H|ˀK>ˀK>ˀK>ˀK>KeH jKJ4`H@HH (@KJI4_@H x H|K>K?!K?K?K? @O? _ : W ]  SV@ \CT x4@ӿ< 77Z<  @?@@Ku4Ks4 k?k?o7hd>he>hf>hg>hh>hi>hj>hk>hl>hm>hn>Ka?H&7$7H7 %4%0Kh2AKj %IYJ5 eIJ@?IY@%zIG@4^"!@J475s4 K?K?g~4` k?k?77h_5 @H4 D 4`5@ K?K?~  k?k?77h_]5 H?w5@$4JA4!|05y @ 07IY@ 7@ 5:75:@ 77J)5z7J5 5 K?K?~4`  k?k?5y7@ @7!|05y @ 77@ 55y@ 7J95:7K?K?~4`  k?k?A774 tp4 `55775)76 7,?5yJ5!5y Jq5!45@ H5X 75@4!I  @5 @x4!X@ ?5!2A7 ("5)A7 ?5)>E@  ˀ84~4 !0M5 h44~Hb>YHn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>˄}hmhk?ok? k?k?k?!k?)KG7C k?1@h4zHc`#Hh( H0"jHf$4HsHw d Hg$XH: GImK?1DRĄX@H}7G? ܋ #D!HHt( Hu0 刀 6# @#*Hx7G? Ջ#D?Ht(Hh  Hh#Jz HIUK?1?-HHa Hy' Hc "Hx C HwH Hh!J HIK?1>HHb H}G Hc!H C IK?1K?1_7Hs(76yHt76y?Hb07 E 7@=Hyˀ8K>Hx Hc!H CK>K?)K?!K?K?K? @O?ˀK>_M@\E@_-@\@_ @\ H _@\E@_@\Hˀ K>_@\H_}@\ H _]@\@_=@\ G @4ś7 Ş'H| ˀMK>_@\% C L҇L HzH ZD:D  "0@60#0@7P#<0@7<p#\0@7\#0@7"|0@6|#0@7"0@6k?o |0k?Ke4z C @K54z C `@KK? C 0@K4z  C04|K?Y@O?C8X7? (7W6 ?7@6?k?ok? k?k?@ 7E@ 8Kc2A(04$ 4I4 @(04$ `kd2AIE47\ k?! 7K?!4J4kf2A I4zK|2AK>K?K?K? @O?k?ok>k>k>7#7I]k>k?K>4k?7z7k>k?k?k?yk?qk?ik?ak?Y@k?Q!7@4z X7I47\e4"`74z4J4k?Y7?7? k?7?7?!k?7?7>k?7>7>k?y4z@k?K>I7K>k?47k?QK>4k?K?k?K? k?K>k?yK?k?qK?k?iK?!k?aK>@K>! 7Ƞ4H @@x4H H 4 `4 KX @ @ J 4c ? ``4@44K>YK>K>K>@O>H @@h4H jH  X4 K_ @@ K:@  ?4?4I4z4 _ : W ]  SV@ \Ku5Ks5  k?Ku31Ks39 k?k?ok> k>k>k>!7D4@KZ@" _4"p77>_ 4 K>48bb@\UK>7" K>4g44_4!@ _ Y!4H B4% # 7 *!\48 !H7 H(4 !hHz"H!hHz H!hHzH C   !`Hz H C h !XHz(h(H!XHz0 Ch0Kg2Q40kw2QY4K=Yy4K=K>!K>K>K> @O>I4zK=_@\}@_@\ _@\H_@\H_u@\h(_U@\ C I 4zI4 Ku3Ks3 k?k?ok? k?k?k?!Kd14%7C4&4tk?qKx2i!:4K2qC 4 "7k2qC?7 8077k2qC ?7_ @ _?'k?qK2qC?=@>k?q4K>K?!K?K?K? @O?k?Ky7?q_4>K2qKKu5!Ks5) k?k?o 7hd6he6hf6hg6hh6hi6hj6hk6hl6hm6hn6ho6757$K?K?~`4`  ~k?k?7Y77JI4#0 70J!4 <049I4#P7DvF04Ka?4&4'4(4 4 F44z7qIe4%H@u7q4k7q"Һ ߀ H@H5kA}"Ӻ |ߋ?5kA _85l5kAbZ zH"B ߈ RH5kA|Ӛ@ *"@ \߃?5kAa ` 5kHAx! Ѽ߀ BH5kAv! <ߋ?5kA|#25m5kAw rH!b <߈ JH5kAw@ "!: Ҽ߃?5kA!* `5k0 iȀ04_@-@_@UH_@@_@H_@%@_u@EH_U@@_5@H ` 5kKy2iKs2ay @h@I57\ u5!755J5Kx2iKt 5I57\ 5!0755Jy5Kb2iK 4Ko2i5kw2i5zI-4 R44z7qI40`i7q4I4z7q?4Dz4I4 "KzKy2iKw1 JQ444~Hb6YHo6Hn6Hm6Hl6Hk6Hj6Hi6Hh6Hg6Hf6He6Hd6@O6k?ok?K2a A04#\ ڃ `7K2iKy I]4Kw2a +`IKzkdkc2aK?YK?@O?@P@K?@ @Ku4Ks4 k?k?7KZ_K9K?Y@7?k?ok?k?7#7D 84I47  `?44K?YK?K?@O?k?ok?k?7#7D h74 44I@7 `? ?4K?YK?K?@O?k?o X7\ x4I77x7K?Y 04K?Y@O?"}6vT"6*  " < 6"6&g?  Y p _ 4  @k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=64 k>4K=ak>K=iI!k>K>K=q K=yK=K=CCK=4xk>cC 4yk>ǃC 4 `_#ªIa57J (@I5!e6 J?@R4K=Y I56O \7#7K>K>5I4^K>K>4t_%566? 6@ 4CC*cCZǃCq> #ǣCr@$"K>7@ 5J>M@$jK=Q`$ZK>_K>7_4z@7>p֟t&a&i8G&qFq \4:(#7P64ǣ@ 4@ `4 @47`4 4eK=YI15zM7I5ZU7I5:]7I4%7I457I45746K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>47@(5ycܥ@4\7@5Yǃq>4\7@59Eq>z?@ V47@h5ǣr4V7@04r4X77@4`47@4eK=QI56K>_K> 4 @K> @K> (K>J I K>K>_]4 0o4oAj6 o!:4  40 ! Ǐ@K>K>_=4 7k?Ii6Zk?K>76Yk?5k?k?yk?qk?ik?ak?Y_k?Q - K>6X_uK>5?575?~@6 M Ku3qKs3y k?Ku6Ks6  k?Ku4!Ks4) k?k?ok? k?k?k?!k?)k?17$7C4 4Ka?H?4'4h " <߀ : 4! \ 4"?5 4 \5!7!4 Ka?4'H `Ӻ! \ 0@ `_Ӛ `@H `!2 < `  4?%4c 4K>K?1K?)K?!K?K?K? @O?_@H_@H!<059@H4ܞ=@_@m@J@C8X7? (7W6 ?7@6?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK>76K>7I4K>4 K> K>y ` @ :C_ 4 4 r4V_ b4X R5)A? 8 (@ ( _8 ?5)K:: I4K?IK?AK?9K?1K?)K?!K?K?K? @O?? crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)? crt0: errno: tsd?|X$,L|d4 lDt\TtUsage: %s OPTION... FILE... Display information from object FILE. At least one of the following switches must be given: -a, --archive-headers Display archive header information -f, --file-headers Display the contents of the overall file header -p, --private-headers Display object format specific file header contents -h, --[section-]headers Display the contents of the section headers -x, --all-headers Display the contents of all headers -d, --disassemble Display assembler contents of executable sections -D, --disassemble-all Display assembler contents of all sections -S, --source Intermix source code with disassembly -s, --full-contents Display the full contents of all sections requested -g, --debugging Display debug information in object file -G, --stabs Display (in raw form) any STABS info in the file -t, --syms Display the contents of the symbol table(s) -T, --dynamic-syms Display the contents of the dynamic symbol table -r, --reloc Display the relocation entries in the file -R, --dynamic-reloc Display the dynamic relocation entries in the file -V, --version Display this program's version number -i, --info List object formats and architectures supported -H, --help Display this information The following switches are optional: -b, --target=BFDNAME Specify the target object format as BFDNAME -m, --architecture=MACHINE Specify the target architecture as MACHINE -j, --section=NAME Only display information for section NAME -M, --disassembler-options=OPT Pass text OPT on to the disassembler -EB --endian=big Assume big endian format when disassembling -EL --endian=little Assume little endian format when disassembling --file-start-context Include context from start of file (with -S) -l, --line-numbers Include line numbers and filenames in output -C, --demangle[=STYLE] Decode mangled/processed symbol names The STYLE, if specified, can be `auto', 'gnu', 'lucid', 'arm', 'hp', 'edg', or 'gnu-new-abi' -w, --wide Format output for more than 80 columns -z, --disassemble-zeroes Do not skip blocks of zeroes when disassembling --start-address=ADDR Only process data whoes address is >= ADDR --stop-address=ADDR Only process data whoes address is <= ADDR --prefix-addresses Print complete address alongside disassembly --[no-]show-raw-insn Display hex alongside symbolic disassembly --adjust-vma=OFFSET Add OFFSET to all displayed section addresses Report bugs to %s. adjust-vmaall-headersprivate-headersarchitecturearchive-headersdebuggingdemangledisassembledisassemble-alldisassembler-optionsdisassemble-zeroesdynamic-relocdynamic-symsendianfile-headersfile-start-contextfull-contentsheadershelpinfoline-numbersno-show-raw-insnprefix-addressesrelocsectionsection-headersshow-raw-insnsourcestabsstart-addressstop-addresssymstargetversionwide%3d %-13s %08lx %08lx %08lx 2**%u %s%sLINK_ONCE_DISCARDLINK_ONCE_ONE_ONLYLINK_ONCE_SAME_SIZELINK_ONCE_SAME_CONTENTS (COMDAT %s %ld) Sections: Idx Name Size VMA LMA File off Algn Flags%s: no symbols%s: not a dynamic object%s: No dynamic symbolsgnu_compiledgcc2_compiled%s <%s-0x+0x> <0x%s(): %s:%u .hrOut of virtual memory ... %s: %s %02x : %s *unknown*Can't use supplied machine %sCan't disassemble for architecture %s Disassembly of section %s: : No %s section present %s has no %s sectionReading %s section of %s failed: %sReading %s section of %s failed: %s Contents of %s section: Symnum n_type n_othr n_desc n_value n_strx String %-6d %-6sHdrSym%-6d %-6d %-6d %-6lu %s * architecture: %s, flags 0x%08x: start address 0x %s: file format %s %s: printing debugging information failedIn archive %s: Contents of section %s: %04lx %cDYNAMIC SYMBOL TABLE: SYMBOL TABLE: RELOCATION RECORDS FOR [%s]: (none) DYNAMIC RELOCATION RECORDSOFFSET %*s TYPE %*s VALUE %-16s %-16d %-16s [%s]big endianlittle endianendianness unknown%s (header %s, data %s) %s %*s%s UNKNOWN!%*s COLUMNSBFD header file version %s binutils/opt/binutils/share/localepib:m:M:VCdDlfahHrRtTxsSj:wE:zgGunknown demangling style `%s'--adjust-vma--start-address--stop-addressBLunrecognized -E optionbiglittleunrecognized --endian type `%s'objdump%s%s() 0x%lx%lu%ld%08lx%s: %s: void%sint%dfloatdoublefloat%dcomplex bool%denum { /* undefined */, = }(*|)*|(|) (/* unknown */...&|range ()::|[]|[%s]|[%s:%s]int /* string */set { /* bitstring */::|class union class ::| (const |volatile |%%anon%u { /* size %u id %u */ publicprivateprotected/* ignore */: ; /* bitsize bitpos */ %u size vtable self static virtual public protected private /* unknown visibility */ /* bitpos volatile const /* context voffset */; struct union /* id %u */typedef %s; %s; const int %s = %s; const double %s = %g; const %s %s = %s; register %s /* %s */; %s (%s /* %s */) { /* %s */ /* file %s line %lu addr %s */ } /* %s */ ?UUUUU\%s: no recognized debugging information.stab.stabstr%s: %s: %s %s: %s: stab entry %d is corrupt, strx = 0x%x, type = %d .debugLast stabs entries before error: n_type n_desc n_value string %-6sHdrSym%-6d %-6d %08lx %s  (@`|`` 8  p` < d`pppp|PhPx%s debug_add_to_current_namespace: no current filedebug_start_source: no debug_set_filename calldebug_record_function: no debug_set_filename calldebug_record_parameter: no current functiondebug_end_function: no current functiondebug_end_function: some blocks were not closeddebug_start_block: no current blockdebug_end_block: no current blockdebug_end_block: attempt to close top level blockdebug_record_line: no current unitdebug_start_common_block: not implementeddebug_end_common_block: not implementeddebug_record_label not implementeddebug_record_variable: no current filedebug_record_variable: no current blockdebug_make_undefined_type: unsupported kinddebug_name_type: no current filedebug_tag_type: no current filedebug_tag_type: extra tag attemptedWarning: changing type size from %d to %d debug_find_named_type: no current compilation unitdebug_get_real_type: circular debug information for %s debug_write_type: illegal type encountered$h% $h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h&% $h$h$h$h#$h$h$h$h$h&$h$h$h$h$h$h$h$h$h$h$h$h$h&$h$h$h%$h$h$h$h$h$h$h&$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h&$h#$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h&X$h&<$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h&$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h"$h&$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h$h#$h&$h'1$+@1$1$(\+1$1$1$1$1$1$1$1$(1$--)81$.(1$.1$1$1$1$1$1$1$1$.1$)1$1$(\1$1$1$1$1$,L1$1$1$0t1$-L,L*|1$.t:54::8X:6:8,::6::6666666666::::::4:8:::::::::::::::9:P:::::::::::::49::98::::8::::::9:::::5OROOOROOOOOOOOOOOOOOOORORRRRe aHahaaaabb$bDbTbtbbbbccc8cTc`c|ccccdd$dDddddddevwDvvwDvvvvvvwDvwDw<wLw<wDwTwDwDvvvvvvvvvvvwlwtw|vw|vvwdvvwdvvvw<vw|wdvvw\wdwd|x4~~tllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllxllllllllllllllllllllllllll0 lHllTllllllllxnumeric overflowBad stab: %s Warning: %s: %s N_LBRAC not within function Too many N_RBRACs gcc2_compiled.gcc_compiled.unknown C++ encoded nameunrecognized cross reference type01000000000000000000000;0777777777777777777777;01777777777777777777777;long long intlong long unsigned intmissing index typeunknown virtual character for baseclassunknown visibility character for baseclass_vptr$unnamed $vb typeFOO_vb$unrecognized C++ abbreviationINVALID_CPLUSPLUS_ABBREVunknown visibility character for fieldconst/volatile indicator missingmember function type missing__ct__dt__%s%s__%s%s%dNo mangling for "%s" intUndefined N_EXCLType file number %d out of range Type index number %d out of range Unrecognized XCOFF type %d charshortlongunsigned charsigned charunsigned shortunsigned intunsignedunsigned longvoidfloatdoublelong doubleintegerbooleanshort realrealstringptrcharacterlogical*1logical*2logical*4logicalcomplexdouble complexinteger*1integer*2integer*4wcharlong longunsigned long longlogical*8integer*8bad mangled name `%s' no argument types in mangled string ___typeNoSuchStrinG__::NoSuchStrinGbool__wchar_t,Xl4Ph <lXt,Lpll(DP||<(0L  D  !!(!D!`!|(( D  L D %s: 0x%lx: %s (0x%x) %s: %s unexpected end of debugging informationinvalid numberinvalid string lengthexpression stack overflowunsupported IEEE expression operatorunknown sectionexpression stack underflowexpression stack mismatchunknown builtin typevoidsigned charunsigned charsigned short intunsigned short intsigned longunsigned longsigned long longunsigned long longfloatdoublelong doublelong long doubleQUOTED STRINGinstruction addressintunsignedunsigned intcharlongshortunsigned shortshort intsigned shortBCD float type not supportedunexpected numberunexpected record typeblocks left on stack at end*global*__XRYCPPunknown BB typestack overflowstack underflowillegal variable indexillegal type indexunknown TY codeundefined variable in TYPascal file name not supportedunsupported qualiferundefined variable in ATNunknown ATN typeunsupported ATN11unsupported ATN12unexpected string in C++ miscbad misc recordunrecognized C++ misc recordundefined C++ objectunrecognized C++ object specunsupported C++ object typeC++ base class not definedC++ object has no fieldsC++ base class not found in containerC++ data member not found in containerunknown C++ visibilitybad C++ field bit pos or sizebad type for C++ method functionno type information for C++ method functionC++ static virtual methodunrecognized C++ object overhead specundefined C++ vtableC++ default values not in a functionunrecognized C++ default typereference parameter is not a pointerunrecognized C++ reference typeC++ reference in class with no fieldsC++ reference not foundC++ reference is not pointermissing required ASNmissing required ATN65bad ATN65 recordIEEE numeric overflow: 0x%08lx IEEE string length overflow: %u .debugbfd_make_sectionbfd_set_section_flagsbfd_set_section_sizebfd_set_section_contents%s: %s: %s GNU objcopyIEEE unsupported integer type size %u IEEE unsupported float type size %u IEEE unsupported complex type size %u __anon%u_vb$%s_b$%sshort unsigned intlong intlong unsigned intlong long intlong long unsigned int<<0>|<<=====gt>le<=lt<plus+plapl+=minus-miami-=mult*mlamu*=amlconvertnegatetrunc_mod%mdamd%=trunc_div/dvadv/=truth_andif&&aatruth_orif||ootruth_not!ntpostincrement++pppostdecrement--mmbit_ior|oraor|=bit_xor^eraer^=bit_and&adaad&=bit_not~cocall()clalshift<<lsals<<=arshift>>rsars>>=component->ptrfindirectmethod_call->()addrarray[]vccompound, cmcond?:cnmax>?mxmin*szsizeof autoAutomatic selection based on executablegnuGNU (g++) style demanglinglucidLucid (lcc) style demanglingarmARM style demanglinghpHP (aCC) style demanglingedgEDG style demanglinggnu-v3GNU (g++) V3 ABI-style demanglingjavaJava style demanglinggnatGNAT style demanglingconstvolatile__restrictconst volatileconst __restrictvolatile __restrictconst volatile __restrictoperator operatorassign_type_ada____<%s>global constructors keyed to global destructors keyed to import stub for statictemplate <class> class()%d.e'falsetrue0JArray1Z__pt____tm____ps____S,_GLOBAL_{anonymous}___imp____imp___std____sti___ virtual table0123456789Qt__thunk_virtual function thunk (delta:%d) for __t__vtbl__::[]unsignedsigned__complexvoidlong longlongintshortboolcharwchar_tlong doubledoublefloat%xint%u_t-2147483648U...__ct__dtT%d--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument %s%sCannot allocate %lu bytes after allocating %lu bytes undocumented error #%d˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰˰ˠˠ˰˰˰˰˰-+ #0hlL???UUUUU\\\\\\L0\\\\\\\\\\\\\\\\\\\\\\\\\|\\\\\\\\\\\\\00 00000@0X00X0X0@000000000000000000000000000@   T             d     Allocation failed.Expected ?std::Unexpected end of name in .::Unexpected character in .Unexpected character in .Zero length in .Internal error.Unexpected end of name in ._GLOBAL_(anonymous namespace)aN&=aS=aa&&ad&ancl()cm,co~dV/=da delete[]de*dl deletedv/eO^=eo^eq==ge>=gt>ix[]lS<<=le<=ls<<lt<mI-=mL*=mi-mlmm--na new[]ne!=ngnt!nw newoR|=oo||or|pL+=pl+pm->*pp++pspt->qu?rM%=rS>>=rm%rs>>sz sizeofoperator operatorUnknown code in . [nv: [v:Unrecognized .guard variable for vtable for VTT for typeinfo for typeinfo fn for typeinfo name for java Class for non-virtual thunk to virtual thunkcovariant return thunkconstruction vtable for -in-Unrecognized .Error.in-chargenot-in-chargeallocatingin-charge deletingUnrecognized constructor.[Unrecognized destructor. [::*Non-pointer or -reference function type.complex imaginary Unexpected character in .signed charboolchardoublelong doublefloat__float128unsigned charintunsignedlongunsigned long__int128unsigned __int128shortunsigned shortvoidwchar_tlong longunsigned long long...Unrecognized code.Non-alphabetic code.restrictvolatileconst [extern "C"] , Missing function return type.Missing function parameter. () Template parameter outside of template.Template parameter number out of bounds.ibi iii ll ii i Unimplemented.falsetrueUnrecognized bool constant.:(stdstd::allocatorallocatorstd::basic_stringbasic_stringstd::stringstringstd::basic_string, std::allocator >std::istreamistreamstd::basic_istream >basic_istreamstd::ostreamostreamstd::basic_ostream >basic_ostreamstd::iostreamiostreamstd::basic_iostream >basic_iostreamUnrecognized .Substitution number out of range.string literal [# [#0]_ZMemory allocation failed. abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789?!B>XXXXXX/opt/binutils/share/localemessages/.moCPOSIXLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_ALLLC_XXXLANGUAGELANG/locale.alias/opt/binutils/share/locale:.riso@,B,XB0C\@C`ClPCpCpXCtCCCCCCG0XGhIIII I IIIIII0I4I4I8I8I<JJ JJJ8J<LxL|P8PPPPPPQQQ Q<Q@Q\Q`Q|QQQQQQQQRRR R8R@S SSS S<S@U|UUUV VlWWWX YY\<\X\\]4]8]]^^^^`T`X``cccccccccccddde`edghh<h@ijjjjjk`kl8l<lHl|opqqq0qd|P8}0(8T 8<0`dtx 0 ,0 0\`X\  <tx,xx | tx <t$(Hd (D`|@D$@(,\x8T@\ 0 Lh DH,00¸¼ xŔLP`|x|4hlɄɠ|ˀ ( $(D\xΐάdh XtРФ8pѸ! TpҠҤ0Lx|lՈTptx״׸|0 ڀL0 Pސ ޔ޸ ޼߀߄48hl| $04 $LPpt 04lp$(X\  @DptLP $pt ,0LPTX`d,0x|$(\` 48 <@dh,0lplplp  @D DH\`lp <@ 8<lp|   <@\`PT`d<@   < @ |   !T!X!!!!&8&<' '\**101450 54: :;L;P;l;p?t ?x@ @ @@APATAABBC CC CEEE<E@GGGGI IIh IlKlKpLxL|MMRT(RXS(TW WX  X$YxY|YYZZ\\\\\\\\\\]]]]^l^p^^^^____` ``\```|```aDaHe@eDf,f0f\f`ffg0g4gLgPhhhthxi ii`i|jjk<k@ll llm mn nqqr,r0v< v@x xyyz z{< {@||| |$ptx|tx,0PT    HLDHLPT XX X  ( ,DH8<hl@@X\HL HHtx(,єј|ҀPTLP\`԰Դ|ՀLPDHx|۔ۘ۰۴TXިެpt`d(Dh l@ tPT \ xptp, Lh   @\ x,Hx(,@t 0 4    4(DTXx0<X$ #H#d######$$0&&($(@+++,--- -$/H/L//0011411123p3t3377889L9P99;;==>>A AA ACt CxD8D<ETEXElEpEtExI0IK0KLLL(LDLLLLMMM0MLMtMxMMNTNXOO4O PP<P@PtPxPPR R R$R(RhRRRRRT@TDTpTUHULUUUVV$V(VVVVWPWTW`WdWWWWWWXLXPXpXYDYHYTYXYYYYYYYYZZZZ[[]]_ __P_T__aab\b`bbbbi i i$ i(jjjjk klx l|m`mdmmoxo|rTrXuuwwy(y,yXy\}H}L}}~~lp|L P hl  8<  4  lp<@txPTPT$ (` d(,x|04$(PT tx48 |€dhÈäĄĸ80lƈ4Px|@\ɴɸ(dʘ 8 <dhΠbΤb@D $04<@HL\`АДФШx|ѴѸDHlp҈ҌҐҔҠҤ$(|ӀlpԴԸ04ՈՌPTdh؜ؠؤبڴڸ,0۔ۘ$@|܀ܴܸݨݬݸݼިެ PT $dhpt| p thl@D 8 <|  <@T X @DX\TX48 p t X \  \E`,0x|04DH $(lp! !! !##$$$$$$$$$$$$$$$$%%%%%%&\&`(D(H((()* *+( +D,,,<,X0 001(1D1H11222P2T225 57 8<9999::= G8 GP V$ W W \@ ` ` c c d j j kd lL o o q4 | 6 <      0 H $ x L  , d     (  ` <   D   4 l     | d  Ɉ   , ` Δ  \  <  `Ѽ X 4   p  X  '$ '<S id   , D \ ` t     P     D   | 0 |   D \      , |    @   #L # #  ## $ (( , / 1 1 3 > L, M4 M O O Rl R Tt Xt    Ì Ĉ Ġ   p  8 D   h  (    ( +, ,@ 0 1 7 @4:$Revision: 92453-07 linker linker crt0.o B.11.06 981204 $/usr/lib/dld.slERROR: mmap failed for dldERROR: mmap failed for TSDbug-binutils@gnu.orgCONTENTS, ALLOC, CONSTRUCTOR, CONSTRUCTOR TEXT, CONSTRUCTOR DATA, CONSTRUCTOR BSS, LOAD, RELOC, READONLY, CODE, DATA, ROM, DEBUGGING, NEVER_LOAD, EXCLUDE, SORT_ENTRIES, BLOCK, CLINK, SMALL_DATA, SHARED, , ???.stab.stabstr.stab.excl.stab.exclstr.stab.index.stab.indexstr$GDB_SYMBOLS$$GDB_STRINGS$HAS_RELOC, EXEC_P, HAS_LINENO, HAS_DEBUG, HAS_SYMS, HAS_LOCALS, DYNAMIC, WP_TEXT, D_PAGED, BFD_IS_RELAXABLE, ??? 2.11.2a.out@4B@4J@1j@4R@1j@42@4 @4@4"@4Z@4b@4jL0L@xLPpL`mLpaLgLCLdLDLMLzLRMTMMfM(@0(M@sMPhMXHM`iMhlMx@7M@7MrMjMhM@7MSMGMMNtNbNVN winfo->stack != NULLprdbg.cinfo->stack != NULLprdbg.cinfo->stack != NULLprdbg.cinfo->stack != NULLprdbg.cinfo->indent == 0prdbg.cinfo->indent == 0prdbg.cuinfo->stack != NULLprdbg.cinfo->stack != NULLprdbg.cinfo->stack != NULLprdbg.cinfo->stack != NULLprdbg.cstruct union info->stack != NULLprdbg.cinfo->stack->visibility != DEBUG_VISIBILITY_IGNOREprdbg.ct[len - 1] == ' 'prdbg.cinfo->stack != NULLprdbg.cinfo->indent >= 2prdbg.cs[0] == ' ' && s[1] == ' ' && s[2] == '\0'prdbg.cclass union class info->stack != NULL && info->stack->next != NULLprdbg.cs != NULLprdbg.c : , info->stack != NULLprdbg.cinfo->stack != NULLprdbg.cinfo->stack->next != NULLprdbg.cinfo->stack != NULLprdbg.cinfo->stack->next != NULLprdbg.cinfo->stack->next->method != NULLprdbg.c@4r@4z@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@5@5 @5@5@5"@5*@52@5:@5B@5J@5R@5Z@5b@5j@5r@5z@5@5@5@5@5@5@5@5@5@5info->units == NULLdebug.cname->kind == DEBUG_OBJECT_TAGdebug.ctype->u.kclass->id > info->base_iddebug.ctype->u.kclass->id > info->base_iddebug.ctype->kind == DEBUG_KIND_STRUCT || type->kind == DEBUG_KIND_UNION || type->kind == DEBUG_KIND_CLASS || type->kind == DEBUG_KIND_UNION_CLASSdebug.cthiseh_throwCVlong long unsigned intlong long intlong unsigned intlong intunsigned intintshort unsigned intshort intunsigned charsigned charcharindx < BUILTIN_TYPE_COUNTieee.cindx < BUILTIN_TYPE_COUNTieee.cts != NULLieee.cinfo->pending_ranges != NULLieee.c! ieee_buffer_emptyp (&info->vars)ieee.clocalp == nt->type.localpieee.cinfo->type_stack != NULL && info->type_stack->next != NULL && ! ieee_buffer_emptyp (&info->type_stack->next->type.strdef)ieee.cinfo->type_stack != NULL && ! ieee_buffer_emptyp (&info->type_stack->type.strdef)ieee.cvclass != NULLieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULLieee.cinfo->type_stack != NULL && info->type_stack->type.name != NULL && info->type_stack->next != NULL && info->type_stack->next->type.classdef != NULL && ! ieee_buffer_emptyp (&info->type_stack->next->type.strdef)ieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULL && info->type_stack->type.classdef->method == NULLieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULL && info->type_stack->type.classdef->method != NULLieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULL && info->type_stack->type.classdef->method != NULLieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULLieee.ch != NULLieee.c! ieee_buffer_emptyp (&info->vars)ieee.c! ieee_buffer_emptyp (&info->vars)ieee.cinfo->block_depth == 1ieee.cinfo->block_depth == 1ieee.cinfo->filename != NULLieee.c@5@5@5@5@5@5@6@6 @6@6@6"@6*@62@6:@6B@6J@6R@6Z@6b@6j@6r@6z@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@7@7 @7@7@7"@7*@72@7:@7BstXXXXXX/usr/tmp/usr/tmp (@Hh p@.::.::.::.::.:: type_info node type_info function.::.::.::.::HPX`hPp`x (08@H@PX`hphx@ 080@PXP`pxp ( 08@8HPXP`hpxxh (080@HPHX`h`pxPOSIXLY_CORRECT:  (08@HPX`px (08@HPX`hpxxh (08@HPX`hpxP`P`p`px 08@Ph  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000@7J@7JYY(/tmp/tmp$.$?0XtRlĠlLO\cld`(k|GP7kdk+,V$VT$ʀD8$xS|(L,1H(,@`q4WqLM'$$h8 d`R8Woid`<}}W\ }}LO}4 >>}d}|P8hM4\@V<}G8Wo`jjcL,d(`<D4l|dɈ,`Δ\<ѼX4Xp,`DtPD|0|D  ,|@ #L###$((,/1130@:@:@:@:VVX0YZ0binutils/binutils-RUN/opt/binutils/bin/ranlib010075500000000000003000001700000732753200400201370ustar000300000000000000@!@XPP(G(< 4@!  92453-07B11.17;^ 92453-07B11.046g0@ X"LX tX!!!X 8#8#X 8X X X HxxX I88X X88(>(@`>(@<>( @P>(x@xh>(@t>(& @  >('@>((@>(P@$>(R@ Y <? 4@ $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$yl\/!  L  U<p(Ohů;A8v˚v)[8XDk'HVL "f/v'6!xy!xD!xry 4'Pנu R`aDg6LmT,שL''̃ !xT H(24/g6OXk )k\TX\T W!x )'6Y^]&hŒ'/\T+ 4gyhM5]YN?SMªAZAaxqV]ɘɘ 0U,Ҹ>>MȘM ƿ R[칽jEX9 Wmm ~?A˚v8vhů;An bRltD8rP.j>MȖM,O_   o@u@|@@@@@U@U@ U@4U@U@U8U8UxUXU@U UUUU(U U78U~UxUzU U%yU,!U,@U ^CU^@U %,28>EMU\chov} '-7=FMT]dkqx}*?IS^lv,5CO^k}8<@DHL`x|/tmp/libtool-17701/ranlib/opt/binutils/lib/opt/binutils/lib/libbfd-2.11.2.sl/usr/lib/libm.2/usr/lib/libc.2_tepv_ktepverrno__ismt__dld_loc_hex_value_SYSTEM_ID_CPU_REVISION_FPU_MODEL_end_environ$RECOVER_END$RECOVER_START$UNWIND_END$UNWIND_START$ARGV__text_startfreadutimemallocwritefopenctimerenamestrrchrsprintfstrcpystrcmpreadstrchr_startcallocchowntolower_isdigitfclosefgetsbsearchfprintfopenexitunlinkrealloc_isalphafilenochmodstrcatfwriteqsortstrncmpvfprintfstrcasecmpgetcwd__filbufgetenvlstatsetlocalefstat_isspacefflushstrlen__flsbufprintfmktempfputcisattyatoiperror_isalnumfreestatclosesbrkabortmemcpystrerrorbfd_initbfd_set_formatbfd_fdopenrbfd_seekbfd_get_errorbfd_scan_vmabfd_check_format_matchesbfd_check_formatbfd_set_archive_headbfd_openwbfd_openrbfd_errmsgbfd_set_errorbfd_closebfd_openr_next_archived_filebfd_set_default_targetbfd_readxstrerrorxexitobjalloc_create_objalloc_allocobjalloc_freemainhex_initobjalloc_free_blockfnmatchdcgettextconcat__d_trapremove_outputprint_descrprint_contentsextract_filear_directory_doerar_addlib_doerxatexit_cleanupalias_compareerrno__ismt_ktepv_tepv__iobbfd_target_vector__SB_masks7!?9" : B*= @ Z ]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]` =@ :7]@ k? k?k?@@K?@ @Ku;!Ks;) k?#`87{7 kc.kx.A'y 4yEe'y7D7%767+4>#%P744445 bנZRke.1ke.9 (4Ц @Ц D(43 H?(ਃ 43 ` 7+4>7D7%7744z#-p74444@H@7D7%7#/07444Kx.A7D7%77Kv 24}74444##@7@@@@ 7K?@ @@@@k?7k?#Ek? 7Yk?4@4 @@K?K?7@4K? *@K? K? 7@@4K? rKa?H:@7?!#74@4@x7?!7?!7@4#%794@4Ka?@ xH:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 86p0.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?ok)4`@44` G>- ""46`_4K>9K>Qki *K>y4ߟ444K>IKa_k? k?54@844? 7 E4Y7z/_4h4k?4K>a5k?4@44?"H74@4Kk>7t.k>Kk>v k>Ks.1k>7g.!k>y 4 c?K?7}.9k>Ka?43k? Ka?44k?֠ k?Ka?45k?7vk?1+4<! k?!k?)#74_47=)"64_4 G=-"67z/_4+"e6y7z/_U4 %497z/_%4 k?)Kk?9k?A k?Ik?Q@k?QKqK>Akf k?q( k?4?k?(0k?47xk?k>  k>7uxk?y7>7>444? 7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4!4! <4?@@k?7k?#Ek? 7Yk?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?!#74_-4@x7?!7?!7_4#%794_4Ka?_H:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 860.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?7Kv+ H4?444757K?Y@7?K?Yk?4?k?474_4$4?7 k|_M@eK?Y#7 7z0_U4-K?YKu<Ks<  k?Ku=QKs=Y k?k?7Ka?_}4:_7@k|9K?Y@7?Ku:Ks: k?Ku;Ks; k?k?ok> k>k>k>!k>)k>1k>9k>A67Dk>Q 7HȀ` 2K>Q4z7HcȈ`?@K=K>AK>9K>1K>)K>!K>K>K> @O>K=4&Ka?4'!H4 4 Iy *IzKV7>5z7Ix @H@4Iy_7 JK9y 5JKw9qW "K>Q5z74 Ikȉ`? @ :45PB44 H4@_-7~4K=k?ok?k?k?Ka?@ 4$ @04$@K97C% 44Bd4 Kx4&7_U444@B4 Kx7_444B4 7_444B4 7_444Bl4 7_m444pB44 7_5444B4 7_444 PB4 7_444 B4 7_444 PBT4 7_U444 B4 7_444 B4 7_444 pB4 7_444 Bt4 7_u444 `B<4 7_=444 B4 7_444 0B4 7_444 B4 7_444@B\4 7_]444pB$4 7_%444B4 7_444`B4 7_444B|4 7_}444BD4 7_E444`B 4 7_ 4PKz44B4 Kx4&7_4KzKa?A49@` :44BT4 7x0Q7_M4z04B@K?YK?K?K?@O?Ku:Ks: k?Ku=Ks=  k?Ku=Ks= k?k?ok?Kx9a7C 7$4^_%4zKy9i 7 0_4zHF4h@Bp7k?H4y7_G4HF}4K? @4|K?YK?@O?@@K?@ @Ku;qKs;y k?Ku;Ks; k?k?7K9 h@K9 K _M@Kz9 @_%@_EKz9K?Y@7?@@K?@ @KuKs>  k?Ku=aKs=i k?KuK?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?`%6X?94? @A4_%4A@BPKz04H_ E59"4?B4H_ 59?4?Kn9)RUk`9)Z=k`9k`9B HC\4Z!_ }4!@H_ U4!Ko9>@AD4_4A$@BKz04А` b'R _5\mk|9q44B4 A7557_4k`9_4 6?_ 4>Wk`94=kq9_4_m4A@BKz0E4_-4A@BXKz0]4Kn99@`(4H_ 4 @_ %4H_ 4 P@H_ 4 (@H4_4 A4H_ ]4 4 4 4%x@  8 @@@@H_4 8@_U@B4eH_ 4EH4)4*4+""e4,686n444?6_?g4? 440B4 A 76X?9bko9Qlko9QhxAn`ko9QdPko9QfHA4 0Ako9Iko99Ako9)kq9)ko91ko9Akp9ko9ko9xkohko9yXko9iHko9a44BH4 7A 6Y_ 54Aӿ=55@A4u+`_4+`_-@4`5@@@HHB H4`5+44B 4 A 7e+d5m@44B4 A 7-+Hkh9!%+44PBp4 A l7u 4  @Ky04_]4u4Ky04_-4E4Ky04_44@x44@P44 Kr9)`*x04@844uk`9Ku>Ks> k?Ku=Ks= k?Ku>Ks> k?Ku>qKs>y k?Ku>Ks> k?Ku>Ks> k?Ku>Ks> k?Ku>aKs>i k?Ku>AKs>I k?Ku=Ks= k?Ku>Ks> k?Ku=qKs=y k?k?ok>k>7C7%_47>_4z!(4Ka?H?"h@Kw9Q"r j4_m4 H74_u4 @HKD_u44z_4 @74_4 @_4 A4zkc94z_}4 74zAL@7?4_%4 `@AD4z_%@ @AK?_%K?B`44_-44Ȁ 07 7%_4?7_u >4zx4A4z}+KxKa?#%4:@_79`_4zA44K>YK>K>@O>@@K?@ @Ku=!Ks=) k?Ku>1Ks>9 k?Ku?Ks?  k?Ku<1Ks<9 k?k?ok> k>k>k>!k>)7CԢB4k>AHu7>4zJ57!p4Kt9A :#47Bp4 Hy_U744_e4zK>و@Ka?4'h4K>A45_54w 7K>A4 7_-4  __%K>AK=K>)K>!K>K>K> @O>"e46ypB4 HyA7E+k>1"46B4 Hxk>I7K>1KAk>1K>1@@K?@ @Ku:Ks: k?Ku<Ks< k?k?ok> k>k>k>!k>)k>1k>97CB`Bk>AHv4z7>J7"4K>bKt9A #EHy_7Z`44_4z!4Hsks9#Hz_]7p"7kf9 _4k`9G>k`9_5HzKa99 @HzA07>_K>AK=K>9K>1K>)K>!K>K>K> @O>%@4'! K>A h"458_4w!h7 @@Hyky95p_Hz!x7kf9K>A5X4_M4 $ _' "46pBx4 HyAh7%K>#47B(4 HyA7+_HzA4M+45A4 Hk>I7AKE@_uHzAT4ekf9Ku:Ks: k?Ku>Ks> k?k?ok? k?k?7CH}k?!_KZAl7k?)Hy_%7AK?)k|9Hx7K4%_ 7!7kf94_ 4Ky9)7p4hKz9i@ @K?!_4 @_=4 k`94z_k`9K?)4A4 @K>K?K?K? @O?A8K?)kf9Hp_hpAK?) @AK?) k`9Ad4=K>k?ok?k?Ke97C h7ȹb HxK_4 zHwJȋ?6p4|Kd9!?H BHzKYȋ ?7C 4| H}74|K?YK?K?@O?k?ok? k?k?k?!k?)k?1k?9k?Ak?I7DK:7#@ 44k?Q4%4&4(!%4 ?59_1@ hkj9)4cHz@?59!k`9K>K?IK?AK?9K?1K?)K?!K?K?K? @O?HK?Q 4 Hz_4IwJ_17 "Kx9y 5Kz9qL IyK?ȋ?}7+Kv9A>4c@459A4 Hy_7m4cKs9A 4Hy_]5:ItJ u_M4-K>k?ok? k?k?k?!k?)K57#7D 4k?14% Hȃ@ hK?1HzH_!4I_ A7 @HK7Ȋ?7'44A 4 HyHA74cHs`?%@_4K>K?)K?!K?K?K? @O?I 44_K?1KiK}9A??4cHy_ 44ck?ok= k=k=k=!k=)k=1k=9k=Ak=Ik=Q7#7D7 !4 H!4k=a4&4'Ka?4(!% HȂ` K=aHzIL_4I7_q45_ 7 @I "RIȋ?u5K=a4_4HzK7_4" |Kt9A Hy_ 5:@IbhJ4 h H|>@`"rk`9K5 7!H@K>9K? _@IK=a_u4HzK7_4! IjIAH+ KKl9A Hy_ =5:0b]@Kz91@??IHz_-7=>II>@A Hz459pA4 IA 7}K>9A HzIA Hz-Kt9A_E4}K!Ks>) k?k?o4k?!_u4`7K?!4_u7 77?4_4z Hw؂!2HxK4z7_4z!@@K>@O?k?_4K?k?A8K?!K?AK?! 7?A0K?!_@ @A K?_K?A T4Hw#47PA$4 K?!A 7HxA8K?!K>@ @K?@ @k?7Kx9AKa?7YA H4: K?Y@7?@7?P6?7=7St797Z6?7_6s`j 777X67@Ku:qKs:y k?k?o 7hd5 he5hf5hg5!hh5)hi51hj59hk5Ahl5Ihm5Qhn5Yho5ahp5ihq5qhr5y4o9k`84?k}04$4j5ho5#E 7G0# 7 phy5" # # 7 Phb5" 6 hr5" 6 hl5" 6hm5"e 6n hn5# 7 ha5#A7P hp54445K?670՟ 4 Hj)5k?Ew5? R_?@7p h  U?@ ? _C ?]@"4j(2Kz04?Kx(@ ky05  4?7 E ]5k q@7?Ht5 KRX7Hk55YBX6Hz5 E@@He5 JK?K?Z~@4`  ^k?k?7 X_7 K?K?S~`4`  ~k?k? 5yh}5_=7H}5 O Y E R7+?6U? 06o? TҒ H@K0 @@k|0K0`k`0Hr5Q V!R%B Kv0%4?kb0Ɯ RHr5 7 Uҿ|@>@H5 \ӑ! P Ha56B?@4? " @@Hs5@@Hs5@@ˀ4~" @6`8Hs5@ IHs5@ IHs5@ $@Hs5@ $IHs5@TIHs5@@xHs5@ @XHs5I@|40Hs5I@T4Hs5I?@IHs5I?I?@IHs5IHs5xI?pHs5_e4I?I܀0(Hs5Ku9A04k9AHs5r A4 4O Hw516?? t K BEyX7 p h*  St  8 \ӑHx5 Am1Kv8hv56hb5"e 6zpkb8@@g׀44~Hb4Hr5yHq5qHp5iHo5aHn5YHm5QHl5IHk5AHj59Hi51Hh5)Hg5!Hf5He5Hd5 @O5k?7" 46AL4 K 7_!7K?Y4@7?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?yKm94# k`9Kk9Ka?4)Kn9Kl9ّ`0ki9Kj9Ka?4( 40kq9@0kh9 @Kz9@8"k|9@@K94$4%4& E04Gk? &#0" "06Cu #07 Pk?#E07Tk?#&4'7 67+ 4 b 4 Kb@Ct Q7?4K9KH *K kzKw9Ka9h-HK|9KKvKa9 @@P7&ҁ%R@k`%Kv9Kx@6?R_7kx97T4?  @Kp@ @kq97@p7k?Kp@$8K9 Z7kp@_Kq@Ks@ U k}HB3@ҿcs  kq9Cy 9KrKqU Z44 4444444p4`4 P4$@4 04 4"4 4K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?e4U4E454%4444 4$4 44"Kv 60k| 4Pu4Re4XAKz@k|(=4K9K9K9Ko 5kp 4KyHKz@Kw9_4PK9ˀK>7\xkq9Kw"@@ PKz9K9Kr@ @ k9K9Kp@77B3 X kqK? kr 7  ZX  4 UҶV j R \K?Ӓ H  B H7X  9 Z]? R \K? B TҒ  W4>61 ZKa9H=Kt kb9@ @Kq9Kp@ Z#@7 K9Cu Kr97%7KuK?!K?K?K? @O?_Kz9% Ks9Jt   <4@h@Kt9J6? dxK|9K47k@<$b?gKs9ُ$H@Ka9H"D  4PkeKw9 D 4_4 k|Kt9FUD K9Kvk Ks$*$@Ks94̤jxH4?`H(K}9H P }H WBhH6@ 6|  4`"jHKe9 k}9H7F?_7H(H0 h>?H4]4TKb9HZ7_? _\4'Ku9J6jB#7 6@ 747?`ҐP4?67@677Z?_7`j 6767Ke9HHD=/Hk`h   hʼ]H#@P7 uH_Kz9;@;@K|9G_۽@#F@7Z `+` &@4: `K9@Kz94@4KgK}9 ktK4 KuKw9J6 Kb9HYuky@k?ok?K@Kw9уK|9#F7X#%0 e0 E0"06"079 44}4S P64bC @ @4 DC< B k k|Dd B BB\ h@ DМ Hc < D HCЄd B BB?@d  C7>|K?YK?@O?#7: VKw9ђ kw kz %047  \ә" 67< A= 4"0"e066s P4b Y: H  A Hҿ9  V?@"06  _1`4@k?7K9ً k?Kz9@"k|9Kz9@K?@@K?Y@7?K9K kxKkw@kw9Kky9B@cz k?ok?7$k?@4P x7 d@4 x |4hw(K?@x4z4|K?YK?@O?#@7 m d#@7 m4k?ok?7C@7$ d4 0h@4h0K?YK?@O?^4^17P4h0k?7@ jk@ K_4KXKWWk]8k@HKy9ًY _U@K?Y@7?Ku;Ks; k?k?7Ka?7X#4:@^7@_4K?Y@7?k?7_@K?Y@7?Ku;Ks; k?k?7_@K?Y@7?@4k?ok? k?k?k?!k?)k?177D k?AHȃ@ 8@KCK?A47`?4zK>K?1K?)K?!K?K?K? @O?Ka?4% 4HȀ x4I B^iHz *K?A559745 Iȉ?@ :44PA4 Hx4@^7Hc`?4K>@ @K?@ @k?77YKz`@4Kx9AK?Y@7?k?ok?7k?^E4 k?#&79^4zk|`!4$Ka?47 kw`#74A4 Ka?4x4:@^q7Ky0K?4_eK?^K?K?YKa?4? K?K?k`4$_Ky0^}K?`K?YKy0K?_K?^=K?` Kz`` ^}@K?YK?@O?KuK?K? @O?44@D4 KxKa?K?!4:@^)7_e@uK>44@@4 KxKa?4:@7^4w_@K>44@d4 KxKa?4:@7^I4w_@K>@ @K?@ @ KWȓ k7KXKkXKyX@k:k?7KX Pk?^4 7Ky0_eK?K?Y@7?"46@4 KxKa?4:@^7_@K?Yk?o7CKzX@ z` Z4^ Hz KXKkKxXkHc`?4K?Y@O?#47 @4 KxKa?4:@^7_@K?Y#&479`@l4 KxKa?Hw4:@^Q7_@HcKX k@k?ok?k?k?KxX 7C` @KX4KЀ h7H^QHy0Hȓ0 HȈ?HKX Hc`?g4K?YK?K?K?@O?#&479 @4 KxKa?4:@^ 7_@mK?Y"46@44 KxKa?Hw4:@^ 7_U@KXKu:Ks: k?k?7KX j@Kk?^ %KzXKyP_uK?k`X^ K?K?Y@7?#47 @4 KxKa?4:@^ 7_%@K?Yk?ok? k?k?k?!k?)k?1KxX!7C`!@Ka?4$4% 4KwXJЀ 6I:^ Hy P@Hz^4! I?4kI)5(I)ȉ ?wI: @Hz^4744@4 4@k?AKx7^ Hw!: Hc`>4K>K?1K?)K?!K?K?K? @O?#&479 @T4 KxKa?4:@^ A7_}@UK>44`@4 KxHw4@^7_@-I)44`@4 KxHw7^qK?A_@mHck?oKsX` @Ka?47 kw`4k9A#&479@4 KxXK^ 7KtXJЀ` *4_4zHcȈ`?4K?Y@O?#47 @4 KxKa?4:@^ 7_E@K?Yk?7KX "^KKX^KK?Y@7?k?ok? k?k?k?!k?)KwX!x7C`!(@Ka?4$4% 4KXKЀ ZI^Hy @^ 54Iȁ ?I `@Hz^444@,4 KxHw4@^7Hc`?4K>K?)K?!K?K?K? @O?#74@4 KxKa?4:@^q7_@]K>Ku;Ks;  k?Ku:Ks: k?Ku=Ks= k?k?o7?(a4>hdhehfhg 7%^4a744^4`7+4'?44_@X744_4 44_M_7Ka?H'_}4_m4`ˀHb?ϟHb?Ka?H%_%4Ka?ϟHh%Ka?H&_4_4Ka?h&4?Hb?Hg HfHeHd4~@O?Ka?ϟh'Ku:aKs:i k?Ku=Ks= k?k?7K70k?K8@7?k?_]k? @K>@7?#&479@@ L4 k?Ka?H:_7K?K?@x7uK>Kuk>7k>7:k>_U7>ɋ 7G>> J G>݆b @K>_5K>!7 @K>_7>^ K>4K>YK>K>@O>K>_mK> 7?4G>K>^K?qK?y_-K>_W4G>K>^ҹ%4"46p@4 k>Ka?_UH:K>K>@7^ K>4#47@4 Ka?H:7_7K>4@(7Ku>Ks> k?k?o^7C_7Ka?7 @4:@k?#Kx7]4w(K>#&Kx]79K>@O?k?7_@@|4K?Y@7?KuKs> k?k?7#7_k? @K?Y@7?"460@|4 k?^7K?k?_7K?K?_-7eK?YKu=AKs=I k?k?ok?7C 44@4 KxKa?4:@k?]7Hw 8@ `K?]M4 h?4cK?_4K?YK?@O?k?ok? k?7D f Hk?!44y@4 K?!]7HKa?44y@<4 K?!7]54Ka?H?K4 P4% K84y4]K?!H ?@K?!]4y0K>K?K? @O?Ku:Ks: k?k?o7#!k>HsJv7>14zI7 K>qk?q_U7?q#&77(79@_17?!G>A@(7?c?K>7?!#Fk?K>Y7Y`7?k?K>k?]K>"HxK>]6K=@O>KuK?QK?IK?AK?9K?1K?)K?!K?K?K? @O? W 84Z@ƚ2C? =03ƺ2C8 4 05 @@ @K?@ @k?ok?k?7?1k?1k?)k?!!0k?944@P@ K?9 7B *7?6`Hw bB *7`?64c?`Hw?@K?YK?K?@O?]4eԠH>7]u4?ԠH@? u4@ @K?@ @k?ok? k?k?k?!k?)CB77$#7W7x3444Z44^4\` _#Z J4~V#4T%jc@ V#"ςpK>@%`߿ ($% @?%B60B4 6046B64A`_ (@B6` @%4%Bc6 `$] jB ZB`_ (6B6 $` B6cĂ B6 ( r4~4^4T @!# @#B6 ( E84!4ˀK>قb :@$B@6 86b?@ ZςK>@ @Bc6 c@ "B4@<]6@#Zǃ 4^#R4K>K?)K?!K?K?K? @O?@!R`!R`߿ (7$ "`/B@??BςUK>6?k?1`_ (@B@7y3`&  @7g34 `  *4xK?1__%4 4@?@ςeK>ςUK>ςEK>ς5K>ǣoB@4\ςK>ˀK>ςK>ς}K>ςmK>ς]K>ςMK>7@*c  @7%|@b:/4AςK>ˀK>ˀK>@ @K?@ @744_77(4666x77Y7!4=74 44477wL4474 b6b:b8b<b>b@@6 @ @K?@ @k?o^]4 (744|K?Y@O?^4 | 274  w]4z`u4|@ @K?@ @k?ok?k?k?4@4744z  | f7C 04Hw7$Ԁ2^4?gHy@7HsHz d  thu7K?YK?K?K?@O?^ 4 7Hv7H}m |@ @K?@ @k?ok?7CKZ@ ]EKD?4]%4zK?YK?@O?@P@K?@ @Ku=Ks= k?k?ok? k?k?k?!k?)KE7C7$ 4H 44H?H H!2Hz 4KH r F84]@54?}@]H_@]HK_]%@507G5?/KH d04 g4 sHHz ]KE?4 dH @HH@?@ g4 vK>K?)K?!K?K?K? @O?k?oKvh0Kt0ђ0kthK|97CK4@z@2^i4 rK}9k|9K6k7  4K?Y7@O?K?Y@ @K?@ @k?ok?k?Kc9` bHx7?@2d 7 7_4?Hc`?@K?YK?K?@O?@ @K?@ @k?7Kvh k?M7^K?K?Y@7?Ku=Ks= k?k?7K: kz: _4k|:K?Y@7?k?oKs: (7C_E4Kz: \_47}.A k?Kx: Ka?k?C4:@ 7w0#&2@7w0]a79_54K>@O?k?ok?7C@04^4z 7_4z4K?YK?@O?k?7]k?7_Ek?k?K?7]K?K?YK?@7?@ @K?@ @k?o_k? 077c`K?#7`_A4zK?Y4|@O?k?7@@K?Y@7?@ @K?@ @k?7@0@K?Y@7?k?7@@K?Y@7?k?ok? k?k?k?!7D@"7%@"Kcp @4&Hy]4 bHc`?Hy" ZHy]4#j(4$4]q4 āHz^4"@7]47^4 |"74]y4(4'4]4 g]47^A4!`744]4Hz @]@ f]i47^4 | 74]Q4Kp (@K]4@@Kp 0kcpˀ0K>`u@ (4<H|ˀK>ˀK>ˀK>ˀK>KepH jK]4`H@HH (@K]Q4_@H x H|K>K?!K?K?K? @O? _ : W ]  SV@ \CT x4@ӿ< 77Z<  @?@@Kuhe>hf>hg>hh>hi>hj>hk>hl>hm>hn>Ka?H&7$7H7 %4%0Kh:Kjp %IY] 5 eIJ@?IY@%zIG@4^"!@]475s4 K?K?g~4` k?k?77h_5 @H4 D 4`5@ K?K?~  k?k?77h_-5 H?w5@$4_4!f5y@ `7IY@ H7@ 5:75:@ 77]5z7]5 5 K?K?~4`  k?k?5y7@ p7!f5y@ P77@ 855y@ 7]5:7K?K?~4`  k?k?A774 tp4 `55775)76 7,?5y] i5!5y ] I5!45@ x5X 75@4!I  @5 @x4!X@ ?5!2A7 ("5)A7 ?5)>E@  ˀ84~4 !M5h44~Hb>YHn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>˄}hmhk?ok? k?k?k?!k?)KG7C k?1@h4zHc`#Hh( H0"jHf$4HsHw d Hg$XH: G]AK?1DRĄX@H}7G? ܋ #D!HHt( Hu0 刀 6# @#*Hx7G? Ջ#D?Ht(Hh  Hh#Jz H])K?1?-HHa Hy' Hc "Hx C HwH Hh!J H]K?1>HHb H}G Hc!H C ]K?1K?1_7Hs(76yHt76y?Hb07 E 7@=Hyˀ8K>Hx Hc!H CK>K?)K?!K?K?K? @O?ˀK>_@\E@_@\@_@\ H _@\E@_@\Hˀ K>_m@\H_M@\ H _-@\@_ @\ G @4ś7 Ş'H| ˀMK>_@\% C L҇L HzH ZD:D  "@60#@7P#&@7<p#F@7\#@7"f@6|#@7"@6KuK?K?K? @O?k?ok>k>k>7#7]k>k?K>4k?7z07k>k?k?k?yk?qk?ik?ak?Y@k?Q!7@4z X7] 47]U4"`74z4]4k?Y7?7? k?7?7?!k?7?7>k?7>7>k?y4z@k?K>])7K>k?47k?QK>4k?K?k?K? k?K>k?yK?k?qK?k?iK?!k?aK>@8K>! 7Ƞ4H @@H4H H 4 `4 KX @@ J 4c ? ``4@44K>YK>K>K>@O>H @@84H jH  X4 K_ @@ K:@  ?4?4]4z4 _ : W ]  SV@ \Ku k>k>k>!7D4@KZ@" ]4"p77>_=4 K>48bb@]uK>7" K>4g44^M4!@ _ ^u4H B4% # 7 *!]48 !H7 H(4 !hHz"H!hHz H!hHzH C   !`Hz H C h !XHz(h(H!XHz0 Ch0Kg:!40kw:!^4K=^4K=K>!K>K>K> @O>]4zK=_%@\}@_@\ _@\H_@\H_@\h(_@\ C ]!4z]4 Ku;Ks; k?k?ok? k?k?k?!Kd94%7C4&4tk?qKx:9!:4K:AC 4 "7k:AC?7 8077k:AC ?7_ @X _?'k?qK:AC?=@>k?q4K>K?!K?K?K? @O?k?Ky@7?q_4>K:AKKu;Ks; k?Ku k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=64 k>4K=ak>K=i\ek>K>K=q K=yK=K=CCK=4xk>cC 4yk>ǃC 4 `_#ª\ 57J (@\5!e6 J?@R4K=Y \ 56O ]M7#7K>K>5\ 4^K>K>4t_%566? 6@ 4CC*cCZǃCq> #ǣCr@$"K>7@ P5J>M@$jK=Q`$ZK>_K>7_4z@7>p֟t&a&i8G&qFq ]4:(#7P64ǣ@ 4@ `4 @47`4 4eK=Y\ u5zM7\ U5ZU7\ 55:]7\ 4%7\ 457\ 45746K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>47@X5ycܥ@4\7@ 5Yǃq>4\7@59Eq>z?@ V47@5ǣr4V7@`4r4X77@4`47@4eK=Q\56K>_K> 4 @K> @K> (K>J I K>K>_]4 0o4oAj6 o!:4  40 ! Ǐ@K>K>_=4 7k?\6Zk?K>76Yk?5k?k?yk?qk?ik?ak?Y_k?Q - K>6X_uK>5?575?~@6 M Ku;QKs;Y k?Ku=Ks= k?Ku;Ks; k?Ku;aKs;i k?k?ok? k?k?k?!k?)k?17$7C4 4Ka?H?4'4h " <߀ : 4! \ 4"?5 4 ]!5!7!4 Ka?4'H `Ӻ! \ 0@ `_uӚ `@H `!2 < `  4?%4c 4K>K?1K?)K?!K?K?K? @O?_@H_@H!&59@H4ܞ=@_u@m@_@C8X7? (7W6 ?7@6?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK>76K>7I4K>4 K> K>y ` @ :C_ 4 4 r4V_ b4X R5)A? 8 (@ ( _8 ?5)K:: _a4K?IK?AK?9K?1K?)K?!K?K?K? @O?? crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)? crt0: errno: tsd=p=P=X=p=h=p=p= =p=p==p=p=p=p=p=p=p=p=p=p=8=@=9=p=`=p=p=H=p=p<9=p=999=9=(=0=p9<<<<<<<<<<<<<<<<<<<<<<no entry %s in archive Usage: %s [-X32_64] [-]{dmpqrstx}[abcfilNoPsSuvV] [member-name] [count] archive-file file... %s -M [ %s is not a valid archivestat returns negative size for %sx - %s w__.SYMDEFd - %s No member named `%s' m - %s no entry %s in archive %s!r - %s a - %s %s: no archive map to update  )$# %&" +2+$'()./045-!"31*!,)&&&&    $$&'"(%! # !"#$%&'(())**++, TSTTTSTTTTTTTTTTTTSTSTSSTTT T0T@TPTdTxTTTTTTTTTTparser stack overflowfooparse errorSyntax error in archive script, line %d DDRR}|{yutsrqponmkgfedcba`_^]\[ZYXVUTSQPONMLKJHGFECBA@?>=<;:9876543210/.-,+*)(#"!    !"#)+-7,*9;8:.`ano<%$%''~}|{zyxwvutsrqpmlkjihgfedcb_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=6543210/(& % }|wqzmsrktkeh+w{vrvwz|hgbaW[VRVWZ\ida^]ijfh\KFC@?KLHJ>[XVUIUOSF>;98,826)?:;CB&!"*)3+ABE    !"#$%&'()*+,-./012)('&# !$("%#######################$%############################################################## ######################################### ###[8XTXlXtX|XXXXXXXXXXXXXXXY<YDYLYTY\YdYlYtY|YYYYYYYYYYYYZW<Z fatal flex scanner internal error--no action foundfatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedflex scanner push-back overflowout of dynamic memory in yy_create_buffer()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()%s No entry %s in archive. wCan't open file %s AR >tmp-%s%s: Can't open output archive %s %s: Can't open input archive %s %s: file %s is not an archive %s: no output archive specified yet %s: no open output archive %s: can't open file %s %s: can't find module file %s Current open archive is %s %s: no open archive %s: cannot set time: %s%s: rename: %s%s: simple_copy: %s%s: %s: %s %s: %s %s: hppa2.0n-hp-hpux11.00can't set BFD default target to `%s': %s%s: Matching formats: %sSupported targets:%s: supported targets: %.12s %.4s%s %ld/%ld %6ld %s %s /%s: bad number: %s2.11.2GNU %s %s Copyright 1997, 98, 99, 2000, 2001 Free Software Foundation, Inc. This program is free software; you may redistribute it under the terms of the GNU General Public License. This program has absolutely no warranty. %s%sCannot allocate %lu bytes after allocating %lu bytes undocumented error #%d/opt/binutils/share/localemessages/.moCPOSIXLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_ALLLC_XXXLANGUAGELANG/locale.alias/opt/binutils/share/locale:.riso!(@!,!8P!<!?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000@@@ h([xpOnDuj45fF0n4!pp6x0Mb6c08DvBh7r[`Tp7PDe5sB vt0P7@(??8nP5p7h?MB8???hF??PrP? ?@tBP!6O8BCdHgt@@@@0hrbinutils/binutils-RUN/opt/binutils/bin/readelf010075500000000000003000006100000732753201100202670ustar000300000000000000@&@<|tGN(l0@&  92453-07B11.17;^w 92453-07B11.046g0@  X"YYLX \\tX!&h&hX `,`,X 8E E X HڰڰX IhhX Xhh(>(@`>(@<>( @P>()@)h>( p@9pt>(& @H@:@H >(' @<>(( @<>(P@<,@>(R@< >(( @Y l? 0@>@@ $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$$THREAD_SPECIFIC$$TBSS$yp$O/D X#,*@I4p@(O4hů;A8v˚v)8XD 'VL'6!xy!xD!xry 4X'Pנu R`aDg6mTLL''̃!xT/}(24/g6OXk[k/X\T !x )'6YY ۠'/\T+ 4gyg@ ƿV|m}[nOEbvx|9+f bh~uF~uE~uD~u:g~uP)W~wF~wE;Lf?A˚v8vhů;An bY;tltD8rP.Y;2Y;Y;'EQZm2@N\j{+++++,, ,,,,,,,,$0,"$4,*)`,2)d,2)h,:)l,B)p,J)t,R)x,Z)|,b),2),2),:),B),j),j),r),z),),readelf/usr/lib/libm.2/usr/lib/libc.2_tepv_ktepverrno__ismt__dld_locoptopt_SYSTEM_ID_CPU_REVISIONopterroptindoptarg_FPU_MODEL_end_environ$RECOVER_END$RECOVER_START$UNWIND_END$UNWIND_START$ARGV__text_startfreadputsmallocfopensprintfstrcpystrcmpreadstrchr_startfseekcalloctolower_isdigitfclosefgetsbsearchfprintfexitopenrealloc_isalphastrcatstrncpyqsortstrncmpvfprintfgmtimestrcasecmpgetcwdftellgetenvsetlocalestrtoulfstat_isspacestrlen__flsbufprintffputsfputcfscanf__assert_isalnumfreestatclosesbrkabortmemcpymemsetmain__d_trapdisplay_debug_infoprescan_debug_infodisplay_debug_abbrevdisplay_debug_linesdisplay_debug_arangesdisplay_debug_pubnamesdisplay_debug_framesdisplay_debug_not_supportedbyte_get_little_endianbyte_get_big_endianunw_decode_r1unw_decode_r2unw_decode_r3unw_decode_p1unw_decode_p2_p5unw_decode_p6unw_decode_p7_p10unw_decode_b1unw_decode_b2unw_decode_b3_x4alias_compareerrno__ismt_ktepv_tepv__iob__SB_masks7!?9" 7]!9ӽ9Y4!:ӽ9Y4T ;|ӽd Y"ӽ9"ӽ@>B! @ Z A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  a@@@ @7]]@]2@@ @] @@ @@ @ @*@ :7!?9" : B*= @ Z ]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]` =@ :7]@ k? k?k?XZ]XZ]XZ]XZ]d@"Z]> ZZ]> ZZ]9 Z8 =@Y :Z @Z@ ZZZ] ZZ @"ZY :ZZ@= ZZZ@= Z ZY :Z]ya: =]: =]  : =@4ZBu ZZZZ ZZ]ya: =]: =]  : = @4ZB ZZZM ZZY :}@4Be]yZZ5@*Z@ya AZ@ya AZ]ya A @Z@] Z]: =] y a: =4Y(ZYY8Z@] Z]: =] y a: =4Y(Z YY8Z]Y Z @*Z@YA AZ@YA AZ]YA A @ ZZmZ@@K?@ @Ku;Ks; k?#a87{ `7 +~h#+~h8'y 4yEe'y 7D7%767+4>#/744445 rנjb+~h%+~h% (4Ц @Ц D(43 H?(ਃ 43 ` 7+4>7D7%7744z#'X74444@H@7D7%7# )`7444+~H87D7%77Kvh 24]74444#-7@@@@ 7K?@ @@@@k?7k?#Nk? 7Yk?4@4 @@K?K?7@4K? *@K? K? 7@4K? rKa?H:@7?!#74@04@x7?!7?!7@4#.794@4Ka?@ H:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 860.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?ok)4`@44` G>- ""46_4K>9K>Qk<+~H<K>i *K>y4ߟ444K>IKa_k? k?54@p44? 7+~ N4Y4: _4h4k?4K>a5k?4@44?"p74@ 4K+~k>44k>KHk>v k>+~H3k>+~4'k>y 4 c?+~K?4=k>Ka?43k? Ka?44k?֠ k?Ka?45k?7vXk?1+~4< !0k?!(k?)#74_47=)"6@4_4G=-+~"64: _M4_+~"n6y4: _4 .49+~4: _4] k?)KPk?9k?A k?Ik?Q@k?QKqK>Akf  k?q( k?4?k?(0k?47k?k>  k>7uk?y7>7>444?U7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4!4! <4?@@k?7k?#N k? 7Y@k?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?!# 7P4_-4@x7?!7?!7_4#. 79`4_4Ka?_H:K>@7? 44@B7?@B?7?B?@k?ok?7?" 'E' 86 0.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?7KvH+~ H4? 44477K?Y@7?K?Yk?4?k?474_4$4?7 k|`_M@eK?Y# +~7p4:_M4%K?Y4""4W!4._!4*!4(X!ZTT!2PP L҇L HH rDRD 2 #/0@7<@#O0@7\`#0@7"o0@6|"0@6"0@6"0@6#0@7 /0@4<@#0@7`"0@6#0@7#/0@7<#O0@7\#0@7"o0@6|"0@6@@4@4?" 6 #/0@7<p#0@7"0@6#0@7 /0@4<#0@7"0@60"0@6P"0@6p"o0@6|#0@7#O0@7\#/0@7< #0@7P"0@6#0@7 /0@4<#0@7"0@6@"0@6p"0@6"o0@6|#0@7 #O0@7\`#/0@7<@4@4?" 6X #0@7"0@6"0@6"0@6 "o0@6|@#0@7`#O0@7\#/0@7<#0@7"0@6#0@7 /0@4<@#0@7`"0@6"0@6"0@6"o0@6|#0@7 #O0@7\@#/0@7<`#0@7"0@6#0@7 /0@4<#0@7"0@6 "0@6@"0@6`"o0@6|#0@7#O0@7\#/0@7<#0@7"0@6 #0@7@ /0@4<p#0@7"0@6"0@6"0@60"o0@6|`#0@7#O0@7\#/0@7<#0@7 "0@6P#0@7p /0@4<#0@7"0@6"0@60"0@6`"o0@6|#0@7#O0@7\#/0@7< @4@4?" 6 ` #0@7@"0@6`#0@7 /0@4<#0@7"0@6"0@6"0@6 "o0@6|@#0@7`#O0@7\#/0@7<#0@7"0@6#0@7 /0@4< #0@7@"0@6`"0@6"0@6"o0@6|#0@7#O0@7\ #/0@7< #0@7 @"0@6 `#0@7 /0@4< #0@7 "0@6 "0@6!"0@6!0"o0@6|!`#0@7!#O0@7\!#/0@7"0@6>1"0@6>Q"0@6>q"p0@6|>#0@7>#P0@7\>#00@7<>#0@7?"0@6?A#0@7?q 00@4!Ks>) k?k?77? 0B  xC\CTCST PS\C]CX  _CYCWי  U  \K?Y@7?k? 104495J4 K?_7_@K?YKu=Ks= k?/'0k?7,@k?, (b( $2#107:6q_UK?K?Y@7?$ ҈ h#0#0_76!"q0K?_6z61K?Y#Q0_7Z6!#0K?_76AEK?Y"0K?_m66QK?Y#0K?_=76aK?Y@ @K?@ @k?70 7? B  C\CACB֡  \CVCS  _C]CX=  ?_ P \C\ CT׼  WCU CYu  wWי  \K?Y@7?k?"0465J84 K?_M7_@K?Yk?7# 7`440 6]  ]H8_@8@@8"0K?Y@@K?YK?YK?YK?YK?YK?YxK?YhK?Y@@0@8K?Y(K?YK?YK?Y@K?Y"0"0K?YK?Y@"0"0hK?Yx"00@X"0H"08"0("0"0"0"0"0"0"0"0"0"0"0x"0h"08K?Y@8"0ˀhK?YK?Y4@7?"0466I4 _7K?Y4@7?Ku;Ks; k?Ku;AKs;I k?Ku;!Ks;) k?Ku=Ks= k?k?/,ok?k?!k?)k?1k?9k?Ak?Ik?QK67?77F7$!& 44_4$8@_4$x7444_4$0@9@E" 60/07?0N0' Y_ $7 44(4 $ Kv 45z7 & \Kv 5z4Y7 \Kv 5z4)7 \4?M5)_M4 f44_4#@_4#7444_4$"0@9@E" 6@/@07?0N0$1 1 ]_ $7 44(44 D Kv 45z7 <Kv 5z4a7 <Kv 5z 417 <45J0?M5)_M4 fK>4 EK>K?QK?IK?AK?9K?1K?)K?!K?O?@/0, 0447I4 +~49 7_4ˀMK> 0447QI4 +~48 7_4ˀK>"0467I44 +~48 7_54_4ˀ}K>!104598I4 _ 7ˀ5K> 0447I|4 +~49 7_ }4ˀK> q044y7QI4 +~48 07_ 4ˀuK>"q046y7I4 +~48 @7_ 4_54ˀK>!0458IL4 _ e7ˀK>k?ok? k?k?k?!k?)k?1k?96Kw7F7%!h744_4#@_4#H7444_4#rЄ_m ڃ#7 44(Kv 45Z%7 <Kv 5Z47 <4? _ 4h f44_M4#@_]4#X7444_U4#Єd_ ڃ#7 44( Kv 45Z7 <Kv 5Z4}7 <4?_4 fK>4DK>K?9K?1K?)K?!K?K?K? @O?"0467IT4 +~49 P7_U4ˀ]K>"0467QI4 +~48 `7_4ˀK>#104797I4 +~48 p7_4_ 4ˀK>#0478I$4 _=7ˀEK>"q046y7I4 +~49 7_4ˀK>#0477QI|4 +~48 7_}4ˀK>#0774I4 +~48 7_4_4ˀK>"0468I4 _7ˀK>Ku;Ks; k?Ku=qKs=y k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K> k>9k>1k>) k>!_ eGzk> K> K>9K>1 K>)7>)k?_7?Q ˀ@K>Y 7864z9_-6G4  #  H9*_77444y9I \4 7_6Y"7>)k?_7?I"@K> q0@ 4y8A@04y84 I 4_7K>)!4+~46 k? 4! k?4%4&Ka?# 4'7P4 V4 >!p0Ղ4 K> !K?Q P KPKx bKt D444z:4@_5K?Q J_4 G? B5y41_6: "  _m4z:H 6P?gh H(4\h(4 AK>)45K> '@_ -K?Q4ˀK>YK?IKx $ 1K<'Gw%@@h@@H@@@ @@@(@@@@@@ @(@@@@@@8@@p@@@h@@@P@@^6Z<@^I6Z<@^ 6Z K>!9@K>"4z:_!5]G4z:A_  JZ_)4 _4z:QJ_ FWK V  8K?Kt K? Ku` _14z:axK> K> B44y:I4 JY_7 K> _4z:aK> @7GK?Q J_q4z:G4 _4%K>)_}K?I4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O># 77 4?#O 7XX #0@7: 10@4<;#0@7;1"0@6;Q"0@6;q"0@6;"q0@6|;#0@7;#Q0@7\<#10@7<!"0@6>Q#0@7>q 10@4<>#0@7>"0@6?"0@6?!"0@6?A"q0@6|?a#0@7?#Q0@7\?#10@7K?!K?K?K? @O??@4 04 ! !R4!"4 4@? 4 _ j B4?K?1_E4 @K?1_4 PK?1_4 K?1_4 _K?1_4 ?K?1_4 K?1_}4 @K?1_]4 `K?1_=4 Ku;qKs;y k?k?ok? k?7Dc`@"4##7!7$7 Y$4ƃ3+4d4"j7wk?!d 04p_E6 ꀀDǤE"DEJ4Ԡ%bע%BE%fe%ւ߂%֪&&"#'"#(?&C{_&#@&b"x&""%#& 04_7z7|FGƄG:ƤGbGЄ'' 04_7zP7|4Y@_=7zHRHzŤHńHdH$I7|K>K?K? @O?4V5?@4P J4(< >'  0w(?w7|(#(7y_4=7|?'7| Q04Y _57z7|@ Q04Y _7z 1049 _7zޗ7| 1049 _7ze7|ԀԢ r 2 "06 p_E7z7|"06 0_7z7|#07 @_7z7|"06 `_7zu7|Ж~=_7|"q06y _m7z-7|#07 _=7z@"06 _ 7zǤ@"06_7zDڿ4"06_7z4#1079 _}7zuע#070_M7zUB"06@_7z5f#07P_7zւ Q04Y`_7z֪ 1049p_7z"q06y_]7z#07_-7z7|"06_7z7|#07_7z7|#1079_7z]7|#Q07Y_m7z-7|#07 _=7z7| 040_ 7z7|#07P_7z@#Q07Y`_7zƄ@#1079_}7zƤ؝@#07_M7zЄ"06_7zMЄ#07_7z87| Q04Y_7z}7|П4(8 Q04 ? :47@#07_7z 1049 _7z׭@"06`_7zׅ@"06_7zŤ]@"06_7zń5@"q06y_]7zd @#07_-7z$7| 1049_7z7|4  #Q07Y_7z4@?6g7|#070_u7z57|4_M6D@K?!_%4 @K?!_4$K?!_40՗7|K?!_4Pm7|#7_ R* @4"0@6p#0@7#10@7<# 74 X 0  XH9<_77@4@@0#10`#0"0`#0 10#0p"00"0"0"q0#0p#Q0@#10#0@6@7@6@7<@7@7\0@7<P@7@4<@6|@7@6@7 @6@"6_ " *#10@7<`#Q0@7\@4k?ok?Lh7Cl!Bh"h!dd ˆ Q04Dp׆|" 44?t@Gs~"j4#07d 7  _44 q04d 04#07"06#07#10h7$֮׆þ׆G4d Z "  b_4zȜ_M4z7 (+`_U4zȜ@4#Q07d 7Y _i4X4#10479H <4 7d 74x_ 44K?YK?@O?_54z7?4e+` 4?#/ 77` @"0@6<"q0@6|;#0@7;#Q0@7\@#10@7<`#0@7"0@6#0@7 10@4<#0@7"0@6 "0@6@"0@6 "q0@6|`#0@7#Q0@7\#10@7<#0@7"0@6#0@7 10@4<@#0@7`"0@6"0@6"0@6"q0@6|#0@7#Q0@7\ #10@7<@#0@7?A"0@6`#0@7 10@4<#0@7"0@6"0@6"0@60"q0@6|P#0@7p@4#7_ R* @4"0@6#0@7@#10@7<"6_ " *#10@7<#Q0@7\@4k?ok?_#87Cv# #7?w"w"7?yzy"Z7?y"7?z"4$xҀx" 4 xx!„||!vv!Zr:r!nn ڄjj fzf Zb:b ": q0`4dp 0H4#007"06#07#107$#Q07D#07"q06d "06"0p6"0X60#0@70 10(4$P Q04D q04d@ 04P#07#107$#Q07D`#07`"0h6#0P7 "q086dP֮ 㨀+`G4d_ b :  j_-4z7!H+`_4zȜ@_e4zȜ@47d 10֎49 _14(4 ㈀ 㨀B+`7d "q06y _44 ㈀`B+`7d #07 _a4X4#047 PH04 7d 74x_44K?YK?@O?Ku1Ks>9 k?k?ok? k?7#Ky:AYx7D4k?!_E4 7Ky:IKx:A_E4^Kz:IK?!ke:Ikw:AK:I  4?"@Cz]"@K>K?K? @O?#07)4H(4 ^A7M+Ku=1Ks=9 k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>k?Da8k?k?+~47K?k? #Q07X)pK?I4k?&74#4$4%4&4'4(4)4*4+4,4-4.4/" 6k?!# 7 k?)404K?!6X@4? @_E@k?Hk?_@(k?Ka4=k}Kv86ky8KrP6TktPKw6kvK}x7krxKz7BkbKv06ky0Ku6kxKa(4=k}(KrKz6S7YkskyKyKbx7!4]kaKy78k}xkxKr6TktKw6kvK|7`kzKbP4S@ksPKx7 k|Kt6kwKu86kx8Ksx6kxK7kuKb(4Sks(K7`kuKwp6kp4Kz;_7?yK?yB70@`@_4k?KwpK;6 k}pkqhk`hCӁK?)4!? 4?a @+`8kq(kqkqkqkqkqkq"046)HH4 Ky;^!7k?GKz:Yxk?K|07Pkz0"046)H4 7^6Y_@k?K?K?K?IK? :%7Kv!@Ks8!@Kt @KuP @Kax @Kb @K| @Kgp p@Kc0 X@Kd( @@Khh (@Ke @Kf bK?&`b#047*H 4 ^7_@K>Y_@K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>k?ok?Cdd r 2"046*0H 4 Ȝ4#07*@4H 4 Ȝ4#10479*PH H4 ȜX4#047*`H 4 7d 74x^44K?YK?@O?k?ok?Cdd r 2"046*0H `4 Ȝ4#07*4H (4 Ȝ4#10479*H 4 ȜX4#047*`H 4 7d @74x^44K?YK?@O?k?ok?C4#4ƒ#:xjx"tzt":pp!lzl!:h*h dd r 2#10479+H 4 Ȝ04#047+ H `4 Ȝ4"q046y+@H (4 Ȝ4"046+`H4 Ȝ4"046+H4 ȜP4"046+H4 Ȝ4#047+HH4 Ȝ4 10449+H4 Ȝ4 Q044Y,H4 Ȝp4 q044y, H4 Ȝ84 044,@Hh4 Ȝ4#047,pH04 Ȝ4#07,4H4 Ȝ4"046,H4 ȜX4#047*`H4 7d 74x^ ]44K?YK?@O?k?ok?k?k?C4"4#Cw4!Cx4!Cy44!Ku&: 044-@Hp4 ]744-`H@4 ]77e4? ]m4-_4]M4-44-H4 Cz_74]744.Hx4 Cz_74]7 044.aH 4 Cy" `7+~p48"046,H4 ]7ˀ`K?Y+~ 48Г 048]@44.HP4 Cz_74]744/!H4 Cy]M744/H4 Gz^74]744/Hx4 Gz^e74]7440AH(4 Ky]u7440H4 ]E7Kz]}4440H4 ]7Kz]54441AH`4 ]7Kz]4441H4 ]m7441H4 KzGy_)7Ky4] 7442QH4 Gy]7442HP4 Gy]74431H4 Gy]e7443G4 Gy ]-7444G4 Gy]7444aGt4 Gy]74K?YK?K?K?@O?k?ok? k?k?k?!7E7$Ky4^4# "q046y7G4 +~Kx49]74K>K?!K?K?K? @O?G|Gf7?Q&&8G&F^! k?q#0477QG4 Gd7?Q+~Gt48 7&&8G&F]UˀK>GGy7?Q744''8G'F]- #104797G|4 Gb7?Q+~Gs48@7&&8G&F]5]K?qˀK>GxK?q!44'4 Kv 447 Kv 447 Kv 447 Kv 44a7 Kv 4 417 Kv 4(47 Kv 4047 Kv 4847 G44@]4@]K?qςK>k?ok? k?k?k?!7E7$Ky4]4# "q046y7Gd4 +~Kx49`]e74K>K?!K?K?K? @O?G|Gf7?Q&&8G&F] k?q#0477QGl4 Gd7?Q+~Gt487&&8G&F]%ˀK>GGy7?Q744''8G'F] #104797GL4 Gb7?Q+~Gs487&&8G&F]]}K?qˀK>GxK?q!44'4 Kv 447 Kv 447 Kv 44e7 Kv 4 457 Kv 4047 Kv 4@47 Kv 4P47 Kv 4`4u7 G44p]4@]K?qςK>Ku=Ks= k?Ku=Ks= k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?yGx4#K7F#4% 2 r044y4G|4 ] 74K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?4]4)rc` 7r 594_6XKb 2459GT4 7] 6YK})@@I 7?ii I(7i(4(JIsks Iy(mkyIz] =4 I 7?`(i I(6i(5 ^4@Iz] 4 I 7V?`(i I(6i(5 ^Y4@Iz ] M4 ] 58Iz(] %4 I 75?ehi I(6i(Xn!@Ku! 0445!G4 Gz^74] 7445QG4 ] 7Kz] 4445qGL4 Gy] 7Kz] 4#0] e7-Gt]=T H7 R044Y5G4 ]7ˀ=K>Kz 4'4_E44_U4 @]4ˀK>Ky!!0456G 4 Gq7"@+~49@49]@Kw 84561G d4 ]7`456G ,4 ]}7457aG 4 ]M74k` G|4)k`4?kr:Q4*#4Ka?4,!04@Ks"R^UIz57]7Kr@:@Iy]u58581Iy]U6ZIy ]=6Z58QIy(]6ZIy0]6ZIw 4@ 4@@ 4@58q56]u67Iy8]]58I5 ]}4@Iz0]m4 I 4@` 4@@ 4@5856]67Iz8]4IK}7IyKw 7K}K:Q7K}IzI}@נ Ekt:Q458G \4 ]u7}Is459!G 4 ]57K}5 ]4Gz5HM5k@Ks:QKa`7k`:Q"@Kv"4% 0449GT4 ]744:1G$4 ]u7K}` (4'+~4:49_E4G!4+~4)@4*04+Ka?4,4 Kn4:a ]5Gu`4GI  IBII :4:rI0 W   4@@Kb_9Ka` _6y]4:G6_5`I 6?`i I(4"i( -Gn5Ȟw]4ςuK>I@I :4:(@I( W   646>I*@5 ]4Gnk?ok? k?k?k?!k?)k?1Ky7E4]4# #104797G4 +~Kx49`]74K>K?1K?)K?!K?K?K? @O?Gd Gf7?a  $$8G$F]  7#0477QG|4 Gb 7?a+~Gt487&&8G&F]1ˀK>G Gy7?a444''8G'F]  !104597G\4 Gv 7?av+~Gww487&i&q8G&yF]y]4ˀK>Gw X]X Hk|#0475Gt4 ]7ˀ K>Gh"(44&7 4  Kv 45: U7 Kv 5:4 %7 Kv 5:4 7 Kv 5:4 7 Kv 5: 4 7h Kv 5:(4 e7 Kv 5:04 57 Kv 5:84 7 Kv 5:@47h(Kv 5:H47 G|45P4`]4ςK>k?ok? k?k?k?!k?)Ky7E4]4# "0467G`4 +~Kx49]a74K>K?)K?!K?K?K? @O?Gw Gx7?Q87')'!8G'1F]1 7"q046y7QG`4 Gb 7?Q+~Gt487&&8G&F]ˀK>G Gy7?Q444''8G'F] #0477G@4 Gv 7?Qv+~Gww487&i&q8G&yF]y]q4ˀK>Gt U]U Hk|#0475GX4 ]q7ˀK>Gz" 44&7   Kv 45=7 Kv 54 7 Kv 547 Kv 5 47 Kv 5@4}7 Kv 5p4M7 Kv 5P47 Kv 5X47 Kv 5047h Kv 5`47h(G44`]4ςK>k?ok? k?k?k?!k?)k?177F7#]4 #104797GH4 +~49 7]I4x44K>K?1K?)K?!K?K?K? @O?Ԥ]4 `7#077Q4Gx4 +~4807]y4Ƞ544z44]4 j"0467G4 +~48@7] 4]a4zȠ4]4 X7#0475GX4 ] q7]4zȠ4!X44'4 Kv 45:17 Kv 5:47 Kv 5:47 Kv 5:47 LKv 5:4q7 Kv 5:4A7  4>5 ]a4z4k?ok? k?k?k?!k?)k?1k?977F7#]Q4 #104797G4 +~49P7] 4x44K>K?9K?1K?)K?!K?K?K? @O? W ]4 `7#077Q4G 4 +~48`7] !4Ƞ%44z44]A4 j#0477G4 +~48p7] 4] 4zȠ4]D X7#0475G4 ] 7]4zȠ 4!`44'44 # Kv 45Z7 Kv 5Z47 Kv 5Z 4y7  Kv 5Z 4I7 LKv 5Z47 Kv 5Z 47 45)0>5 ]4z}4k?ok? k?k?k?!7Cc` @"84$4 04s c!` !24!4? 4@_ 4 r J "!7z ^ 4:j7z ^ 4:J7z ^ a4:*7z ^ A4: 7z ^ !4:7z ^ 4:7z ^ 4:7z ^ 4;7z ^ 4;jx "7z ^ q4;!8`<c4;A<4;1^ )7z `=s7| K>K?!K?K?K? @O?KuHKs` H%*Kb@@$H )H(k}pKz7$H@_K? k|@H@K?] Q4%@] aH k|x%7H K?] Y4(z!0457G 4 +~H 48P]7] !Kzxˀk`x_ eK?!GgKb KՋ H H@K?] 4!@] !H k|`!7H K?] 4!H kik`@4(Guk`x4%Kfk`Ѐg4+~4<k?4!k?4)4*4+4,4-4.4/40"20!K? 2#047;QG4 ]7ςK>ˀK>#104797G(4 +~H@49\-7ˀ@K>#077Q4G4 +~H 48\7ˀK>"0467Gh4 +~H 48\m7] Kz`ˀhk``HKt@%K?469K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?"Q046Y7QG4 +~H 480\7ˀK>Kvh `@Kb JKw :Ky *K}Ȉ Kt K|!69<4_6Z!h@K}h!(6RKa 69=]Y6Z K 69=])6Z Kx "69=!]6Z @KzȀ 69=1]6Z ZKs 69=Q]6Z *Kv 69=a]a6Z 4^ U4pGaKuh @K| z69=q4"_6Z R4^ 4Ga4ym4`Kqx rςeK>Ku?Ga69=]Y6Z?Ga4^ E4eGa 044=G4 Gf@7+~49p+~49\@Km 844=G4 \U7`Gv4>G4 \744?1G4 \7GvKgax44(Ka?4)+~4 @!q04,4-!͂B6?`c i3 I?(7i9(H\}4 H@\4`\4H \=4 \5z:QH(\4 _H40\7H0H84\uHHGz4F^4`44F4 \%744F4 \744Ft4 \744FD4 \7ςuK>HKx +` Kw`  4N^H4?74\5K}=oI4 H\4 H@H 4\H(_ H40\}7H0H84@\UHHGz59 ]q4@Hk?ok>k>k>k>k>k>k>k>k>k>k>k>Kv"k?K|$@K44"P4ȟKcK?_-57 !"I0Kw S֓ I@K?\4%@\I %7I K?4\5& k?H04k?K?5y5Xk?] 5\]5\M54 Gj4cj4` 2"046 FD4 \74K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>ςK>YKX @Kc`ȟX4Kw؀ @@K64" Kc004? k?#074F4 74\%4xKe:QKw@Kopk?Kkxk?4x] IK?=4"046F<4 \74Gm4$Kf4 4=u4%+~4.k>4?k>4'4(!20H HKu K>@ \5:459F4 H(5Z77\5yH0Kx AAX I I(KzI@@: 7K?_5ɼ@"q046y7F4 +~I@49\ 7ˀEK>Y#0477QF<4 +~I 48\ =7ˀK>Y#104797F4 +~I 480\ 7\U5ˀuK>Yk?KS8k?KW0` 4G?K?sBҕ bJ R F< :J(@ 6 6b?u6  p@KKAH7@+~47PKY@ 7 K?K?@K?K?K?@]Ku=Ks= k?Ku=Ks= k?k?ok>k>k>k>k>k>k>k>k>KG IKfKE ː 4e7C+~4*k>4&Ka?4'4(7?7?q!r0k?H4z4 k?_H5z_]5K? 8@_55K?q @\ m5z5z_5H\ 45_4ZH\ ]4H(Ht( \ 5zH(Hu 4HxKv 7`*4?K< 4?47k8 k8 k8 k8 k8 k8( k80 k88 _u79@ 5zk?K>44\ k?\ }5z@HzHw Z \ 40Gk?K>YK>K>K>K>K>K>K>K>K>@O>k?/,/-ok>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yk>k>4&Knk>G 47%7$4'HX_Ko (7K>^E5@K>^M5%bGp `5J :HzJ"Hp J0   8 V6@@5457 Kv 547 Kv 5 4u7 H(  7  H(  _  H(   l50\55ZGuK KՋ 4*7# 7 . & 7?!!0It%RIu8 Vז s%*k?Iy@7?QK>\ Ix $"K?!K?Q  A A 7NKt#I\ZIH07]ם AҖ%245pF 4 A9\7K?!h(5\ E@Hy@Hk 4\ K>!@\ 5z!7K>45Z\ 5y" H5z }5 B7 H K j5L4-7 I Y HKz@;Kv 457 Kv 54}7 Kv 54M7 H( \ m5ˀXK=#104797F4 +~Hx@49\7ˀK=#077Q4F$4 +~487\!5yˀK="0467F4 +~48 7\5y\ =5Zˀ(K=ˀK=\@H0Au!h745pF4 A\7K?!K?Q B B 5nWKt\]@GoK N 5k`˚gIt 4K=K>K>K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)O>!/0-@/0,54_16 B45F4 7\Y6uK?!I657647>'E0@00N08G'H K?! ҈ bHE s W _ @H S IH9 " Mh6HE s X PH IHZ O h\HE s Y x g H u II( }i(Ku>AKs>I k?k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=K|P4k>4&4Gt4d&4%44P_7?9KvGt4*K 4 4'`4& 4+7( 'Kw = k?q $p7_K>hk?i'5? ) Vk>+~4+ k>!4, k>)4-!4.! k>14/!040!`k>941!p42!k>A4?!49" k>I4:"04="k>Q43"47!k>Y48!4( k> 4) 4* k>4(!4)"k>4*!Pk>a4+k>y#4,k>7!0k>4k>k>ik>qGKuh J &J45`6`04k?Q4Jk?YK>\eJ@*@\uK?Qk?I+07K?QK>\m4+b45F4 \7K`+@Hy\584Kx  K>\545F 4 Hz K>Hy@7\I7K>7?9_M4xK?A @_ 7?9K?9 @\)@K?I @\@k?9k?I4@=U4?K?i_iK>k?i Kt 9 ]} t I k?4K>\I@!@\K?k?y!P7K?K>\4! 0447F 4 +~K?48 p\!7\K?yˀk?yςK=Y r044y0F4 \7ςK=Y Q044Y7FX4 +~I@49 0\Y7ˀ@K=Y 0447QF4 +~K?48 P\7ˀK=Y 85Gu45`9@ R044Y0FX4 \75?K?i @\@K?y @\@4K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=64 5`8K> HKa? K>Kq` 5_ a4,! 8K>HK| K>!Kp` GKp4#06, K>)Ky ?Kt`  ??K>A7.\m6Y"@G|61m6`GrJKz _Ku`  _:K>15_4.?m@>J%K>9 5R@K>IHKz _K}`  _:K>Q5_94 Z @K>YHKv ߘKb`  ߘ_K>a7GaKp!4 8K>iJKx K>qKs` 5_I4$ j0:JKw K}`  ?4?7$\6Y Gv61џ6`GrQ5J 45@F4 \A7K` (@Hy\5m4 0K>yHwKy  79K>\ 54 104497F4 +~J@49"P\ 7ˀK=Y 0447QF4 +~K?Q48"p\ 7ˀK=Y 0447FP4 +~K?Q48"\ Q7\K?Iˀ%k?I`4HwK>Ku;1Ks;9 k?Ku+~4="k?)Hw45"k?!447e/ 0y@B 4 K?!@K?)\ Hw44? R04Z _@K>Kx 2Hw"0 \ 6 XK>"r0Hy\ 6z (K>Hak?q7?q_ 0Kk?"06 Kk?7?AKk?Kk?K(K 6x\64 `\ 7?AXK>#0Hy\7 (K>"0Hy\6 K>K?K?K? @O?k?ok? k?k?k?!KV 4 JKZ\Y4K>K?!K?K?K? @O?7d/KC7e/Ka?44&4?   z BH 6?``h H(7h(4@ _4 4 4?U4 >K>و Ka?H$ 4?h" @`RH5(6h<(4@@4 \4@% 49 \y4@4\i4z K>k?ok? k?k?k?!k?)Ky 7E\ q4 q044y7F 4 Kx +~49#\!74K>K?)K?!K?K?K? @O?Kz\ 4$ `7#0477QF `4 +~Ky48# \a7ˀEK>Ky4z4\ 4 j#0477F 4 +~Ky48#@\7\ I4zˀK>4kaHv 2Kx7kyx Jt?@Ku\ i k| X7 R044Y5F4 [7\ i4zˀK>Kw 44'f Kv 457 Kv 547 K4}4\ 4zςK>k?ok? k?k?k?!k?)Ky 7E\ 4 0447FX4 Kx +~49#`[]74K>K?)K?!K?K?K? @O?Kz\ !4$ `7 104497QF4 +~Ky48#[7ˀEK>Ky4z4\4 j#0477F4 +~Ky48#[ 7\4zˀK>4kbH| :Ky7:kzֹ Jt?@Kv\ k| X7 0445F4 [%7\4zˀK>Kx 44' Kv 45 7 Kv 54 7 Kw4u4\4zςK>k?ok?k?@ 7C4$ 0   j04 ` 4 ]7z `?7| K?YK?K?@O?7z ]q4 p7z ]Q4 7z ]14 _Ku=Ks=  k?Ku=aKs=i k?k?/,opk>k>k>k>k>k>k>k>k>k>k>k>k>k?k? Kp7E/4#Ko/_4/@Kn@!2KuK!4 04/ 4&4'4(7 9 kqP44 Ks:Q4\ } /Kp$@_4 \_dPkp^ 5Yk|@Kx4%5)Kkx $4$KtK$44'4(!207 y @ `kaH44 `Kw:Q4\  .h@_4  Bcj459@E<4 [U7Kl4%5k+`@UDzVǒV:rVbRV2VVWW*ƲWRƒWzrWRWʊ@7@_ 5 xKyH[4I= 7?{ i= I<(7i3([4I: 7Z?@|`i: I6(6i=(KxH  :Kx7:4H[4I4 6?xi4 I"(4Ri2( MKw:H[4I3 6s?`xi3 I!(4"i"( -_4 \7?17|p&E0@00N0'KxpKb@;4^5Yk|@44[5*@[5Zk|x+745Y[4+JKgЈ"KmKw4 4K+~"4(6;6;6=6 7+2 ( R5$P5$^!4B(Kw Kx:Q  kqX4u5KyX 0j4[M4*@[]4*7444[U4*@[4k|Ѓ+@7kzH4 4(4) Kv 45Z7 @Kv 5Z4i7 DKyH4&}4[4Kj X4%Kh  B R044YE4 Ky Kx[7Ki 2 204490E,4 [}7KsKg504#7=k?!7=k?)7h 7vk?Ka?! 54)4 .!04 7?7?"Ky I5 6?i(i5 I:(7Wi7(4@\H[4 \HKy 64&7_7+~ 547%p[6YH4 W 6  H _@@@pKxHKwKxKwKxXKKxKw`@KxKrxKyKxKx@hKwKw @KbPKx@ Ka@KxKxKxpKxKxPKxKxKx@KxpKx@@@Kw@@Kw`@Kx`K|PKx @Kx Kx[ }5H[ 4I< 7?fi6 I2(6_i?(MKw/%*[_$K?!K?!_%K?)?jK?)%KxKz 2#07 4E4 [ U7ς(K>YˀK>Y_ 40-@ˀK>Y!r045y PE|4 [7+`"046 E44 [M7Kx459E4 [ 7_#0477E4 +~49#7[5ˀK>Y"Q046Y7QET4 +~48#7[U5Yˀ`K>Y!0457E4 +~48$ 7[5Y[mKzxˀk`x4@ #104797Ed4 KxX+~49$[e7ˀpK>Y"104697QE4 +~48%7[4ˀK>Y!0457E4 +~48%@7[4[4ˀK>Y"0465E44 [M7ˀXK>Y59 [4@H*_ H5[7 Ky45E 4 [7Kx45E L4 [7Kx45 E 4 []7xKx45PE 4 [78Kx45E 4 [7Kx9=@H [5 PKy59 [4 (Ky)45E 4 [57H :45E 4 [7Ky @[54  @[54  50[e6Y_ 5 Ky'45E 4 [ 7H :45E |4 [7xKy @[5@4 R @[m5`4  50[=6Y_5 Ky&45E 4 [7H@*u@45E L4 [7HKy[}54 2@[M54 Dz@[54 Rǒ@[54 rɝ@[54 rRu@[54@22M@[]54 %@[-5 4 @[504 @[5@4 Ʋȭ@[5P42ƒȅ@[m5p4Rr]@[=54 R5@[ 5 @(@50[6Y@#j\ qH_Q7HKyH (HH4:!B !r45E4 7[6Y7y [6Z(?I4 45E\4 [7I4 45 E4 7[a6YI4 45PE4 7[6YmI4 45E4 7[6Y%I4 H[4I4 59 [40KyKx!H[4[95Ky59 []4KyKx Kwx (H W BU$@45E,4 7[q6Y Ky59 [4Ky4&e44K>YK? K?K>K>K>K>K>K>K>K>K>K>K>K>K>O>@/0,߀2K? H  Kv>KyG 2 #H_4Ky_i4Ky59 [4eKyk?oc`  @7C#047*0E4 K?Y@O? @#2079\ 7z J +`#07 \7z "060\7z ` #R07Y@\7z K?Y7| @O?k?ok:k:k:k:k:k:k:k:k:k:k:k:k:k:k:Kp0k;a38k;ik;GsKk(`k;q+~4"(`k;Y4<(Pk;Q46(0k;I45( 47&k;A4?&#k;97 ?#$k;7.7 ?k;42&41&k;40%4/%k;4.%4/%k;1k;)k;!k;k; k;K;qJK;K;4 [4 Kv 4)7>4M7Kv 77>477d 4K;a7[7?K;a7>4 [4?Kv 7>47Kv 77>4U7 M Oӈ? C @?'4?ʊ >5 $ @4"b M YK;т"JK"8@K|:Q 4K;a[Q5?5K;a7?A4([y4?Kv 4)7?a4%7Kv 77?I47 M VӇ  ?4! @Kv 7?Y47\ k;K;a[4?H5K;a44[97?q?rKv 7?q47K; _5+~!05P47*@[5 4$`"#07:ѕ$[Q4@5kh`K;K; o kKa?H9 7??~h? Ka?H1(66h6(48K;K;7ZJXk;[5Z[K;[K;K;7k;GwK;q7`k;qK;i 2 044`E4 [74K:YK:K:K:K:K:K:K:K:K:K:K:K:K:K:K:@O:Kp` K;qK;q[!J9@I@K;a[4*K;q[J +8k;K;qI 47[K;a+`@K;qK!84 -4 4)K; s Kv 45)7Kv 5Ӑ47Kv 5ӑ47Kv 5 ӎ47Kv 5ӌ4i7Kv 54A7Kv 75 47k;"046PE4 7_-6:6Z67[ 5y"R046YE4 75[ Y5 Kv 45)7Kv 7547Kbx)(7"r046yEX4 Kyx 0 [ 7  Ko` K;qK;q[ YJY@J@K;a[4,:K;q[ JZ ,k;K;qI 47[K;a,K;qJ|84 /4 4)K; | Kv 45i7Kv 5Ӑ497Kv 5ӎ4 7Kv 7547Kv 7547k;"046E4 76[ Y5yK}x+#047E4 Kax [ 7 "0IY@]K;ak;IL0Kk BՂ Iy@K;a[I4.@[YIz .k;Iy K;a4[Q7.!045E4 K;q/07`K;AKv` K;qIY@[IX0KKs:QK;a4[9 /@K; J[95Z007K;a45z[15Y0ZK;[5Z7 `5? L M4)5Kv l Z47 @5??5?k;K;[5z u@!0K;[)5@K;K;4 ]tKa?K; p M O/.K;#047PE H4 K;y^17=5kςK:YK;qJ_Kj_ K; Kl` K;q[K8"04K;q6E 4 [7Ka?#0J8K;q4: [ 7#047E 4 J80K  Q  7K;Kn@K; q04K;q4y7E p4 +~H@49%[q7ˀK:Y Q04K;q4Y7QE 4 +~H 48& [ 7ˀ]K:Y"04K;q67E 4 +~H 48&`[7[ K;ˀK:Y"046E 04 7[y6 AP4Kv 4517Kv 7547Kxx  h7"R046YEX4 Kax1 75[6X6#047@E4 756[)676 ~Kv K;qJ485JK; [ !K;U+`4k;i!r045yE(4 K;q 7@K;!K;qKKb_ K;)Kk` K;qJ8[!R0 R044YEx4 [7K;qKa?4: K 20Z4945Y E4 K;qJ0  RK  7K;1Km}@}K;9 104K;q497E`4 +~IX@49'Ze7ˀK:Y#04K;q77QE4 +~I9 48'0Z7ˀMK:Y"q04K;q6y7E4 +~I 48'`Z7[ K;ˀK:Y"046E 4 7Zm5"046E4 7Z-5 b Kv 45 7Kv 54 7Kv 5 ӏ4 7Kv 5Ӑ4 Y7Kv 754 )77K|x Z"r046yE4 K}x ] 7Z5P R0"046@E(4 75Zm6X R044YE4 7_56Z7Z 6 - ] , K;qJS85JK;j%+ [K; 5+`4k;iK;qK0Kr MK K(y k;IZ IY(QKs`1%7IY@]K;ak;!0457E`4 +~Ix@49'Ze7ˀK:Y!0457QE4 +~Iy 48'Z7ˀUK:Y q044y7D4 +~Iy 48'Z7[K;ˀK:YK;qJK| K;IKa` ZmK; R044Y0D4 Z57K;qKa?KX4: k;y!r0Z]5y!045Dl4 7K;QI_Ku@K;Y#0477D4 KzK}:Q+~ 49(Z7ˀ5K:Y!q045y7QD4 +~48(7Z5YˀK:Y"0467D$4 +~48(7Z%5YZ5zˀeK:Y"046D4 K;y^ 75k!@+`!R045YDD4 +~48)7ZE4ˀK:Y!20459D4 +~48)07Z4ˀ5K:Y!045D4 +~48)P7Z4yˀK:Y 044D$4 +~48)7Z%4yˀuK:YKv 7>4!7K; ^ 5+~"06P47)Z55 044D44 +~48)7Z54ˀK:Y 044D4 +~48)7Z4ˀ%K:Y"046Dt4 +~K;48*Zu7ˀK:Y"046D4 +~K;48* Z7ˀeK:YK;y[ i4UK;k?ok?DX7Cd 2 #20p7$#R0X7D#0@7``Z#074D4 7d 74x[44``Z#0470D|4 7d 74x[I4X4"046`D4 7d 74x[44K?YK?@O?k?ok?J7Cj fzf Zb:b  204$ R04D r04d 0x4#0`7"0H6А``@G4P ?8` #074V _8` "060` "06 #074D4 7d 74x[4(4``+`G} :v "06@x "r06d`#0470D$4 7d 74x[4X4"046`D4 7d 74x[44K?YK?@O?k?7FF BbB B@ "Z @K?Y@7?#07p"06#07#207<k?os1S 7Xփ ƒ "#H7W>?ד"6>7c @#20790[4zK?Y4|@O?#07"06#07 r04c R0m4C 20U4# k?ok? k?k?k?!k?)7E 7&Z-4 7#0475D4 Z744K>K?)K?!K?K?K? @O?44z4Z4 B#20479@D4 Z7ȀM4Z 4 X7#0754D4 Z7Z4zȀ4 `4? 4'4Kv e 4e7 4??4?Z4zE4k?/,/-/.oPk;k;k;k;k;k;k;k;k;k<k< k<k<ky4 Z -47Kv 7>47Kv 7>ӊ47Kv 77>4}77 D @>4 > ' N 2KˀK>4%]q59 24%]Q59 @Z4%@Zq40@ZQ4%Ǯ@Z14&ǎ@Z4@]4 KnH4ǝ@4K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?iKC 7F7'!( 044& D H4  7+~H49,`KvH߀@+~49,pK|` Z)@4K>K?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?44&pD 4  7+~H49,KtH@+~49,Ku` Z@H@H4Z 4 Z q044y7DH4 +~H@49,YM7ˀ]K>Z Q4z Xk?q Q044Y7QD4 7x 7Y4yˀK>74y4Z 4 b 104497D@4 7x 7YM4yZ K?qˀMK>K?q4'Ka?4(4 !Q04 @4 4 4&Z4C} # 4n!r4@" Z4&Z5Z:Q @Zi5Z:A5?@`b4  yH HZ 4& Y4&_5I 6z?@`i I(7i(  `>m ZK?qςMK>4@" Y=4&Y5Z:Q @Y5Z:A5@5 Z4 444@u@֓ \77_7Z = 24@`"?a@?ן@k` 4k` k k kz k` k` @k` k?ok? k?k?k?!k?)7'77C4_7?yK?y H #047'D4 Yu7K?y 0C44'` 7D04 7Y}52 ҅R# 44'D4 Y-7_544|Kv 44 7744'DX4 7Y4ke 44'D4 Ye744(0D4 Y5744(pD4 Ky 79ky Y7]474(  44 D@4744_7?y5Ye7K?y4 4 C4744_e7?y5Y7K?y4 4Cd4 744_7?y4Y744(C4 7YM4H4|44(C4 K?y CY74|K>K?)K?!K?K?K? @O?@ @K?@ @k?/,/-/.///0/1o k=k=k=k>k> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Y7CHt 7. k> 044(C4 )7`7y !44-PC4 Y-7B?(244-C4 7Y5]57 . A?454-C$4 Yu744(0C4 YE7B2'44.C4 Kv 6ky Y7]6:6.74(4 4 C<6746:_7?y6ZY]7K?y41 4 C6746:_]7?y6ZY7K?y4 6C\4 746:_7?y6Y}7K?y  44. C4 7Y55B.=4x4Kv` YK>Ό 04,  4&4' O04E4(4 !S0Kv 45i7Hy 7Y7Kv 54!7ӒD%@Kv 5 47Kv 7547Ӑ7>Kv 54& i7ӝk>Kv 5417Kv 7547Kv 5Ӌ47 44* ӌC<4 7Y544*pC4 7YM6Y44*C4 7Y6944+C4 6Y74+`4C\4 K>Y744+C$4 7Ym544,C4 7Y55y44,PC4 7Y5 K>_744,C\4 Y75@`444,C4 6? 6YM76 4 B?76?44-C4 Y75B?8-44-CL4 Y744.0C4 Ym76.ϧ*7>&&11nA74? 5KuH@7y 144)0C44 Y 7ˀK=Y44)C4 Y 7ˀHK=YKx:aK>_}545Y.qC4 Y 747?_ 57>Ks 4K?5Y.N 4 '9G'E p Ckr Kx 7Y 67?4_ M5Kr \ kx 7K?45Y. CD4 Kx 7Y 6:47?_ 5K?745Y/ n C4 7Y 6kp 47?_ 55K?745Y/q CD4 7Y 6@kp Kb P0445Y/C4 7Y -6kp 45Y/C4 Y 7ki 17>Ku 45Y00N` 4 09W$(G ( Ckq Kx 7Y E6@Kv 54 7Kq < kw 745Y0QCl4 Kx 7Y6`5 0Kw 7>045Y0` 4 &02 0N09W&8G8 C kt Kw 76Y6X2 K 45Y1!` 0N4 08G&!G!   C k Kx 7Y=6A"q0Y6z-K>wKv 4K=YK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> K>K=K=K=O=/01/00/0//0./0-@/0,@ @K?@ @k?ok? k?k?k?!k?)k?1k?9k?Ak?I7FH 7# 0441Q C 4 !77y QY=@P@4&4'Kv 44z7Kv 74z47Kv 4z Ӌ47Kv 74z4e74h5_7d!( Ks:i :441C 4 Y74ku:iKv "0Y6-4K>K?IK?AK?9K?1K?)K?!K?K?K? @O?KxH@7y aKt` 441C4 7Y5Y442QC\4 7Y5y442C$4 7Ym59443C4 7Y55443qC4 Y7PKv 5435Y59]57  Kv 457?7 ?Kv ok?ok?#077C44> 6z zH8_@7@@P+@+P+++++++++`++++ +++P+++`+++p+0++++@++8#0+#0#0+`+0++++p+@+++++P+ +++#0p+@+#0#0#0#0#0p+@+X#0H#07d p7d `7d P7d@7d107da 7d7d7d7d!7dA7dq7d7d7d7d17dap7d`7dP7d@7d07dA 7dq7d7d7d7dA7da7d7d7d7d17dap7d`7dP7d@7d07d1 7dQ7d7d7d7d!7da7d7d7d7d7dAp7dq`7dP7d#0473C4 7d 74xZ44K?YK?@O?k?ok?#077C44^ 6z zH8_@7@@+ +p+ ++++ + ++ ++++ + + @++0++++@+++`++++@++++P+++p+ +++0+++@+++++#00++++p+@++X#0H#0+p+#0 +#0#0++#0#0++++P+H#0+++p+@+++++P+ ++++X#0H#08#0(#0#0#0#007d 7d17dQ7dq7d7d7d7d7d17da7d7dp7d`7dP7d@7d!07dQ 7d7d7d7d7d!7dQ7d7d7d7d7d1p7dQ`7dP7d@7d07d 7dA7dq7d7d7d7d17dq7d7d7d7d!p7dA`7dqP7d@7d07d 7d7d17da7d7d7d7d 7d 17d a7d 7d p7d `7d!!P7d!a@7d!07d! 7d!7d"!7d"a7d"7d"7d#7d#Q7d#7d#7d#7d#p7d$`7d$AP7d$q#0473C4 7d 74xY44K?YK?@O?k?ok?7_?4?#077C @+7d$7d$p7d$`7d$P7d%@7d%107d%Q 7d%q7d%7d%7d%7d%7d&7d&17d&Q7d&7d&7d&p7d&`7d'P7d'1#304794!C4 7d`74xY44K?YK?@O?k?ok?k?Kc:y` RHz Hd(YKE?4Y4z?4k`:yk`:qK?YK?K?@O?k?ok?k?7E7#7Y40 jk k(K:y Kw:q0k|:y j(k|:qK?YK?K?@O?k?ok?7D7#Y4 bK:qK K 0 Ky:qk< K?YK?@O?k?ok? k?Ks:y7D` 7#z44_ 7?qK?q7 x 44_ A7?qK?q D C74_u7H4Ȁ4d844_ 444_7?qK?q $ 744_a7?qK?q7?} ?4444K>K?K? @O?@ @K?@ @k?ok? k?k?k?!k?)k?17EH 7$ k?A s044y1QC p4 !77y'aY@4%4_K?A474y4QC 4 YQ7Kf:y!44y4qC 4 H_7H x744y4C p4 pHKxH@7y'qKs` 44y4C 4 H45Y17H 44y4C 4 H_ 7H_7559Y7H?4H(>O4=4"0YY6-4K>K?1K?)K?!K?K?K? @O?k?ok?k?k?7C7$ 0445CH4 7Y4 R4&Kv 4z4Y7451YA7?4c4|K?YK?K?K?@O?k?ok? k?k?k?!k?)k?1 X 7HDP7# O04EP4& 0A 5??4? 5Y149!A K>Kv 54y745AY7@Y45au@Kv 54y745Ya7%5Kv 54)745Y75Kv 45745X7@Kv 45746Xu75@Kv 459746AX%7@Kv 45 746qX7@Kv 45 7Kv 754 i74659XM7 @Kv 45 7Kv 754 74659X7@47?^547X}7K?5@7?4^5471X-7K?@X47a@X47@X47@Kv 54 747Xu755XU47@X548@X48!@X48A@X48a@X48u@X48U@Xu485@XU48@X549@X49A@X49a47?^%549X7K?m@X49M@Xm49-@XM49 @X-4:@Kv 4574:1X7@X4:Q}@X4:q]@X}4:=@X]4:@X=4:@X4:@Kv 4574;X7@4;1X59?g4;QX59?aG7?4^54;q59?!X=7K?@47?^]54;X7K?@7?4^ 54;X7K?U@47?^5K?  77?4^54;59X 7K?@47?^-54 044=B4 XM7K>K?1K?)K?!K?K?K? @O?k?ok? k?k?k?!k?)k?17F7(7_6 04=AX}75?4?#O07X 44*RX4 K>4_4X40 "0p5?K>k?A4zKv 77K?A| 5?Kv 4z4Q7ȼ4cKv 4z47ȼ4cKv 4z47ȼp4c7?4^ 4zK?ȼ8 47?^4zK?7 c 5?4?#07 ? 4=aX4*4=qX  4=X44=X4@Kv 44z7!205:0k?I7XU7Kv 4z4)7K?IX7p*!05"X4y\4z7b47?^4zK? 74_ u7|@Kv 44zE74g74_ 7|0@Kv 44z74g74_ 7|@Kv 44z74g74_ U7|r44=B4 7X 5244=B4 7X m5X4>4? i4?#07 `  ҄ B!44>!B4 X=7`"044>AB4 X 7 "044>aBl4 X 7"044>B,4 X }7"044?B4 7X 54X"0#D7Y!J! " ڄ!jB z * B4X 4"0X }4?Q"0X ]4?q"0X =4?`"0X 4?@"0X 4? "0X 4?"0X 4"0X 4 "0X }40"0X ]4P"0X =4p`"0!2 ℨ j B X 4"0X 4"0X 4"0X u4 "0X U4@x"0X 54PX"0X 4p8"0X 4"0X 4"0X 6-4|K>K?1K?)K?!K?K?K? @O?4*4X =4e"0X 4E"0r J" ZX4 "0X4@"0X4`"0X}4"0r J" ZX=4e"0X4E"0X4%"0X4"0j B X40"0X4@"0Xe4`"0XE4m"0 rJ " zX4%"0X4"0X4"0X4 "0X}4P"0r J" ZX=4pe"0X4E"0X4%"04*4X4"0X4"0@ @K?@ @k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7#7GH k> 044@B ,4 C 4f#(7X7y'Ko:y(RI 0@I(((@I?@(44B |4 K?iI7_Q k?6:6X5X}6I Bk?J55w_=JJ?7I@ 5mj@Kz _+` _K}`  _ZK>X4 Gs6e5`%@I %I@K>X 4%@X I %P7I K>4X 6%rI  _! X 6 447?i^57K?i< =@KpH@7y'Kq` X@e@7'k>7w'k>4'4(4)4*Kv 44z}7Kv 74z4M7Kv 4z ӏ47Kv 74z4764m 44ӌ BD4 7X5y44B 4 7XQ644B4 7X544 B4 7X544PBd4 7X5 44B$4 X7Kv "q0XI6z-4K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>Ko:y @_@GyKo Z4:oIK>44 B4 X7ˀK=#0477B4 I@7y'X7ˀ}K=#104797QB,4 I 7x(1X17ˀ%K=#0774B4 I 7x(qX7XU6ˀK=44Bt4 7XI6ˀuK=@ @K?@ @k?ok? k?k?k?!k?)k?1k?9k?A7FH 7# 0  44@B4  77y(#4 0X5YKv 5:5 }7 Kv 5:75 E77@?u ]@KwH +` + Ky`  Y7y(X@@4&Kv 44zm7Kv 74z4=7Kv 4z ӊ4 7Kv 74z47Kv 4zӈ47D!Ӌ44B4 7Xa444B4 7X)5Y44 0B4 59X744 Bp4 7X544 B84 7X5y44 B4 XQ7 S4m6y 4i  mKv 44@B4 Xa7(#04 C Kv #0X7-4K>K?AK?9K?1K?)K?!K?K?K? @O?k?ok?KD7C$`78 xHzC Y |Hu CHz h| Ht@R4?Hy $ ]@Hz D `4Hw_HyK?YK?@O?k?ok>k>k>K7C7K_@ K%  "0X6 PH`4HwH X? jHb`E * 0X)4 H0Hw#07 X4HHw4_e@#0X7- 0Hy@X4 HxPHwX4 X7>4 XQ7>Ha A`44H} S! j҇ * 4 Y7>4 4 Yy7>4 Hu  4 X 7>X4 Ht  4 X7> 4 4 Y7>4 X7>Hz4E^@#10X7:-K>YK>K>K>@O>_" @4: "K 4@@4@4@P@K?@ @Ku;Ks; k?k?/,ok=k=!k=)k=1k=9k=Ak=Ik=Qk=Yk=ak=ik=qk=yk=k=KN 7Fk=7$4k='k=!r07z(X5y=k>04k=Kh 0K> 4k>44 0B4 7`7y)-RAabh5 4,ڭݵKi` XK=񀑦t@7m0k=7p)Ak=4&4'44 4k>Kv 4417K>4447%4 P Kv 5m5zK=747 '(7?044 6X i67K> X Q4 Iy(X 94 PIy0X !4 Iy8X 4 Iy`X 4  @X 4 P5X 4 "?6Ka?H4 6?h2 @jKa?H5(6h:(4Ka?H5 6?h? iKa?H4(6h9(4*:Iw(6 vC Z |IwC i| I XIzY]IIbIz  Y5I I(ix(5zI0iu0I8iv8IPi|PIXiaXI`ib`K>_6?Ahayh: @_@7Kv 55YQ7i|@ M Kv 55Y7i|HI(4 M C_ :47>^ !5K> 7 I@k?4K=I  k?IxH  6k?X 967Kz@00@X 4 P X4 ?5Ka?H9 7/?h/ iKa?H<(7h/(4Ka?H8 7?h. iXKa?H6(6h.(4KjH_@!r07z(X5y=k>04k=Kh 0K> 4k>44 0B 4 \+`Kl`!r0 XA5y=k>04k=Kh 0K> 4k>44 0B P4 7KbHⷵ@7y)!?74C 4p744p[ e7 rK=4 }C d ` |C L4i| K>6?5z_k=Ak> 54_iz(Iz(CV4 747>^5i|0K>, 47>^Y5i|8K> 5Kv 47i|`547>^5K>Ku l  Xq4 p K> L 47>^y5i|0K>, 7>4^A5i|8K> 4Kv 57i|`Ku547>^5i|0K> 7>4^5i|8K>L 4Kv 57i|`Ku5K=5l55 Ia(k?4 6I}0k?67Is8k?It`XYk?g49 X4Ka?49 XY4424_UA75Azh _@7Iy`_ e5zKt#jX5A "6"5?"b4"4^(B4\'҇'r'򂲇&Jʇ%Jʇ$#ғ0 M ZK=47K[4pK= K=K= q  <4? 06I @I?@3I4 69W56X `C4 |C4i| K>7?_ %5za`hK=44ɋ}it(49 XI4Ka?49 X!4MKt47>^5K> - 5z_]5Ia/ P48@5z_5IbO Q4?@@5zA7=. "75'h&! 8&j4%z4^x4^3z4Z 4Z2҇2R12Z/j- : ,zJ*''Ka4BW4*@@u@47>]5K> - 747>]5K>5z_5I} R4\@ 47>]%5K>75z_}7Is o _4@U - 47>]5K>75z_7It W4@ M 47>]55K>7 5z_7Iu X4e@47>]5K> M 747>]5K> 5z_5Iv Y4!@47>]5K>M 47>]5K>U@47>]5K>@47>]u5K>@47>]=5K>@47>]5K> 747>]5K> 5z_%5I| Z4B@Kp *7>7>_5zX5y05x0'7=Ip@4p9G&IDIW 0 5y0' 7=Ip@9G'QEQ iq@47>]}57=|KrK> -  H&y 5}8'7=459G&DWIx  V@5z8'@It 9G &@EKb 4W-5IIr N ] Y@I Ix  . @Kv 55Y7Ku7 ( M 7>7>_U5z4@WM5 in@Kv 5477=<Kw5 0'( 7>7>_5zX5s05}0'7=Io@49G'DWe / 5s0&`7=Io@9G'E  ix@Kv 5477=\Kx5 0'A 7>7>_5zX5u05t0&7=In@49G&DW= . 5u0&7=In@9G&qEqN  Xiw@Kv 5477=Ky5 0' 7>7>_Y5z`5|05v0&7=Ib@4 9G'D " W @5|0'7=Ib@9G&E"  (i@47>]5K>- 747>]57=KtK>  H' 5s8&`7=4p59G'DWIw P @5a8$ Is n 9G&`E47>]5KsK>7  4W55IIq . S Zz@I Iw  H47>]5KtK>7  4 W}5I V4@I} 47>]u5KuK>7  - 4`W5Ir N U4@Iz N @47>]5K> 747>]5KuK>7  4W5Ip  W4@I 0/Kb @W 4C4pIv7C Z IC i IIyYIII  YIy nH@Kn W 4 H4nHc7?_a5zIzIYaIIIz  Y9I WIWuI We5r47>] E5i|PK> 47>] 5i|XKz7K>" IyPW m4P47>] 5i|PKv7K>" m W 4b47>] 55i|X7K|K>" W 4@Ko!W m4047>] 5KaK>7! W 4pj47>] =5K>M 747>] 5K>7= m 5z5_9' Ka B5t8&7=459G$)DW )Iq . O @5b8$@Iy . 9G(' EKa?4:@W4 4@Ku 7>7>_95zK=ę4"0W%6-4KK?!K?K?K? @O?49=q4"Z4 @7d,+~44'  F W4" 4?4?(@KxHz@7d+aKy`H} Hy@K?1W 4 R#0477A l4 Hx@7y+Wu7ˀeK>W }4 Xk?9"0467QA4 7x+7W4ˀK>K?147W 4= 20"0467Ad4 7x+7Wi4W K?9ˀMK>+~47  K?9K?14zE7 :"s046yPA4 7W4W =K?9Kb:y @^@ς}K>k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?YKp$k?aGf4#Kd"84Kh:A" 4&+~4' 4( 7i,17j,A4+0ɉZHKy 8+` 8LH 8Kz`  87H !24  N W55 "5?5?Gt   @H@H 4WmK?a"@W}5"7K?a45Wu5"  K?a457W]5Gt44`Ku:A@GgKe4 +Ki:A 4&K:I4' K?a]4K:I ǡ @K?a_=4K:IGv4Ā4`K|:Ao Km:A2!045AL4 W)74K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?ςK>!0457A4 H@7y,aW7ˀ5K>!q045y7QA44 7x,7W95ˀK>!Q045Y7A4 7x,7W5W]5ˀuK>k?o!7C`@4@jǣ@ǃ@cA0@K?Y@O?Ka?#S049 Z7Zߕ4#307: 7y,07y-W@ǣM4 7y-#007y-!W70ǃ 4 7y-1"007y-AW6@c4 7y-Q#007y-aW97PK?YKa?"s049 Z 6z`]K?Yk?ok= k=k=k=!k=)k=1k=9k=Ak=Ik=Qk=Yk=ak=ik=qk=yKy4k=444 '4K:!`@K:Q!"056 79 @4? `4We49  Wu49@7K=44Wm49b44(Kv  4 7 4?Kv 4 (@>79 0+`Kx#K=4W!4& W)5&7K=44W!5&!05 W4Ka?4) 5Z U597|0Ak=7n0Ik=4+4 4,!04 Kv 45=7Kv 754 7k>YKv 547Kv 7547Kv 75 4}77[ I7>YKk?5 7>aKk?Kk?Kk?K(K 7W6k?Krx P 5k?5YW7>a @[A5P5JK=K=4?   "Z59 O6B?61 5`W5[5 5JF=]5(W4/X@KhI#@7__ 5`I?5`K=4W4#p@W I #7I K=4W4#I ӳW ڃ$7I 4 !44*4 Kv 45M7 |Kv 547 |Kv 547 |BKv 547 | ` 5)I 5k 044pA4 "7 7y-ˀpK< M =  %   !0457AH4 7y-q7W Q4ˀKKv 647k>Kv 64q7k?Kv 6 4A7k? 7Kv 6(k?4746YW 7K>K>4@W K?85Kv 467Kv 764Q7k?1Kv 64!7k?9Kv 6 47k?AKv 6(47k?I7Kv 60k?4774W a6Y5: 5W6W 15-K?1K?94@W K?A550 4Zy6H_ :4 ZI6H4> _ Z40Z 6H4@Z6H4PZ6Hų4`Z6HŝÚ4pZi6@50 4Z96H4Z6H4Z6Hǹ4Z6@50 4Z6H4Zi6H4 ZA6HǷ4@Z6Hǟ"4PZ6@4pZ59 @4Z59 @50 4Zq6H4ZI6HR4Z!68@50 4Z6H4Z6H4Z6@H6րҘ40Wp@H6`x4Wqҹ(@DHWA4@P4 ҿ H H* W5&(6 әW4 6@w 5-Z59 54V5?W 4 `0b+`Ku@"4% W 4#7Ky +K=4W y4#@W 4#@7K=44W 4#b44(Kv  4!7 4㿿Kv 4 04Ap4 7W4y44A84 ZE7 44(!20 Kw@8 7 4W140IZWi4 IAKjx* W5:-4? W 44KK?1K?)K?!K?K?K? @O?44Y"@4 47V4 30449"p@4 V7f f4i4'4Kv 5:47k?yKv 45:Y7k?i55Kv 5:k?47k?qK?i7`K? x k?w D k? 7ր" V7"(7K?K?i_%5K?i  7?i_Mk? 5Ve@&W44z44V4 R 0447@D4 7y.7VM4Ƞ4VU4 X7 0447Q@4 7x.7V4Ƞe44z44V4K?K?K? @O?Ky K?!XE4@XU4 @V4`]4|Gx h4G4  *  _ K?!G 4埭4@V544|k?7Kw 4K?Y@7?G ςK?YGx B#30479"@4 V-7ς}K?Y_M@]K?Yk?7K @@G 0*4K?Y@7?ςK?Y_@K?Yk?ok>7Wk>4#7z4 V54 2C@ BKx/kx ȁHC4K>YK>@O>Ky/ ky C4$ 4"kwK>4H4Ve7>ч ˀmK>YKv 7>47g|Kv 7>47g|Kv 7>47k|Kv 7>4u7k|Kv 7>4E7k|Kv 7>47k|Kv 7>47k|Kv 7?47g|Kv 7?47g|Kv 7? 4U7g|Kv 7? 4%7g| Kv 7?47g|Kv 7?47g|ςK>Y#047#@$4 V =7"s046y#@4 V 7ˀmK>YKu=Ks= k?Ku;QKs;Y k?Ku<Ks<  k?k?ok>7C_E7>ɋ`#07$P_M4z 7_4 #047$@4 7V4y_4xK>Y"046$@44 7VE4y(K>Y"046$`@4 7V4yK>Y7wj@j84j07?7??j(4.7?j 7?j?j?j?6?7wxj`KtjXjPjHj@j8j0j(j j?j?j?j?j?j?j? @6?A"s046y$@4 7V =4yX@ @_E4K>YYE4X4Z 4Y4Z 4[}4\4[4_4_4_U4_u4Kz @Ve@k`Kz` @V5@k``k`Kzx V@k`xKz@ @V@k`@k`pKzЀ V@k`K>YK>@O>@P@K?@ @Ku=!Ks=) k?k?ok? k?7C7$"r06y _4 #07%k?!@ 7% @ K?!4zX4K:4y?`4%4kw؃`27kx:_= K:7Kz:I@ @V @4K>K?K? @O?k?oKx:7Y tV-4zp44y@ 4 V744y @ |4 V7X y4K?Y@O?k?ok? k?k?%7C4 x7x070k?! *4 4W4zK?! Х؀ 4@ `K>K?K?K? @O?k?ok? k?k?70@7C4k?!%7x0 *4 4W 4zK?! 4ХK>K?K?K? @O?k?ok? k?k?k?!70@7C7$k?147x04( :`44 W 4zK?1 4_ЄK>K?!K?K?K? @O?k?77^7? j 2 #479 W K?Y#7 W XK?Y"t6y W y(K?Y7w8W K?Y@7?k?78 _䀊 b *#7 W XK?Y"t6y W (K?Y"6 W qK?Y@7?KW44Bs@=6 <\B@Wk?ok? 7W7_k>7>c>k>_5Ck?_7>7`y_ 7?Q k?K?#T7y17Z Vq7?QXK>_7?q k?#K?7 07y1V7?qK>K>K? @O?k?ok>k>7_7]k>977>9c>7k>)Cc ek>9Cd _g?k>փ օ g?y`_ _e7?Q44_U7?q7?qk?K>"7y116 V7?QK>9K>YK>K>@O>_7?1"K>7y1!6 V97?1K>9k?ok>k>k>7_7]k>977>9c>7k>)Cd Ѓk>9Cf _g?k>_7>9ք֙ g?p7_7?17?1k? K>k? 7y1A4 0V4xhK>9_7?a7?ak? K>k? T7y1Q4Z Vq4xK>9K>YK>K>K>@O>k?ok>k>7]7Sk>977c>77>9k>)Bek>9Ck>9_Ck>еtk>yk>`_ _7?17?ak?K>4_7?a7?1k?K>#K>7y1qV7 pK>9K>YK>K>@O>_7?7?k?K>"K>7y1aVi6 }K>9@ @K?@ @k?7k?7?_kw:7y1#7 Г 7x107x1V@K?YK?@7?@ @K?@ @k?ok>7_7Zk>9=7>9c>7k>)Ck>_ wDk|:K>) 77y1DŽ(c?#7 pW7?7y1Ǥ8@WY7?"6 W97?7y18@W7?"6 @W7?7y10@W7? T4Y 0W7?k? 4K>49 W7> t4z7y27?VI7>K>9K>YK>@O>@ @K?@ @k?7k?97?9c?7_k?)k|:C?7ҝK?)04C?7#47: 7 7y27x2!@7x21V!@K?YK?9@7?@ @K?@ @k?79k?_7?q#7y2Q7pVy7?qK>K?@7?@ @K?@ @k?/,/-o`k"7y46V 7>K;K<@7<@ @K?@ @k?ok? 7_c>9$k>y@Pk>_ 7>44?"6 `7 B+*ʄ*)+7k>C_ 7>4x?4?#475h 77k>C7k>Ci7?q7t9A #7y8Q74V4w @K>_ 7>#77y4!V4x K>"7y416`VY4x K>#7y4A7V! K>#7y4Q7x4a7V @K> 7y4q7x44 V4w K> T7y47x44ZPVa K>7y47x4 44: V!4wK>#7y47x47PV @K>"7y47x56 V4wK>"7y57x5!6PVa K>"7y517x5A6 V!4wK>"t7y5Q7x5a6zPV @K>#7y5q7x57 V4wK>#T7y57x57ZPVa K>"6 7y57x5V!4wK>#7y57x57PV @K>#7V4K> 7y57x64Vq K> t7y67x6!4zV1 K> T7y617x6A4ZV PK>7y6Q7x6a 44:V K>#7y6q7x67Vq K>"7y67x66V1 K>"7y67x6V6 XK>"7y67x66PV K>"t7y67x76zVy K>#7y77x7!VA7 K>#T7y7A7x7Q7ZPV `K>#7y7q7x77V  K> 7y77x7V4 K> t7y77x74zPVI K> T7y77x74ZV  hK> t7y84zV60K> T7y84ZV K>7y8! 44:0Va K>#7y817pV)6K>#47:U4yXK>7k>C7Uk>CCӹ_7?A 7y8A4wUu7?AK> 449V 4%+_7K>_7hK>_7HK>_7(K>#TU7ZK>K>K? @O?@ @K?@ @k?78Y0k?#7y8aU7P(K?Y"7y8qU6K?YK?@7?@ @K?@ @k?7k?97?9c?7_k?)C?7"67y8U 7K?YK?9@7?@ @K?@ @k?7c?79k?9y@k?)_7?9k?_7?9#7K?7y8U-7HK?9!J" #TU7ZK?9K?Y@7???@_7?9C?7Ǚ07#7y8U]7P}K?9"7y8U-6MK?9_@5K?Y_@K?Y_@K?Y_u@K?Yk?7@@K?Y@7?k?7@@K?Y@7?k?7@`@K?Y@7?k?ok? k?k?k?!7D@"7%@"Kc @4&HyV4 bHc`?Hy" ZHyV14#j( 4$4V4 āHzV4"@7Y47Vy4 |"74WU4( 4'4VI4 gY47U4!`744W4Hz @U@ fY47UU4 | 74W-4K (@KV4@@K 0kcˀ0K>`u@ ( 4<H|ˀK>ˀK>ˀK>ˀK>KeH jKV )4`H@HH (@KV 4_@H x H|K>K?!K?K?K? @O? _ : W ]  SV@ \CT x4@ӿ< 77Z<  @?@@Kuhe>hf>hg>hh>hi>hj>hk>hl>hm>hn>Ka?H&7$7H7 %4%0Kh:Kj %IYV y5 eIJ@?IY@%zIG@4^"!@Y475s4 K?K?g~4` k?k?77h_5 @H4 D 4`5@ K?K?~  k?k?77h_]5 H?w5@$4]4!t 5yp@ `7IY@ H7@ 5:75:@ 77Y5z7Y5 5 K?K?~4`  k?k?5y7@ p7!t 5yp@ P77@ 855y@ 7Y%5:7K?K?~4`  k?k?A774 tp4 `55775)76 7,?5yV)5!5yV 5!45@ x5X 75@4!I  @5 @x4!X@ ?5!2A7 ("5)A7 ?5)>E@  ˀ84~4 ! M5h44~Hb>YHn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>˄}hmhk?ok? k?k?k?!k?)KG7C k?1@4zHc`#Hh( H0"jHf$4HsHw d Hg$XH: GVK?1DRĄX@H}7G? ܋ #D!HHt( Hu0 刀 6# @#*Hx7G? Ջ#D?Ht(Hh  Hh#Jz HVK?1?-HHa Hy' Hc "Hx C HwH Hh!J HVQK?1>HHb H}G Hc!H C Y K?1K?1_7Hs(76yHt76y?Hb07 E 7@=Hyˀ8K>Hx Hc!H CK>K?)K?!K?K?K? @O?ˀK>_M@\E@_-@\@_ @\ H _@\E@_@\Hˀ K>_@\H_}@\ H _]@\@_=@\ G @4ś7 Ş'H| ˀMK>_@\% C L҇L HzH ZD:D  " @6# @7#4 @7<#T @7\# @70"t @6|@# @7`" @6pKu=Ks= k?k?o t k?_4z C @_u4z` C `@_EK? C 0@_4z C04|K?Y@O?C8X7? (7W6 ?7@6?k?ok? k?k?@ 7E@ 8Kc:( 4$P4UM4 @( 4$P`kd:Y47U k?! 7K?!4W4kf: U 4zK|:K>K?K?K? @O?k?ok>k>k>7#7Yk>k?K>4k?7z07k>k?k?k?yk?qk?ik?ak?Y@k?Q!7@ @4z X7YU47U %4"`74z4W4k?Y7?7? k?7?7?!k?7?7>k?7>7>k?y4z@k?K>Yu7K>k?47k?QK>4k?K?k?K? k?K>k?yK?k?qK?k?iK?!k?aK>@K>! 7Ƞ4H @@4H H 4 `4 KX @@ J 4c ? ``4@44K>YK>K>K>@O>H @@4H jH  X4 K_ @x@ K:@  ?4?4U 4z4 _ : W ]  SV@ \KuKs>  k?k?ok> k>k>k>!7D4@KZ@" _4"p77>_4 K>48bb@UK>7" K>4g44_4!@ _ _4H B4% # 7 *!U48 !H7 H(4 !hHz"H!hHz H!hHzH C   !`Hz H C h !XHz(h(H!XHz0 Ch0Kg:40kw:_4K=_4K=K>!K>K>K> @O>U4zK=_@\}@_u@\ _U@\H_5@\H_@\h(_@\ C U4zU4 Kuk?q4K>K?!K?K?K? @O?k?Ky@7?q_4>K:KKu<Ks< k?Ku=QKs=Y k?Ku k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=64 k>4K=ak>K=iY k>K>K=q K=yK=K=CCK=4xk>cC 4yk>ǃC 4 `_#ªY Y57J (@U15!e6 J?@R4K=Y Y 56O U7#7K>K>5V]4^K>K>4t_%566? 6@ 4CC*cCZǃCq> #ǣCr@$"K>7@ P5J>M@$jK=Q`$ZK>_K>7_4z@7>p֟t&a&i8G&qFq U 4:(#7P64ǣ@ 4@ `4 @47`4 4eK=YY)5zM7Y 5ZU7Y5:]7Y4%7Y457Y45746K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>47@X5ycܥ@4\7@ 5Yǃq>4\7@59Eq>z?@ V47@5ǣr4V7@`4r4X77@4`47@4eK=QU Q56K>_K> 4 @K> @K> (K>J I K>K>_]4 0o4oAj6 o!:4  40 ! Ǐ@K>K>_=4 7k?Ya6Zk?K>76Yk?5k?k?yk?qk?ik?ak?Y_k?Q - K>6X_uK>5?575?~@6 M Ku;Ks; k?Ku=Ks= k?KuK?1K?)K?!K?K?K? @O?_@H_@H!4 59 @H4ܞ=@_u@m@_@C8X7? (7W6 ?7@6?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK>76K>7I4K>4 K> K>y ` @ :C_ 4 4 r4V_ b4X R5)A? 8 (@ ( _8 ?5)K:: \e4K?IK?AK?9K?1K?)K?!K?K?K? @O?CW 07\ *7C?@4@k?ok?k?4?KwhKxpKy: h x W W  araX4 P6? D X Ҥ `6 e4c_7`@ V   ֠ 476 m7 ` aH4P6? X ҃7 @67 D_4B`@ X  v 7ր 4\6 m7 7@ } Ku:Kah5kuhK|p kbpK?YK?K?@O?k?ok?4$k``Ky:kyh77z9_ !kypk|P@4Z 4bHkzX4V b(k`X0k`X0k}X4|K?YK?@O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K>4'k`;K:7Hk?K>7$7k? 6 4%Kt: J4 0kj:45_474k|:K` 4#C!0@K:Kmh hkhKnp hkpKoX%KbpKwhW%% @_54K: 8kpkhhkh:K:& B4ZU&B&6 (4 0Z4 kv` #*K}: 4 ZB :K?"B _4"Km`A4 44 84 ?4z "5A ?5I:4!51Ky`W - BK`J:X !Z@0 6*61 J:@?}6*ku: 6 kp;kj`AW 24z "5JAW ?5JI:* 4 Ky`W * BKw`I:X )`05+5) I:@?}5 6 46* #:@#K?@&Kq: B &rKr`B__4&BKa`49ky`4@+j_5YK`C@0Ka:4,@0kl:&4 t&C4= C4vS'"C,C+C+k;Ku:6 kj: (kpK:@z C4Z C J7`8k: C?7C ?7kh:K:" T60:WK:Ks:6k:KwpKxh ( 8_4khhKpKwh (k:̟4KmX0̟7kr: 4hkq;Kh: BK|:Ka? T H4:@4Y@T@XKz`Kd` k}`k`:Kd:44~kp:Kv:6k:A! IW 50kf;Km: !7? CKa?щl 84:@# HIWT7@@IWk? 4 49CHTX-Kz`Kb` ks`ICkc:h4~ "@7kb: kh;XKz`Ke`K? k}`K? I_ID  44Kz: :7?Ka? H" 4:@TI6@XKz`Kx` kx`IZkz:@0tt4~4Kq: Kl: Ka?4:@C 2" HKw`Ty6@+Kr`k?" 6CHT)k`:K:7kz:7e:ke`4~Kg: zKqPKa?р 84:@! H5 T5W(+! H5 PTY5Wkj:X4~C4 44 04 k;K|:7kj:_=kj`K:57Kp: 8@Ka?" H4:@6 Ty5Wkj:@ 8t4~`4545+ +Kf: :Kv:Ka?"t H4:@T6y XMKz`Ka` ku`4~Kr:6Yky: "AS I 5Iki;Ke: 8@Ka?#4 HIw4:@T79 0XmKz`Kx` ki`4~ 0@K:A*7ka: kj;XKz`Kd` ks`K? K? @ -IId  44K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ko: :7?Ka? H# 4:@T7@XKz`Kn` kl`@0tt4~4k``4k`;k`` "k;Kt:6ki:K: Ky: 8@Ka?! H4:@5 T5Wkj:@ 8 t4 ~k``d7kn: km;k?7K?k?_ Ek?K?Y@7?Ku>Ks> k?k?oKs; (7C_4Kz;( \_u4+~4= k?Kx;Ka?k?C4:@ 7w:!#4 2@7w:1T)79 @4K>@O?k?ok?7C@04TM4z 7_4z4K?YK?@O?KuX=== =,=8=D=P=\=h=t===========>>>>(>4>@>L@(>x>>>>>>>>>>>??? ?,?8@(@(@(?D?P?\?h?t???@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(????@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(????@@@At@H@T@`@l@x@@@@@@@@@@@AAA A,A8ADAPA\AhDXAAAAAAAAABB BB$B0B<BHBTB`BlBxBBBBBBBBBBBCCC C,C8CDCPC\ChCtCCCCCCCCCCCDDDD(D4DXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXDXD@DLEDxDDDDDDDDDDDEFhEEEEEFFF F,F8FDFPF\GFFFFFFFFFFGGGGGGGGGGGGGGGGG GG$G0G<GHGTG`GlGxGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGI HHHHHHHHIINtI@ILIXIdIpNtI|IIIIIIIIINtNtIJJ NtJJ$NtNtJ0NtNtNtJ<JHNtNtJTNtNtNtJ`JlJxJJJJNtJJJJJNtNtNtJJNtKKNtNtNtK NtK,K8KDNtNtNtKPNtK\KhKtKKKKKKKKKKKLLLNtNtL(L4L@LLLXLdNtNtLpL|LLLLNtNtLLNtNtNtLNtNtLLLMM MNtNtM$M0M<MHMTM`MlMxNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtMMNtNtNtMNtNtNtMNtNtNtMMNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtNtMNtNtMMMMNNNtNtN N,N8NDNPN\NhO|NNNOOOO(O4O@OLOXOdOpP8OOOOOOOOOPPP P,Q\PPPQQ\Q\QQ Q\Q\Q\Q\Q\Q,Q8QDQPR`Q|QQQQQQQQQQRR RR$R0R<RHRTV@RV@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@V@RRRRRRRV@V@RRRSSSV@V@S(S4V@V@V@V@V@V@S@SLV@V@SXSdV@V@V@SpS|SSSSSSSSSSTV@V@T TT$T0T<THV@V@V@V@TTT`TlTxV@V@V@V@TTTTV@V@V@V@TTTTV@V@V@V@TTTUV@UU U,V@V@V@V@U8UDV@V@UPV@U\UhV@V@V@V@V@V@V@V@V@UtUUV@V@UUV@V@UV@V@V@V@V@V@V@V@V@V@V@UUV@V@UV@V@V@V@V@V@UUUVVVV(V@V@V4XVWWWW(W4XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXW@WLWXXXXXXXXXXXXXXWdXWpXW|XWXWXWXWXXXWXWXWXWXXXXXXXXXWXWXXXX XXXXXX$XXXX0XXXXXXXXXXXXXXXX<XXXXXXXXXXXXXXXXHXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXXXX`XXXXXXXXXXXXXXXXlXXXXXXXXXXXXXXXXxXXXXXXXXXXXXXXXXYpXXXXXXXYYYY(Y4Y@YLYXYd)30A>vvL2 ޭ&vPWA5+'?UUUUU\?UUUUU\+vP AL&W2(ޭ@vv30c>-*' ommmmmmmmnn noooon$n0n<nHnTon`nlnxnnnnnnonnnnnooo o,o8oDoPo\ohotooopoopppp(p4p@pLpXpdppp|oooooo! oooooo  oo,JvP8$ARB0( &WNF<4.*& ޭ@vv30cPLHD>:62```p```p`` ````0\ht000(4@LXdp| $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$D$l$$|$$$$$$$$$$$$$$$$$$$$$$$$$$D$$$$$$ $$$$d?UUUUU\d(Րo oooooooooo?UUUUU\@Y&$$$%<%%&&8&X&?- 5%A1)! A@3/+'# "C 3 !K;,! G?7/'  !!  MIEA=951.*%54544455555 5(50585@5H5P5X5`5h5p5x5@P:@P@P:@P:;;D;l;;;<(>>(>8>`>p>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>?????????????????????????????????4?\???@@DAXA`AXAXAXAAAXAXAXAXAAAAXAA`AAAAXACBPCC@CpB\B\BpBBCB\B\B\CB\B0B@B@B@BpB@CF\A,F\F\F\F\F\F\F\F\F\F\F\F\F\F\F\F\DF\F\F\GF\F\F\F\F\F\F\F\CF\F\F\F\F\F\F\F\F\F\F\F\F\F\F\F\F\FF\F\F\HF\A,F\F\F\F\F\EF\A,F\GF\F\F\F\F\F\F\F\F\G`A,o`rro`o\o`o`o`o`ro`o`o`o`o`o`o`o`o`o`o`o`o`o`o`o`o`o`o`o`o`o`o`o`rxttvHvw<wwwx xLxpR_386_NONER_386_32R_386_PC32R_386_GOT32R_386_PLT32R_386_COPYR_386_GLOB_DATR_386_JUMP_SLOTR_386_RELATIVER_386_GOTOFFR_386_GOTPCR_386_16R_386_PC16R_386_8R_386_PC8R_386_GNU_VTINHERITR_386_GNU_VTENTRYR_V850_NONER_V850_9_PCRELR_V850_22_PCRELR_V850_HI16_SR_V850_HI16R_V850_LO16R_V850_32R_V850_16R_V850_8R_V850_SDA_16_16_OFFSETR_V850_SDA_15_16_OFFSETR_V850_ZDA_16_16_OFFSETR_V850_ZDA_15_16_OFFSETR_V850_TDA_6_8_OFFSETR_V850_TDA_7_8_OFFSETR_V850_TDA_7_7_OFFSETR_V850_TDA_16_16_OFFSETR_V850_TDA_4_5_OFFSETR_V850_TDA_4_4_OFFSETR_V850_SDA_16_16_SPLIT_OFFSETR_V850_ZDA_16_16_SPLIT_OFFSETR_V850_CALLT_6_7_OFFSETR_V850_CALLT_16_16_OFFSETR_V850_GNU_VTINHERITR_V850_GNU_VTENTRYR_PPC_NONER_PPC_ADDR32R_PPC_ADDR24R_PPC_ADDR16R_PPC_ADDR16_LOR_PPC_ADDR16_HIR_PPC_ADDR16_HAR_PPC_ADDR14R_PPC_ADDR14_BRTAKENR_PPC_ADDR14_BRNTAKENR_PPC_REL24R_PPC_REL14R_PPC_REL14_BRTAKENR_PPC_REL14_BRNTAKENR_PPC_GOT16R_PPC_GOT16_LOR_PPC_GOT16_HIR_PPC_GOT16_HAR_PPC_PLTREL24R_PPC_COPYR_PPC_GLOB_DATR_PPC_JMP_SLOTR_PPC_RELATIVER_PPC_LOCAL24PCR_PPC_UADDR32R_PPC_UADDR16R_PPC_REL32R_PPC_PLT32R_PPC_PLTREL32R_PPC_PLT16_LOR_PPC_PLT16_HIR_PPC_PLT16_HAR_PPC_SDAREL16R_PPC_SECTOFFR_PPC_SECTOFF_LOR_PPC_SECTOFF_HIR_PPC_SECTOFF_HAR_PPC_EMB_NADDR32R_PPC_EMB_NADDR16R_PPC_EMB_NADDR16_LOR_PPC_EMB_NADDR16_HIR_PPC_EMB_NADDR16_HAR_PPC_EMB_SDAI16R_PPC_EMB_SDA2I16R_PPC_EMB_SDA2RELR_PPC_EMB_SDA21R_PPC_EMB_MRKREFR_PPC_EMB_RELSEC16R_PPC_EMB_RELST_LOR_PPC_EMB_RELST_HIR_PPC_EMB_RELST_HAR_PPC_EMB_BIT_FLDR_PPC_EMB_RELSDAR_PPC_GNU_VTINHERITR_PPC_GNU_VTENTRYR_PPC_TOC16R_MIPS_NONER_MIPS_16R_MIPS_32R_MIPS_REL32R_MIPS_26R_MIPS_HI16R_MIPS_LO16R_MIPS_GPREL16R_MIPS_LITERALR_MIPS_GOT16R_MIPS_PC16R_MIPS_CALL16R_MIPS_GPREL32R_MIPS_UNUSED1R_MIPS_UNUSED2R_MIPS_UNUSED3R_MIPS_SHIFT5R_MIPS_SHIFT6R_MIPS_64R_MIPS_GOT_DISPR_MIPS_GOT_PAGER_MIPS_GOT_OFSTR_MIPS_GOT_HI16R_MIPS_GOT_LO16R_MIPS_SUBR_MIPS_INSERT_AR_MIPS_INSERT_BR_MIPS_DELETER_MIPS_HIGHERR_MIPS_HIGHESTR_MIPS_CALL_HI16R_MIPS_CALL_LO16R_MIPS_SCN_DISPR_MIPS_REL16R_MIPS_ADD_IMMEDIATER_MIPS_PJUMPR_MIPS_RELGOTR_MIPS_JALRR_MIPS_maxR_MIPS16_26R_MIPS16_GPRELR_MIPS_PC32R_MIPS_PC64R_MIPS_GNU_REL16_S2R_MIPS_GNU_REL_LO16R_MIPS_GNU_REL_HI16R_MIPS_GNU_VTINHERITR_MIPS_GNU_VTENTRYR_ALPHA_NONER_ALPHA_REFLONGR_ALPHA_REFQUADR_ALPHA_GPREL32R_ALPHA_LITERALR_ALPHA_LITUSER_ALPHA_GPDISPR_ALPHA_BRADDRR_ALPHA_HINTR_ALPHA_SREL16R_ALPHA_SREL32R_ALPHA_SREL64R_ALPHA_OP_PUSHR_ALPHA_OP_STORER_ALPHA_OP_PSUBR_ALPHA_OP_PRSHIFTR_ALPHA_GPVALUER_ALPHA_GPRELHIGHR_ALPHA_GPRELLOWR_ALPHA_IMMED_GP_16R_ALPHA_IMMED_GP_HI32R_ALPHA_IMMED_SCN_HI32R_ALPHA_IMMED_BR_HI32R_ALPHA_IMMED_LO32R_ALPHA_COPYR_ALPHA_GLOB_DATR_ALPHA_JMP_SLOTR_ALPHA_RELATIVER_ARM_NONER_ARM_PC24R_ARM_ABS32R_ARM_REL32R_ARM_PC13R_ARM_ABS16R_ARM_ABS12R_ARM_THM_ABS5R_ARM_ABS8R_ARM_SBREL32R_ARM_THM_PC22R_ARM_THM_PC8R_ARM_AMP_VCALL9R_ARM_SWI24R_ARM_THM_SWI8R_ARM_XPC25R_ARM_THM_XPC22R_ARM_COPYR_ARM_GLOB_DATR_ARM_JUMP_SLOTR_ARM_RELATIVER_ARM_GOTOFFR_ARM_GOTPCR_ARM_GOT32R_ARM_PLT32R_ARM_GNU_VTENTRYR_ARM_GNU_VTINHERITR_ARM_THM_PC11R_ARM_THM_PC9R_ARM_RXPC25R_ARM_RSBREL32R_ARM_THM_RPC22R_ARM_RREL32R_ARM_RABS32R_ARM_RPC24R_ARM_RBASER_68K_NONER_68K_32R_68K_16R_68K_8R_68K_PC32R_68K_PC16R_68K_PC8R_68K_GOT32R_68K_GOT16R_68K_GOT8R_68K_GOT32OR_68K_GOT16OR_68K_GOT8OR_68K_PLT32R_68K_PLT16R_68K_PLT8R_68K_PLT32OR_68K_PLT16OR_68K_PLT8OR_68K_COPYR_68K_GLOB_DATR_68K_JMP_SLOTR_68K_RELATIVER_68K_GNU_VTINHERITR_68K_GNU_VTENTRYR_SPARC_NONER_SPARC_8R_SPARC_16R_SPARC_32R_SPARC_DISP8R_SPARC_DISP16R_SPARC_DISP32R_SPARC_WDISP30R_SPARC_WDISP22R_SPARC_HI22R_SPARC_22R_SPARC_13R_SPARC_LO10R_SPARC_GOT10R_SPARC_GOT13R_SPARC_GOT22R_SPARC_PC10R_SPARC_PC22R_SPARC_WPLT30R_SPARC_COPYR_SPARC_GLOB_DATR_SPARC_JMP_SLOTR_SPARC_RELATIVER_SPARC_UA32R_SPARC_PLT32R_SPARC_HIPLT22R_SPARC_LOPLT10R_SPARC_PCPLT32R_SPARC_PCPLT22R_SPARC_PCPLT10R_SPARC_10R_SPARC_11R_SPARC_64R_SPARC_OLO10R_SPARC_HH22R_SPARC_HM10R_SPARC_LM22R_SPARC_PC_HH22R_SPARC_PC_HM10R_SPARC_PC_LM22R_SPARC_WDISP16R_SPARC_WDISP19R_SPARC_UNUSED_42R_SPARC_7R_SPARC_5R_SPARC_6R_SPARC_DISP64R_SPARC_PLT64R_SPARC_HIX22R_SPARC_LOX10R_SPARC_H44R_SPARC_M44R_SPARC_L44R_SPARC_REGISTERR_SPARC_UA64R_SPARC_UA16R_SPARC_REV32R_SPARC_GNU_VTINHERITR_SPARC_GNU_VTENTRYR_M32R_NONER_M32R_16R_M32R_32R_M32R_24R_M32R_10_PCRELR_M32R_18_PCRELR_M32R_26_PCRELR_M32R_HI16_ULOR_M32R_HI16_SLOR_M32R_LO16R_M32R_SDA16R_M32R_GNU_VTINHERITR_M32R_GNU_VTENTRYR_D10V_NONER_D10V_10_PCREL_RR_D10V_10_PCREL_LR_D10V_16R_D10V_18R_D10V_18_PCRELR_D10V_32R_D10V_GNU_VTINHERITR_D10V_GNU_VTENTRYR_D30V_NONER_D30V_6R_D30V_9_PCRELR_D30V_9_PCREL_RR_D30V_15R_D30V_15_PCRELR_D30V_15_PCREL_RR_D30V_21R_D30V_21_PCRELR_D30V_21_PCREL_RR_D30V_32R_D30V_32_PCRELR_D30V_32_NORMALR_SH_NONER_SH_DIR32R_SH_REL32R_SH_DIR8WPNR_SH_IND12WR_SH_DIR8WPLR_SH_DIR8WPZR_SH_DIR8BPR_SH_DIR8WR_SH_DIR8LR_SH_SWITCH16R_SH_SWITCH32R_SH_USESR_SH_COUNTR_SH_ALIGNR_SH_CODER_SH_DATAR_SH_LABELR_SH_SWITCH8R_SH_GNU_VTINHERITR_SH_GNU_VTENTRYR_SH_LOOP_STARTR_SH_LOOP_ENDR_SH_GOT32R_SH_PLT32R_SH_COPYR_SH_GLOB_DATR_SH_JMP_SLOTR_SH_RELATIVER_SH_GOTOFFR_SH_GOTPCR_MN10200_NONER_MN10200_32R_MN10200_16R_MN10200_8R_MN10200_24R_MN10200_PCREL8R_MN10200_PCREL16R_MN10200_PCREL24R_MN10300_NONER_MN10300_32R_MN10300_16R_MN10300_8R_MN10300_PCREL32R_MN10300_PCREL16R_MN10300_PCREL8R_MN10300_GNU_VTINHERITR_MN10300_GNU_VTENTRYR_MN10300_24R_PARISC_NONER_PARISC_DIR32R_PARISC_DIR21LR_PARISC_DIR17RR_PARISC_DIR17FR_PARISC_DIR14RR_PARISC_DIR14FR_PARISC_PCREL12FR_PARISC_PCREL32R_PARISC_PCREL21LR_PARISC_PCREL17RR_PARISC_PCREL17FR_PARISC_PCREL17CR_PARISC_PCREL14RR_PARISC_PCREL14FR_PARISC_DPREL21LR_PARISC_DPREL14WRR_PARISC_DPREL14DRR_PARISC_DPREL14RR_PARISC_DPREL14FR_PARISC_DLTREL21LR_PARISC_DLTREL14RR_PARISC_DLTREL14FR_PARISC_DLTIND21LR_PARISC_DLTIND14RR_PARISC_DLTIND14FR_PARISC_SETBASER_PARISC_SECREL32R_PARISC_BASEREL21LR_PARISC_BASEREL17RR_PARISC_BASEREL17FR_PARISC_BASEREL14RR_PARISC_BASEREL14FR_PARISC_SEGBASER_PARISC_SEGREL32R_PARISC_PLTOFF21LR_PARISC_PLTOFF14RR_PARISC_PLTOFF14FR_PARISC_LTOFF_FPTR32R_PARISC_LTOFF_FPTR21LR_PARISC_LTOFF_FPTR14RR_PARISC_FPTR64R_PARISC_PLABEL32R_PARISC_PLABEL21LR_PARISC_PLABEL14RR_PARISC_PCREL64R_PARISC_PCREL22CR_PARISC_PCREL22FR_PARISC_PCREL14WRR_PARISC_PCREL14DRR_PARISC_PCREL16FR_PARISC_PCREL16WFR_PARISC_PCREL16DFR_PARISC_DIR64R_PARISC_DIR64WRR_PARISC_DIR64DRR_PARISC_DIR14WRR_PARISC_DIR14DRR_PARISC_DIR16FR_PARISC_DIR16WFR_PARISC_DIR16DFR_PARISC_GPREL64R_PARISC_DLTREL14WRR_PARISC_DLTREL14DRR_PARISC_GPREL16FR_PARISC_GPREL16WFR_PARISC_GPREL16DFR_PARISC_LTOFF64R_PARISC_DLTIND14WRR_PARISC_DLTIND14DRR_PARISC_LTOFF16FR_PARISC_LTOFF16WFR_PARISC_LTOFF16DFR_PARISC_SECREL64R_PARISC_BASEREL14WRR_PARISC_BASEREL14DRR_PARISC_SEGREL64R_PARISC_PLTOFF14WRR_PARISC_PLTOFF14DRR_PARISC_PLTOFF16FR_PARISC_PLTOFF16WFR_PARISC_PLTOFF16DFR_PARISC_LTOFF_FPTR64R_PARISC_LTOFF_FPTR14WRR_PARISC_LTOFF_FPTR14DRR_PARISC_LTOFF_FPTR16FR_PARISC_LTOFF_FPTR16WFR_PARISC_LTOFF_FPTR16DFR_PARISC_COPYR_PARISC_IPLTR_PARISC_EPLTR_PARISC_TPREL32R_PARISC_TPREL21LR_PARISC_TPREL14RR_PARISC_LTOFF_TP21LR_PARISC_LTOFF_TP14RR_PARISC_LTOFF_TP14FR_PARISC_TPREL64R_PARISC_TPREL14WRR_PARISC_TPREL14DRR_PARISC_TPREL16FR_PARISC_TPREL16WFR_PARISC_TPREL16DFR_PARISC_LTOFF_TP64R_PARISC_LTOFF_TP14WRR_PARISC_LTOFF_TP14DRR_PARISC_LTOFF_TP16FR_PARISC_LTOFF_TP16WFR_PARISC_LTOFF_TP16DFR_PARISC_GNU_VTENTRYR_PARISC_GNU_VTINHERITR_ARC_NONER_ARC_32R_ARC_B26R_ARC_B22_PCRELR_FR30_NONER_FR30_8R_FR30_20R_FR30_32R_FR30_48R_FR30_6_IN_4R_FR30_8_IN_8R_FR30_9_IN_8R_FR30_10_IN_8R_FR30_9_PCRELR_FR30_12_PCRELR_FR30_GNU_VTINHERITR_FR30_GNU_VTENTRYR_MCORE_NONER_MCORE_ADDR32R_MCORE_PCRELIMM8BY4R_MCORE_PCRELIMM11BY2R_MCORE_PCRELIMM4BY2R_MCORE_PCREL32R_MCORE_PCRELJSR_IMM11BY2R_MCORE_GNU_VTINHERITR_MCORE_GNU_VTENTRYR_MCORE_RELATIVER_MCORE_COPYR_MCORE_GLOB_DATR_MCORE_JUMP_SLOTR_960_NONER_960_12R_960_32R_960_IP24R_960_SUBR_960_OPTCALLR_960_OPTCALLXR_960_OPTCALLXAR_PJ_NONER_PJ_DATA_DIR32R_PJ_CODE_REL32R_PJ_CODE_REL16R_PJ_CODE_DIR32R_PJ_CODE_DIR16R_PJ_CODE_LO16R_PJ_CODE_HI16R_PJ_GNU_VTINHERITR_PJ_GNU_VTENTRYR_AVR_NONER_AVR_32R_AVR_7_PCRELR_AVR_13_PCRELR_AVR_16R_AVR_16_PMR_AVR_LO8_LDIR_AVR_HI8_LDIR_AVR_HH8_LDIR_AVR_LO8_LDI_NEGR_AVR_HI8_LDI_NEGR_AVR_HH8_LDI_NEGR_AVR_LO8_LDI_PMR_AVR_HI8_LDI_PMR_AVR_HH8_LDI_PMR_AVR_LO8_LDI_PM_NEGR_AVR_HI8_LDI_PM_NEGR_AVR_HH8_LDI_PM_NEGR_AVR_CALLR_IA64_NONER_IA64_IMM14R_IA64_IMM22R_IA64_IMM64R_IA64_DIR32MSBR_IA64_DIR32LSBR_IA64_DIR64MSBR_IA64_DIR64LSBR_IA64_GPREL22R_IA64_GPREL64IR_IA64_GPREL32MSBR_IA64_GPREL32LSBR_IA64_GPREL64MSBR_IA64_GPREL64LSBR_IA64_LTOFF22R_IA64_LTOFF64IR_IA64_PLTOFF22R_IA64_PLTOFF64IR_IA64_PLTOFF64MSBR_IA64_PLTOFF64LSBR_IA64_FPTR64IR_IA64_FPTR32MSBR_IA64_FPTR32LSBR_IA64_FPTR64MSBR_IA64_FPTR64LSBR_IA64_PCREL60BR_IA64_PCREL21BR_IA64_PCREL21MR_IA64_PCREL21FR_IA64_PCREL32MSBR_IA64_PCREL32LSBR_IA64_PCREL64MSBR_IA64_PCREL64LSBR_IA64_LTOFF_FPTR22R_IA64_LTOFF_FPTR64IR_IA64_LTOFF_FPTR32MSBR_IA64_LTOFF_FPTR32LSBR_IA64_LTOFF_FPTR64MSBR_IA64_LTOFF_FPTR64LSBR_IA64_SEGREL32MSBR_IA64_SEGREL32LSBR_IA64_SEGREL64MSBR_IA64_SEGREL64LSBR_IA64_SECREL32MSBR_IA64_SECREL32LSBR_IA64_SECREL64MSBR_IA64_SECREL64LSBR_IA64_REL32MSBR_IA64_REL32LSBR_IA64_REL64MSBR_IA64_REL64LSBR_IA64_LTV32MSBR_IA64_LTV32LSBR_IA64_LTV64MSBR_IA64_LTV64LSBR_IA64_PCREL21BIR_IA64_PCREL22R_IA64_PCREL64IR_IA64_IPLTMSBR_IA64_IPLTLSBR_IA64_COPYR_IA64_LTOFF22XR_IA64_LDXMOVR_IA64_TPREL14R_IA64_TPREL22R_IA64_TPREL64IR_IA64_TPREL64MSBR_IA64_TPREL64LSBR_IA64_LTOFF_TP22R_IA64_DTPMOD64MSBR_IA64_DTPMOD64LSBR_IA64_LTOFF_DTPMOD22R_IA64_DTPREL14R_IA64_DTPREL22R_IA64_DTPREL64IR_IA64_DTPREL32MSBR_IA64_DTPREL32LSBR_IA64_DTPREL64MSBR_IA64_DTPREL64LSBR_IA64_LTOFF_DTPREL22R_CRIS_NONER_CRIS_8R_CRIS_16R_CRIS_32R_CRIS_8_PCRELR_CRIS_16_PCRELR_CRIS_32_PCRELR_CRIS_GNU_VTINHERITR_CRIS_GNU_VTENTRYR_860_NONER_860_32R_860_COPYR_860_GLOB_DATR_860_JUMP_SLOTR_860_RELATIVER_860_PC26R_860_PLT26R_860_PC16R_860_LOW0R_860_SPLIT0R_860_LOW1R_860_SPLIT1R_860_LOW2R_860_SPLIT2R_860_LOW3R_860_LOGOT0R_860_SPGOT0R_860_LOGOT1R_860_SPGOT1R_860_LOGOTOFF0R_860_SPGOTOFF0R_860_LOGOTOFF1R_860_SPGOTOFF1R_860_LOGOTOFF2R_860_LOGOTOFF3R_860_LOPCR_860_HIGHADJR_860_HAGOTR_860_HAGOTOFFR_860_HAPCR_860_HIGHR_860_HIGOTR_860_HIGOTOFFR_X86_64_NONER_X86_64_64R_X86_64_PC32R_X86_64_GOT32R_X86_64_PLT32R_X86_64_COPYR_X86_64_GLOB_DATR_X86_64_JUMP_SLOTR_X86_64_RELATIVER_X86_64_GOTPCRELR_X86_64_32R_X86_64_32SR_X86_64_16R_X86_64_PC16R_X86_64_8R_X86_64_PC8%s: Error: %s: Warning: Unhandled data length: %d 0x%8.8lx%lx%ld%5ld%luDon't know about relocations on this machine architecture Unable to seek to start of %s at %x Out of memory allocating %d bytes for %s Unable to read in %d bytes of %s out of memory parsing relocs Offset Info Type Symbol's Value Symbol's Name Addend Offset Info Type Symbol's Value Symbol's Name %8.8lx %5.5lx unrecognised: %-7lx%-21.21s bad symbol index: %08lx %-25.25s + %lx%*cMIPS_RLD_VERSIONMIPS_TIME_STAMPMIPS_ICHECKSUMMIPS_IVERSIONMIPS_FLAGSMIPS_BASE_ADDRESSMIPS_MSYMMIPS_CONFLICTMIPS_LIBLISTMIPS_LOCAL_GOTNOMIPS_CONFLICTNOMIPS_LIBLISTNOMIPS_SYMTABNOMIPS_UNREFEXTNOMIPS_GOTSYMMIPS_HIPAGENOMIPS_RLD_MAPMIPS_DELTA_CLASSMIPS_DELTA_CLASS_NOMIPS_DELTA_INSTANCEMIPS_DELTA_INSTANCE_NOMIPS_DELTA_RELOCMIPS_DELTA_RELOC_NOMIPS_DELTA_SYMMIPS_DELTA_SYM_NOMIPS_DELTA_CLASSSYMMIPS_DELTA_CLASSSYM_NOMIPS_CXX_FLAGSMIPS_PIXIE_INITMIPS_SYMBOL_LIBMIPS_LOCALPAGE_GOTIDXMIPS_LOCAL_GOTIDXMIPS_HIDDEN_GOTIDXMIPS_PROTECTED_GOTIDXMIPS_OPTIONSMIPS_INTERFACEMIPS_DYNSTR_ALIGNMIPS_INTERFACE_SIZEMIPS_RLD_TEXT_RESOLVE_ADDRMIPS_PERF_SUFFIXMIPS_COMPACT_SIZEMIPS_GP_VALUEMIPS_AUX_DYNAMICSPARC_REGISTERHP_LOAD_MAPHP_DLD_FLAGSHP_DLD_HOOKHP_UX10_INITHP_UX10_INITSZHP_PREINITHP_PREINITSZHP_NEEDEDHP_TIME_STAMPHP_CHECKSUMHP_GST_SIZEHP_GST_VERSIONHP_GST_HASHVALNULLNEEDEDPLTRELSZPLTGOTHASHSTRTABSYMTABRELARELASZRELAENTSTRSZSYMENTINITFINISONAMERPATHSYMBOLICRELRELSZRELENTPLTRELDEBUGTEXTRELJMPRELBIND_NOWINIT_ARRAYFINI_ARRAYINIT_ARRAYSZFINI_ARRAYSZRUNPATHFLAGSPREINIT_ARRAYPREINIT_ARRAYSZCHECKSUMPLTPADSZMOVEENTMOVESZFEATUREPOSFLAG_1SYMINSZSYMINENTADDRRNGLOCONFIGDEPAUDITAUDITPLTPADMOVETABSYMINFOVERSYMRELACOUNTRELCOUNTFLAGS_1VERDEFVERDEFNUMVERNEEDVERNEEDNUMAUXILIARYUSEDFILTERProcessor Specific: %lxOperating System specific: %lx: %lxNONE (None)REL (Relocatable file)EXEC (Executable file)DYN (Shared object file)CORE (Core file)Processor Specific: (%x)OS Specific: (%x): %xNone, relocatable executable, has entry point, , sorted symbol tables, interworking enabled, uses APCS/26, uses APCS/float, position independent, 8 bit structure alignment, uses new ABI, uses old ABI, software FP, , cpu32, emb, relocatable, relocatable-lib, v850e, v850ea, v850, unknown v850 architecture variant, m32r, noreorder, pic, cpic, abi2, mips1, mips2, mips3, mips4, mips5, mips32, mips64, 3900, 4010, 4100, 4650, 4111, mips32-4k, sb1 UNKNOWN, v8+, ultrasparcI, ultrasparcIII, halr1, ledata, tso, pso, rmo, PA-RISC 1.0, PA-RISC 1.1, PA-RISC 2.0, trapnil, ext, lsb, wide, no kabp, lazyswap, new calling convention, gnu calling convention, 64-bit, 32-bit, reduced fp model, no function descriptors, constant gp, constant gp, absoluteREGINFORTPROCOPTIONSHP_TLSHP_CORE_NONEHP_CORE_VERSIONHP_CORE_KERNELHP_CORE_COMMHP_CORE_PROCHP_CORE_LOADABLEHP_CORE_STACKHP_CORE_SHMHP_CORE_MMFHP_PARALLELHP_FASTBINDPARISC_ARCHEXTPARISC_UNWINDIA_64_ARCHEXTIA_64_UNWINDLOADDYNAMICINTERPNOTESHLIBPHDRLOPROC+%lxLOOS+%lxMIPS_GPTABMIPS_UCODEMIPS_DEBUGMIPS_REGINFOMIPS_PACKAGEMIPS_PACKSYMMIPS_RELDMIPS_IFACEMIPS_CONTENTMIPS_SHDRMIPS_FDESCMIPS_EXTSYMMIPS_DENSEMIPS_PDESCMIPS_LOCSYMMIPS_AUXSYMMIPS_OPTSYMMIPS_LOCSTRMIPS_LINEMIPS_RFDESCMIPS_DELTASYMMIPS_DELTAINSTMIPS_DELTACLASSMIPS_DWARFMIPS_DELTADECLMIPS_EVENTSMIPS_TRANSLATEMIPS_PIXIEMIPS_XLATEMIPS_XLATE_DEBUGMIPS_WHIRLMIPS_EH_REGIONMIPS_XLATE_OLDMIPS_PDR_EXCEPTIONPARISC_EXTPARISC_DOCIA_64_EXTPROGBITSNOBITSDYNSYMGROUPSYMTAB SECTION INDICIESSHT_LOPROC+%xSHT_LOOS+%xSHT_LOUSER+%xallfile-headerprogram-headersheadershistogramsegmentssectionssection-headerssymbolssymsrelocsnotesdynamicarch-specificversion-infouse-dynamichex-dumpdebug-dumpunwindversionhelpUsage: readelf {options} elf-file(s) Options are: -a or --all Equivalent to: -h -l -S -s -r -d -V -A -I -h or --file-header Display the ELF file header -l or --program-headers or --segments Display the program headers -S or --section-headers or --sections Display the sections' header -e or --headers Equivalent to: -h -l -S -s or --syms or --symbols Display the symbol table -n or --notes Display the core notes (if present) -r or --relocs Display the relocations (if present) -u or --unwind Display the unwind info (if present) -d or --dynamic Display the dynamic segment (if present) -V or --version-info Display the version sections (if present) -A or --arch-specific Display architecture specific information (if any). -D or --use-dynamic Use the dynamic section info when displaying symbols -x or --hex-dump= Dump the contents of section -w[liaprf] or --debug-dump[=line,=info,=abbrev,=pubnames,=ranges,=frames] Display the contents of DWARF2 debug sections -I or --histogram Display histogram of bucket list lengths -v or --version Display the version number of readelf -H or --help Display this information Report bugs to %s Out of memory allocating dump request table.ersuahnldSDAIw::x:i:vVUnrecognised debug option '%s' Invalid option '-%c' Nothing to do. noneELF32ELF642's complement, little endian2's complement, big endianUNIX - System VUNIX - HP-UXUNIX - NetBSDUNIX - LinuxGNU/HurdUNIX - SolarisUNIX - AIXUNIX - IRIXUNIX - FreeBSDUNIX - TRU64Novell - ModestoUNIX - OpenBSDStandalone AppARMNot an ELF file - it has the wrong magic bytes at the start ELF Header: Magic: %2.2x Class: %s Data: %s Version: %d %s OS/ABI: %s ABI Version: %d Type: %s Machine: %s Version: 0x%lx Entry point address: Start of program headers: (bytes into file) Start of section headers: (bytes into file) Flags: 0x%lx%s Size of this header: %ld (bytes) Size of program headers: %ld (bytes) Number of program headers: %ld Size of section headers: %ld (bytes) Number of section headers: %ld Section header string table index: %ld There are no program headers in this file. Elf file type is %s Entry point There are %d program headers, starting at offset Out of memory Program Header%s: Type Offset VirtAddr PhysAddr FileSiz MemSiz Flg Align Type Offset VirtAddr PhysAddr FileSiz MemSiz Flags Align %-14.14s 0x%6.6lx 0x%8.8lx 0x%5.5lx %c%c%c %#lx %c%c%c more than one dynamic segment Unable to find program interpreter name %63s [Requesting program interpreter: %s] Section to Segment mapping: Segment Sections... %2.2d %s WAXMSILOGopx There are no sections in this file. There are %d section headers, starting at offset 0x%lx: File contains multiple dynamic symbol tables .dynstrFile contains multiple dynamic string tables .debug_infoabbrevlinepubnamesarangesframe.gnu.linkonce.wi..eh_frame Section Header%s: [Nr] Name Type Addr Off Size ES Flg Lk Inf Al [Nr] Name Type Address Offset Size EntSize Flags Link Info Align [%2d] %-17.17s %-15.15s %6.6lx %6.6lx %2.2lx %3s %2ld %3lx %2ld %8.8lx %2ld %3lx %ld Key to Flags: W (write), A (alloc), X (execute), M (merge), S (strings) I (info), L (link order), G (group), x (unknown) O (extra OS processing required) o (OS specific), p (processor specific) Relocation section at offset 0x%lx contains %ld bytes: There are no dynamic relocations in this file. Relocation section %d'%s' at offset 0x%lx contains %lu entries: There are no relocations in this file. <+%lx>: [), info at +0x%lx v%u, flags=0x%lx (%s%s ), len=%lu bytes Unknown version. Skipping unexpected symbol type %uR_IA64_SEGRELSkipping unexpected relocation type %s There are no unwind sections in this file. .gnu.linkonce.ia64unw..gnu.linkonce.ia64unwi..IA_64.unwind.IA_64.unwind_info Could not find unwind info section for Unwind section QUICKSTARTNOTPOTNO_LIBRARY_REPLACEMENTNO_MOVESGI_ONLYGUARANTEE_INITDELTA_C_PLUS_PLUSGUARANTEE_START_INITPIXIEDEFAULT_DELAY_LOADREQUICKSTARTREQUICKSTARTEDCORDNO_UNRES_UNDEFRLD_ORDER_SAFENONE %s%sInterface Version: %s %ld %04u-%02u-%02uT%02u:%02u:%02uTime Stamp: %s %#lx HP_DEBUG_PRIVATEHP_DEBUG_CALLBACKHP_DEBUG_CALLBACK_BORHP_NO_ENVVARHP_BIND_NOWHP_BIND_NONFATALHP_BIND_VERBOSEHP_BIND_RESTRICTEDHP_BIND_SYMBOLICHP_RPATH_FIRSTHP_BIND_DEPTH_FIRSTORIGIN SYMBOLIC TEXTREL BIND_NOW unknown There is no dynamic segment in this file. Unable to seek to end of file!Unable to determine the number of symbols to load Unable to seek to end of file Unable to determine the length of the dynamic string table Dynamic segment at offset 0x%x contains %ld entries: Tag Type Name/Value (%s)%*s%sAuxiliary libraryFilter libraryConfiguration fileDependency audit libraryAudit library: [%s] : Flags: None PARINIT CONFEXP %lx LAZYLOAD GROUPPERM NOW GLOBAL GROUP NODELETE LOADFLTR INITFIRST NOOPEN ORIGIN DIRECT TRANS INTERPOSE NODEFLIB NODUMP CONLFATShared library: [%s] program interpreterLibrary soname: [%s]Library rpath: [%s]Library runpath: [%s] (bytes) Not needed object: [%s] BASE | WEAK | Version definition section '%s' contains %ld entries: Addr: 0x%08lx Offset: %#08lx Link: %lx (%s) %#06x: Rev: %d Flags: %s Index: %d Cnt: %d Name: %s Name index: %ld %#06x: Parent %d: %s %#06x: Parent %d, name index: %ld Version needs section '%s' contains %ld entries: Addr: 0x Offset: %#08lx Link to section: %ld (%s) %#06x: Version: %d File: %s File: %lx Cnt: %d %#06x: Name: %s %#06x: Name index: %lx Flags: %s Version: %d Version symbols section '%s' contains %d entries: Addr: %03x: 0 (*local*) 1 (*global*) %4x%cUnable to seek to %x for %s Unable to read data at %x for %s (%s%-*s No version information found in this file. LOCALGLOBALWEAK: %d: %d: %dNOTYPEOBJECTFUNCSECTIONFILECOMMONTHUMB_FUNCREGISTERPARISC_MILLIHP_OPAQUEHP_STUBDEFAULTINTERNALHIDDENPROTECTEDUNDABSCOMPRCRSVOS %3dUnable to read in dynamic data Unable to seek to start of dynamic informationFailed to read in number of buckets Failed to read in number of chains Symbol table for image: Num Buc: Value Size Type Bind Vis Ndx Name Num Buc: Value Size Type Bind Vis Ndx Name %3d %3d: %6s %6s %3s %3.3s %s Symbol table '%s' contains %lu entries: Num: Value Size Type Bind Vis Ndx Name Num: Value Size Type Bind Vis Ndx Name %6d: %-7s %-6s %-3s %4s %s@%s (%d)bad dynamic symbol Dynamic symbol information is not available for displaying symbols. Histogram for bucket list length (total of %d buckets): Length Number %% of total Coverage Out of memory 0 %-10d (%5.1f%%) %7d %-10d (%5.1f%%) %5.1f%% Dynamic info segment at offset 0x%lx contains %d entries: Num: Name BoundTo Flags %4d: %-30s SELF PARENT %-10s %-10d PASSTHRU COPY Section '%s' has no data to dump. Hex dump of section '%s': 0x%8.8lx %2.2x%c.badly formed extended line op encountered! Extended opcode %d: End of Sequence set Address to 0x%lx define new File Table entry Entry Dir Time Size Name %d %lu %s UNKNOWN: length %d Dump of debug contents of section %s: The line info appears to be corrupt - the section is too small Only DWARF version 2 line info is currently supported. Length: %ld DWARF Version: %d Prologue Length: %d Minimum Instruction Length: %d Initial value of 'is_stmt': %d Line Base: %d Line Range: %d Opcode Base: %d Opcodes: Opcode %d has %d args The Directory Table is empty. The Directory Table: %s The File Name Table is empty. The File Name Table: %d %s Line Number Statements: Copy Advance PC by %d to %lx Advance Line by %d to %d Set File Name to entry %d in the File Name Table Set column to %d Set is_stmt to %d Set basic block Advance PC by constant %d to 0x%lx Advance PC by fixed size amount %d to 0x%lx Special opcode %d: advance Address by %d to 0x%lx and Line by %d to %d Contents of the %s section: Only DWARF 2 pubnames are currently supported Length: %ld Version: %d Offset into .debug_info section: %ld Size of area in .debug_info section: %ld Offset Name %ld %s Unknown TAG value: %lxUnknown AT value: %lxUnknown FORM value: %lx Number TAG %ld %s [%s] has childrenno children %-18s %s %lu byte block: %lx DW_OP_addr: %lxDW_OP_derefDW_OP_const1u: %luDW_OP_const1s: %ldDW_OP_const2u: %luDW_OP_const2s: %ldDW_OP_const4u: %luDW_OP_const4s: %ldDW_OP_const8u: %lu %luDW_OP_const8s: %ld %ldDW_OP_constu: %luDW_OP_consts: %ldDW_OP_dupDW_OP_dropDW_OP_overDW_OP_pick: %ldDW_OP_swapDW_OP_rotDW_OP_xderefDW_OP_absDW_OP_andDW_OP_divDW_OP_minusDW_OP_modDW_OP_mulDW_OP_negDW_OP_notDW_OP_orDW_OP_plusDW_OP_plus_uconst: %luDW_OP_shlDW_OP_shrDW_OP_shraDW_OP_xorDW_OP_bra: %ldDW_OP_eqDW_OP_geDW_OP_gtDW_OP_leDW_OP_ltDW_OP_neDW_OP_skip: %ldDW_OP_lit%dDW_OP_reg%dDW_OP_breg%d: %ldDW_OP_regx: %luDW_OP_fbreg: %ldDW_OP_bregx: %lu %ldDW_OP_piece: %luDW_OP_deref_size: %ldDW_OP_xderef_size: %ldDW_OP_nop(User defined location op)(Unknown location op) %-18s: <#%lx> <%lx> %#lx %ldUnable to handle FORM: %dUnrecognised form: %d (not inlined)(inlined)(declared as inline but ignored)(declared as inline and inlined) (Unknown inline attribute value: %lx)(non-ANSI C)(ANSI C)(C++)(FORTRAN 77)(Fortran 90)(Modula 2)(ANSI Pascal)(Ada)(Cobol 74)(Cobol 85)(MIPS assembler)(Unknown: %lx)(void)(machine address)(boolean)(complex float)(float)(signed)(signed char)(unsigned)(unsigned char)(user defined type)(unknown type)(public)(protected)(private)(unknown accessibility)(local)(exported)(qualified)(unknown visibility)(none)(virtual)(pure_virtual)(unknown virtuality)(case_sensitive)(up_case)(down_case)(case_insensitive)(unknown case)(normal)(program)(nocall)(user defined)(unknown convention)()The section %s contains: Compilation Unit @ %lx: Length: %ld Version: %d Abbrev Offset: %ld Pointer Size: %d Only version 2 DWARF debug information is currently supported. .debug_abbrevUnable to locate .debug_abbrev section! Unable to locate entry %lu in the abbreviation table <%d><%x>: Abbrev Number: %lu (%s) Only DWARF 2 aranges are currently supported. Length: %ld Version: %d Offset into .debug_info: %lx Pointer Size: %d Segment Size: %d Address Length %8.8lx %lu LOC CFA ra r%-4d%08lx r%d%+d%-8s usc%+dr%dn/a%-5sThe section %s contains: eh %08lx %08lx %08lx CIE "%s" cf=%d df=%d ra=%d %08lx %08lx %08lx CIE Version: %d Augmentation: "%s" Code alignment factor: %u Data alignment factor: %d Return address column: %d Augmentation data: %02xInvalid CIE pointer %08lx in FDE at %08lx %08lx %08lx %08lx FDE cie=%08x pc=%08lx..%08lx DW_CFA_advance_loc: %d to %08lx DW_CFA_offset: r%d at cfa%+ld DW_CFA_restore: r%d DW_CFA_set_loc: %08lx DW_CFA_advance_loc1: %ld to %08lx DW_CFA_advance_loc2: %ld to %08lx DW_CFA_advance_loc4: %ld to %08lx DW_CFA_offset_extended: r%ld at cfa%+ld DW_CFA_restore_extended: r%ld DW_CFA_undefined: r%ld DW_CFA_same_value: r%ld DW_CFA_register: r%ld DW_CFA_remember_state DW_CFA_restore_state DW_CFA_def_cfa: r%d ofs %d DW_CFA_def_cfa_reg: r%d DW_CFA_def_cfa_offset: %d DW_CFA_nop DW_CFA_GNU_window_save DW_CFA_GNU_args_size: %ld DW_CFA_GNU_negative_offset_extended: r%ld at cfa%+ld unsupported or unknown DW_CFA_%d Displaying the debug contents of section %s is not yet supported. Section '%s' has no debugging data. Unrecognised debug section: %s Some sections were not dumped because they do not exist! INEX%sUFLO%sOFLO%sDIV0%sINVAL0 EXACT_MATCH IGNORE_INT_VER REQUIRE_MINOR EXPORTS DELAY_LOAD DELTA Section '.liblist' contains %lu entries: Library Time Stamp Checksum Version Flags %3lu: %-20s %s %#10lx %-7ld NONE %#x Section '%s' contains %d entries: NULL %d %lx REGINFO GPR %08lx GP 0x%lx CPR0 %08lx CPR1 %08lx CPR2 %08lx CPR3 %08lx GPR %08lx GP 0x EXCEPTIONS fpe_min() fpe_max( PAGE0 SMM FPDBUG DISMISS PAD PREFIX POSTFIX SYMBOL HWPATCH R4KEOP R8KPFETCH R5KEOP R5KCVTL FILL TAGS HWAND R4KEOP_CHECKED R4KEOP_CLEAN HWOR GP_GROUP %#06lx self-contained %#06lx IDENT %#06lx self-contained %#06lx %3d ??? %d %lx\%03oconflict list with without table Section '.conflict' contains %d entries: Num: Index Value Name%5lu: %8lu NT_PRSTATUS (prstatus structure)NT_FPREGSET (floating point registers)NT_PRPSINFO (prpsinfo structure)NT_TASKSTRUCT (task structure)NT_PRXFPREG (user_xfpregs structure)NT_PSTATUS (pstatus structure)NT_FPREGS (floating point registers)NT_PSINFO (psinfo structure)NT_LWPSTATUS (lwpstatus_t structure)NT_LWPSINFO (lwpsinfo_t structure)NT_WIN32PSTATUS (win32_pstatus strcuture)Unknown note type: (0x%08x) %s 0x%08lx %s Notes at offset 0x%08lx with length 0x%08lx: Owner Data size Description No note segments present in the core file. This instance of readelf has been built without support for a 64 bit data type and so it cannot read 64 bit ELF files. Cannot stat input file %s. rbInput file %s not found. %s: Failed to read file header File: %s binutils/opt/binutils/share/locale2.11.2GNU %s %s Copyright 1997, 98, 99, 2000, 2001 Free Software Foundation, Inc. This program is free software; you may redistribute it under the terms of the GNU General Public License. This program has absolutely no warranty.  $<Tl?UUUUU\ <\|<\|84Tt,Ll%sb%u%sr%u%sf%uprpsp@priunatrpar.bspar.bspstorear.rnatar.unatar.fpsrar.pfsar.lcUnknown11Unknown12Unknown13Unknown14Unknown15r%uf%ub%u %s:spill_sprel(reg=%s,t=%lu,spoff=0x%lx) %s:spill_psprel(reg=%s,t=%lu,pspoff=0x10-0x%lx) %s:restore(t=%lu,reg=%s) %s:spill_reg(t=%lu,reg=%s,treg=%s) %s:spill_sprel_p(qp=p%u,t=%lu,reg=%s,spoff=0x%lx) %s:spill_psprel_p(qp=p%u,t=%lu,reg=%s,pspoff=0x10-0x%lx) %s:restore_p(qp=p%u,t=%lu,reg=%s) %s:spill_reg_p(qp=p%u,t=%lu,reg=%s,treg=%s) %s:%s(rlen=%lu) %s:prologue_gr(mask=[%s],grsave=%s,rlen=%lu) %s:br_mem(brmask=[%s]) -frb %s:br_gr(brmask=[%s],gr=r%u) %s:%s_gr(reg=r%u) %s:rp_br(reg=b%u) %s:priunat_gr(reg=r%u) Unknown code 0x%02x %s:spill_mask(imask=[]) %s:frgr_mem(grmask=[%s],frmask=[%s]) %s:gr_mem(grmask=[%s]) %s:fr_mem(frmask=[%s]) @svr4@hpux@nt %s:mem_stack_f(t=%lu,size=%lu) %s:mem_stack_v(t=%lu) %s:spill_base(pspoff=0x10-0x%lx) %s:%s_sprel(spoff=0x%lx) %s:%s_when(t=%lu) %s:%s_psprel(pspoff=0x10-0x%lx) %s:priunat_when_gr(t=%lu) %s:priunat_psprel(pspoff=0x10-0x%lx) %s:priunat_sprel(spoff=0x%lx) %s:priunat_when_mem(t=%lu) %s:gr_gr(grmask=[%s],r%u) 0x%x %s:unwabi(abi=%s,context=0x%02x) %s:copy_state(label=%lu) %s:label_state(label=%lu) %s:epilogue(t=%lu,ecount=%lu) /opt/binutils/share/localemessages/.moCPOSIXLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_ALLLC_XXXLANGUAGELANG/locale.alias/opt/binutils/share/locale:.riso--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument %s%sCannot allocate %lu bytes after allocating %lu bytes \!\X!`"@""P""X"""""""&`X&(4(8(8(<(<(@(@(D(D(H(`(d(d(h(h(l)8)<)H)L)h)l++/8/000 00,000L0P0l0p000000001 11,101L1P1h1p2<2@2L2P2l2p44445P5T555555555555666 6666$6(60646<6@6H6L6T6X6`6d6l6p6x6|666666666666666666777777 7(7,74787@7D7L7P7X7\7d7h7p7t7|777777777777777777888 888 8$8,80888<8D8H8P8T8\8`8h8l8t8x8888888888888888888888999999 9(9,94989@9D9L9P9X9\9d9h9p9t9|999999999999999999999::: ::::$:(:0:4:<:@:H:L:T:X:`:d:l:p:x:|::::::::::::::::::;;;;;; ;(;,;4;8;@;D;L;P;X;\;d;h;p;t;|;;;;;;;;;;;;;;;;;;;;;<<< <<<<$<(<0<4<<<@>> >>>>$>(>0>4><>@>H>L>T>X>\>`>>>>>>>>>>>>>>>>>>>>>>?????? ?(?,?4?8?@?D?L?P?X?\?d?h?p?t?|?????????????????????@@@ @@@@$@(@,@0@P@T@\@`@h@l@t@x@@@@@@@@@@@@@@@@@@@@@@AAAAAA A(A,A4A8A@ADALAPAXA\AdAhApAtAxA|AAAAAAAAAAAAAAAAABBB BBB B$B,B0B8B<BDBHBPBTB\B`BhBlBtBxBBBBBBBBBBBBBBBBBBBBBBCCCCCC C(C,C4C8C@CDCLCPCXC\CdChCpCtC|CCCCCCCCCCCCCCCCCCCCCDDD DDDD$D(D0D4D<D@DHDLDTDXD\D`DDDDDDDDDDDDDDDDDDDDDDEEEEEEEHELETEXE`EdElEpExE|EEEEEEEEEEEEEEEEEEFFFFFF F(F,F4F8F@FDFLFPFXF\FdFhFlFpFFFFFFFFFFFFFFFFFFFGGG GGG G$G,G0G8G<GDGHGPGTG\G`GhGlGtGxGGGGGGGGGGGGGGGGGGGGGGHHH,H0H8H<HDHHHPHTH\H`HhHlHtHxHHHHHHHHHHHHHHHHHHIIIIII I$I(IHILITIXI`IdIlIpIxI|IIIIIIIIIIIIIIIIIIIIIJJJ JJJ J$J,J0J8J<JDJHJPJTJ\J`JhJlJtJxJJJJJJJJJJJJJJJJJJJJJJKKKKKK K(K,K4K8K@KDKLKPKXK\KdKhKpKtK|KKKKKKKKKKKKKKKKKKKKKLLL LLLL$L(L0L4L<L@LHLLLTLXL`LdLlLpLxL|LLLLLLLLLLLLLLLLLLLLLMMM MMM M$M,M0M8M<MDMHMPMTM\M`MhMlMtMxMMMMMMMMMMMMMMMMMMMMMMNNNNNN N(N,N4N8N@NDNLNPNXN\NdNhNpNtNxN|NNNNNNNNNNNNNNOOO OOOO$O(O0O4O<O@OHOLOTOXO`OdOlOpOxO|OOOOOOOOOOOOOOOOOOPPPPPP P(P,P4P8P<P@PhPlPtPxPPPPPPPPPPPPPPPPPPQQQQQQ Q(Q,Q4Q8Q@QDQLQPQXQ\Q`QdQQQQQQQQQQQQQQQQQQQQQRRR RRR R$R,R0R8R<RDRHRPRTR\R`RdRhRRRRRRRRRRRRRRRRRRRRSSS SSSS$S(S0S4S<S@SHSLSTSXS`SdSlSpSxS|SSSSSSSSSSSSSSSSSSSSSTTT TTT T$T,T0T8T<TDTHTPTTT\T`ThTlTtTxTTTTTTTTTTTTTTTTTTTTTTUUUUUU U(U,U4U8U@UDULUPUXU\UdUhUpUtU|UUUUUUUUUUUUUUUUUUUUUVVV VVVV$V(V0V4V<V@VDVHVtVxVVVVVVVVVVVVVVVVVVWWW WWWW$W(W0W4W<W@WHWLWTWXW`WdWlWpWxW|WWWWWWWWWWWWWWWWWWWWWXXX XXX X$X,X0X8X<XDXHXPXTX\X`XhXlXtXxXXXXXXXXXXXXXXXXXXYYY YYYY$Y(Y0Y4Y<Y@YHYLYTYXY`YdYlYpYtYZZ ZlZ[ [[@[l[[\,\H\\]]^^_ _b)bc|)ceTeXfgmxm|mmmmmmmmmmmmmmmnnn nnn n$n,n0n8n<nDnHnPnTn\n`nhnlntnxnnnnnnnnnnnnnnnnnnnnnnoooooo o(o,o4o8o@oDoLoPoXo\odohopoto|oooooooooooooppp pppp$p(p0p4p<p@pHpLpTpXp`pdplpppxp|ppppvvv v$ww}@}\~4~8(D$(04<@lp  $(,048<@DHLPTX\x| 8<dhpt| $(04<@HLTX`dlpx|  $,048X\dhpt|hl04 ,0TXTp|8 < x|Đ ˬN ˰N ((P X\<@ظؼ $ڜڠ |܀ܬ0p0tXXX\,0txpHxpH| ptLPtx((Ѐ((D) )* *..44556 6$66667899:D:H@@FFH|HLh LlMl MP, P0PPRxR|RRRRRRRRg00ggghhhLhPhhjhjll lmD mHm|mnHnLz0z|0| ||}}~ ~<~~LPDHx|ptlp`dLP,0$(0|@\4E88TE8p@$ldh,0HL$   (D|     $48LPX \ DHT Xlpʹ͸txθ,0\&h & Yx Zp Z [D [\\0 _$ f p }D ,    X Ĕ  ܰ  (, 7 H Mp R R g h ~$       D  X   p   ,        μ @;$Revision: 92453-07 linker linker crt0.o B.11.06 981204 $/usr/lib/dld.slERROR: mmap failed for dldERROR: mmap failed for TSDEpaExhElEeEIElESESEsEsErEnFdFAFVF(DF8xFHwFXuF`vFhH@1p@;@;@1@;@1@;@1@<@1@< @1@<@1@<@1@<@1@<@2@<@2@<@20@<@2@@<readelfrelocsrelocsrelocsrelocsrelocsrelocsrelocsrelocsrelocsrelocsrelocsrelocsWE32100SparcIntel 80386MC68000MC88000Intel 80486Intel 80860MIPS R3000IBM System/370MIPS R4000 big-endianSparc v9 (old)HPPAPower PC (old)Sparc v8+Intel 90860PowerPCNEC V800Fujitsu FR20TRW RH32MCOREARMDigital Alpha (old)Hitachi SHSparc v9Siemens TricoreARCHitachi H8/300Hitachi H8/300HHitachi H8SHitachi H8/500Intel IA-64Stanford MIPS-XMotorola ColdfireMotorola M68HC12Alphad10vd30vARCMitsubishi M32rNEC v850mn10300mn10200Fujitsu FR30picoJavaFujitsu Multimedia AcceleratorSiemens PCPSony nCPU embedded RISC processorDenso NDR1 microprocessprMotorola Star*Core processorToyota ME16 processorSTMicroelectronics ST100 processorAdvanced Logic Corp. TinyJ embedded processorSiemens FX66 microcontrollerSTMicroelectronics ST9+ 8/16 bit microcontrollerSTMicroelectronics ST7 8-bit microcontrollerMotorola MC68HC16 MicrocontrollerMotorola MC68HC11 MicrocontrollerMotorola MC68HC08 MicrocontrollerMotorola MC68HC05 MicrocontrollerSilicon Graphics SVxSTMicroelectronics ST19 8-bit microcontrollerDigital VAXAtmel AVR 8-bit microcontrollerAxis Communications 32-bit embedded processorInfineon Technologies 32-bit embedded cpuElement 14 64-bit DSP processorLSI Logic's 16-bit DSP processorDonald Knuth's educational 64-bit processorHarvard Universitys's machine-independent object formatSiTera PrismAdvanced Micro Devices X86-64bug-binutils@gnu.org(current)program headersprogram headersprogram headersprogram headersprogram headersprogram headerssstring_table != NULLreadelf.csection headerssection headerssection headerssection headerssection headerssection headerssymbolssymbolssymbolssymbolssymbolssymbolsstring tablestring tablestring tabledynamic stringsdynamic stringsdynamic stringssstring tablestring tablestring table ehandler uhandlerunwind tableunwind tableunwind tablestring tablestring tablestring tableunwind infounwind infounwind info dynamic segmentdynamic segmentdynamic segmentdynamic segmentdynamic segmentdynamic segmentdynamic string tabledynamic string tabledynamic string tablesizeof (Elf_External_Syminfo) == entry->d_un.d_valreadelf.csymbol informationsymbol informationsymbol information version definition sectionversion definition sectionversion definition sectionversion need sectionversion need sectionversion need sectionversion string tableversion string tableversion string tableversion symbol dataversion symbol dataversion symbol dataversion needversion needversion need aux (2)version need aux (2))version defversion defversion def auxversion def aux)string tablestring tablestring tableversion dataversion dataversion needversion needversion need aux (3)version need aux (3)version defversion defversion def auxversion def aux@%s@@%ssection datasection datasection dataDW_TAG_paddingDW_TAG_array_typeDW_TAG_class_typeDW_TAG_entry_pointDW_TAG_enumeration_typeDW_TAG_formal_parameterDW_TAG_imported_declarationDW_TAG_labelDW_TAG_lexical_blockDW_TAG_memberDW_TAG_pointer_typeDW_TAG_reference_typeDW_TAG_compile_unitDW_TAG_string_typeDW_TAG_structure_typeDW_TAG_subroutine_typeDW_TAG_typedefDW_TAG_union_typeDW_TAG_unspecified_parametersDW_TAG_variantDW_TAG_common_blockDW_TAG_common_inclusionDW_TAG_inheritanceDW_TAG_inlined_subroutineDW_TAG_moduleDW_TAG_ptr_to_member_typeDW_TAG_set_typeDW_TAG_subrange_typeDW_TAG_with_stmtDW_TAG_access_declarationDW_TAG_base_typeDW_TAG_catch_blockDW_TAG_const_typeDW_TAG_constantDW_TAG_enumeratorDW_TAG_file_typeDW_TAG_friendDW_TAG_namelistDW_TAG_namelist_itemDW_TAG_packed_typeDW_TAG_subprogramDW_TAG_template_type_paramDW_TAG_template_value_paramDW_TAG_thrown_typeDW_TAG_try_blockDW_TAG_variant_partDW_TAG_variableDW_TAG_volatile_typeDW_TAG_MIPS_loopDW_TAG_format_labelDW_TAG_function_templateDW_TAG_class_templateDW_AT_siblingDW_AT_locationDW_AT_nameDW_AT_orderingDW_AT_subscr_dataDW_AT_byte_sizeDW_AT_bit_offsetDW_AT_bit_sizeDW_AT_element_listDW_AT_stmt_listDW_AT_low_pcDW_AT_high_pcDW_AT_languageDW_AT_memberDW_AT_discrDW_AT_discr_valueDW_AT_visibilityDW_AT_importDW_AT_string_lengthDW_AT_common_referenceDW_AT_comp_dirDW_AT_const_valueDW_AT_containing_typeDW_AT_default_valueDW_AT_inlineDW_AT_is_optionalDW_AT_lower_boundDW_AT_producerDW_AT_prototypedDW_AT_return_addrDW_AT_start_scopeDW_AT_stride_sizeDW_AT_upper_boundDW_AT_abstract_originDW_AT_accessibilityDW_AT_address_classDW_AT_artificialDW_AT_base_typesDW_AT_calling_conventionDW_AT_countDW_AT_data_member_locationDW_AT_decl_columnDW_AT_decl_fileDW_AT_decl_lineDW_AT_declarationDW_AT_discr_listDW_AT_encodingDW_AT_externalDW_AT_frame_baseDW_AT_friendDW_AT_identifier_caseDW_AT_macro_infoDW_AT_namelist_itemsDW_AT_priorityDW_AT_segmentDW_AT_specificationDW_AT_static_linkDW_AT_typeDW_AT_use_locationDW_AT_variable_parameterDW_AT_virtualityDW_AT_vtable_elem_locationDW_AT_MIPS_fdeDW_AT_MIPS_loop_beginDW_AT_MIPS_tail_loop_beginDW_AT_MIPS_epilog_beginDW_AT_MIPS_loop_unroll_factorDW_AT_MIPS_software_pipeline_depthDW_AT_MIPS_linkage_nameDW_AT_MIPS_strideDW_AT_MIPS_abstract_nameDW_AT_MIPS_clone_originDW_AT_MIPS_has_inlinesDW_AT_sf_namesDW_AT_src_infoDW_AT_mac_infoDW_AT_src_coordsDW_AT_body_beginDW_AT_body_endDW_FORM_addrDW_FORM_block2DW_FORM_block4DW_FORM_data2DW_FORM_data4DW_FORM_data8DW_FORM_stringDW_FORM_blockDW_FORM_block1DW_FORM_data1DW_FORM_flagDW_FORM_sdataDW_FORM_strpDW_FORM_udataDW_FORM_ref_addrDW_FORM_ref1DW_FORM_ref2DW_FORM_ref4DW_FORM_ref8DW_FORM_ref_udataDW_FORM_indirectdebug_abbrev section datadebug_abbrev section datadebug_abbrev section data.debug_info.debug_abbrev.debug_line.debug_aranges.debug_pubnames.debug_frame.eh_frame.debug_macinfo.debug_str.debug_static_func.debug_static_vars.debug_types.debug_weaknamesdebug section datadebug section datadebug section data.debug_infodebug section datadebug section datadebug section data||||liblistliblistliblistoptionsoptionsoptionsconflictconflictconflictconflictconflictconflict(NONE)notesnotesnotes@<"@<*[[\\\ \0\@\X\p\x\\\\\]H]`]x]] ]@]]]^^8HXhx ,,,X1X1X2X2X3X3X4X4R1bodyprologue,,,R2R3bodyprologueP1P2P3pspP3rpP3pfsP3prP3unatP3lcP3P3rnatP3bspP3bspstoreP3fpsrP3P4P5P6P6P7P7P7P7pspP7rpP7rpP7pfsP7pfsP7prP7prP7lcP7lcP7unatP7unatP7fpsrP7fpsrP8rpP8pfsP8prP8lcP8unatP8fpsrP8bspP8bspP8bspP8bspstoreP8bspstoreP8bspstoreP8rnatP8rnatP8rnatP8P8P8P8P9P10B1B1B2B3B4B4 0@px@<2@<2@<:@(@`>(@<>( @P>(@h>(t@tt>(&H@H >('H$@H$>((p@p>(P@4@>(R@dY |? @ $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$ylI/H#  L HH @<p(OHhů;A8v˚v)b bR [8 'VL /v'6!xy!xD!xry 4'PנuR `aDg6mTLL''̃!xT(24/g6OXkkX\T !x )'6YY]'/+ 4gyhM5]YAZAaxqVɘ 0U,Ҹ>>a9 ƿ$jȎU?A˚v8vhů;An bRY;tltD8rP.Y;2Y;Y;'j>a%*M]  "  m@s@z@@@@@U@U@U@ U@U@U@ U@U@U@UUUU xU @U&U]WUgUUmRdU}RUSU/lUQhUTLU@UWU?UU!@ U $*18>DTdv38?EKS[binu| #,3:@FKTY_djqz 0G " * 2 : B B/tmp/libtool-17527/size/opt/binutils/lib/opt/binutils/lib/libbfd-2.11.2.sl/usr/lib/libm.2/usr/lib/libc.2_tepv_ktepverrno__ismt__dld_loc_hex_valueoptopt_SYSTEM_ID_CPU_REVISIONopterroptindoptarg_FPU_MODEL_end_environ$RECOVER_END$RECOVER_START$UNWIND_END$UNWIND_START$ARGV__text_startputsmallocfopenctimestrrchrsprintfstrcpystrcmpreadstrchr_startcalloctolower_isdigitfgetsfclosebsearchfprintfexitopenrealloc_isalphastrcatqsortstrncmpvfprintfstrcasecmpgetcwdgetenvsetlocalefstat_isspacestrlen__flsbufprintfmktempfputsfputcatol_isalnumfreeclosesbrkabortmemcpystrerrorbfd_initbfd_core_file_failing_commandbfd_get_errorbfd_scan_vmabfd_check_format_matchesbfd_check_formatbfd_openrbfd_errmsgbfd_set_errorbfd_closebfd_openr_next_archived_filebfd_set_default_targetbfd_map_over_sectionsxstrerrorxexitobjalloc_create_objalloc_allocobjalloc_freemainhex_initobjalloc_free_blockfnmatchdcgettextconcat__d_trapberkeley_sumsysv_internal_sizersysv_internal_printeralias_compareerrno__ismt_ktepv_tepv__iobbfd_abs_sectionbfd_und_sectionbfd_target_vector__SB_masks7!?9" : B*= @ Z ]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]` =@ :7]@ k? k?k?@@K?@ @Ku<1Ks<9 k?#`87{7 kc-kx-1'y 4yEe'y7D7%767+4>#!744445 bנZRke-!ke-) (4Ц @Ц D(43 H?(ਃ 43 ` 7+4>7D7%7744z#*74444@H@7D7%7#+7444Kx-17D7%77Kv 24u74444#0/7@@@@ 7K?@ @@@@k?7k?#C0k? 7Yk?4@4 @@K?K?7@4K? *@K? K? 7@@4K? rKa?H:@7?!#074@4@x7?!7?!7@4##0794@4Ka?@ xH:K>@7? 44@B7?@B?7?B?@k?ok?7?"0'E' 860.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?ok)4`@44` G>- ""046_4K>9K>Qki *K>y4ߟ444K>IKa_k? k?54@844? 7 C04Y7z._4h4k?4K>a5k?4@44?"H74@4Kk>7t-k>Kk>v k>Ks-!k>7g-k>y 4 c?K?7}-)k>Ka?43k? Ka?44k?֠ k?Ka?45k?7vk?1+4< ! k?!k?)#074_47=)"06 4_4 G=-"067z._4+"c06y7z._U4 #0497z._%4 k?)Kk?9k?A k?Ik?Q@k?QKqK>Akf k?q( k?4?k?(k?47 k?k>  k>7u8k?y7>7>444? 7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4!4! <4?@@k?7k?#C0k? 7Y k?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?!#0704_-4@x7?!7?!7_4##079@4_4Ka?_H:K>@7? 44@B7?@B?7?B?@k?ok?7?"0'E' 860.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?7Kv+ H4? 4447-7K?Y@7?K?Yk?4?k?474_4$4?7 k|_M@eK?Y#07P7z/_U4-K?YKuqKs>y k?Ku=Ks= k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k> 07Ck?4 4 _k?4 4 A4A04K?H:A kz _@@@4 k?K?7w/Ak? A4z!@4%4&Ka?4'4(4 4 4 4 4 44444<< \ځ\""\#4ނ#4̃ 4ȃ<#4\#b<#J4#*4~#zpk?aK?7ku;)@ K;)@+K;1k:k?K?4zK?@K? >@K|: @@`4 Kb:@"@K;)?4$@7z01K|:K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Kt;1B "  ? km:uk`:44 A @4 Ky;1@74@_54k?_Kz;1| b j44 `A 4 Ky;1@H74@_4k?}k`:mkm:]kl:Mk`:=km:-km:k`: kl:km:4@_4k?Ka?4_4: %+Ku>Ks> k?Ku>Ks> k?Ku=Ks= k?Ku>Ks> k?Ku>Ks> k?Ku>Ks> k?Ku;Ks; k?k?o7C_4!44z_7? 8@@h4z"c0_6z K?Y_@ H@@Hz@K?_K?4(kx:4z7?_4 @@4zKa?#049 _7 _-4z 7#C0_u7Z #0_7 hK?Y@Hz_]@ @@K?_]K?4kw:K?Y@O?Ku>Ks> k?Ku?Ks? k?k?ok?Ȁ7C_-4_]44z_u4?7_%@ @@ 0Hz4k:K?YK?@O?Ku>Ks> k?Ku?Ks?  k?k?oKy:_}k? 87@ XK?4kw:K?Y@O?4_]4z @_-4z@_m4z_4z?u@@ K?4Mk:Ku;Ks; k?Ku=Ks= k?k?7K: 7X 7y0A07y0Q 7y0a_=7?Q_]7?QK>@7?k?7K:k? 78 7y0q07y0 7y0_7?Q#0K?7 _7?QK>@7?@P@K?@ @Ku>AKs>I k?k?oK# `C:(:@JK?H`__`Jp+`Kx  8kt_E@⟝@Kw ksK?Y@O?Ky ? kuKu?1Ks?9 k?Ku=Ks= k?k?ok? k?k?Ky2k`7C4k`4$_=k`Ks:6|` 8k|:Ke:07z0 7z1_@KyK ? 4K}  _k?!Ka?H& 4?h" @`4%H(7h(4Ky_54H 6?`h H(6h(Ky_4Kd: `+X7z14 _4E44 _4}Ky7z1K?!_7Hz_ ]4 H "0K_=6 K>K?K?K? @O?@ @K?@ @k?ok?C4(7#4@HdHKa?48 H} @x@Ka?49# Z_MHzK: hk|:Kw: ks:H0Kz: _k:K?YK?@O?_m@̂%Ka?@ @K?@ @k?ok?C3(7#3AHdHKa?49# H} @@Ka?4:C @Kw: kx:#0Ky:Hx_7 0Kz:_m4"0_6 @Kz:_=Hy0"0_e6 K?YK?@O?_@̂Ka?k?ok? 7Ck`:Ky2 k`:4_k`:_Kz:ᇈk|:4kz:_Kz:釈k|:4kx:k`: 0Hy_M4 PH @K_4 Ky:k?7w1k?71k?Ky:7x1Kw:_4 `Ky24_e4zKy:4 0_7x1Kz:_-Ky:_]4 K>K? @O?k?7K: _-@K?Y_@K?Y@7?Ku>Ks> k?k?o_7C_7Ka?7 @4:@k?#0Kx 7 _4w(K>##0Kx _79 K>@O?Ku=!Ks=) k?k?7Kx k?#C0Ka?k?7Y 4:@_k?K?K?_]K?Ka?H9@78?`Hh8@Ka?H?H7h7H4K?Y@7?K?_4K?Yk?77_k?17?9k?)k?!_k?9@4K?Y@7?k?77_k?17?9k?)k?!_=k?9K?Y@7?Ku?!Ks?) k?k?7#07 _k? @K?Y@7?"046 @L4 k?_ 57K?k?_7K?K?_-7eK?YKu=Ks= k?k?ok?7C 044 p@l4 Kx Ka?4:@k?_7Hw 8@ `K?_4 h?4cK?_4K?YK?@O?k?ok? k?7D c0 Hk?!44y @T4 K?!_7HKa?44y @ 4 K?!7_y4Ka?H?K4 P4% K84y 4_K?!H ?@K?!_4yK>K?K? @O?k?oKx;7Y c0_4z44y@4 _744y@4 _e7_q4K?Y@O?@ @K?@ @k?ok?k?7?1k?1k?)k?!!0k?944@ @ K?9 7B *7?6`Hw bB *7`?64c?`Hw?@K?YK?K?@O?_ }4eԠH>7_ M4?ԠH@? u4@ @K?@ @k?ok? k?k?k?!k?)CB77$#7W7x4444Z44^4\` _#Z J4~V#4T%jc@ V#"ςpK>@%`߿ ($% @?%B60B4 6046B64A`_ (@B6` @%4%Bc6 `$] jB ZB`_ (6B6 $` B6cĂ B6 ( r4~4^4T @!# @#B6 ( E84!4ˀK>قb :@$B@6 86b?@ ZςK>@ @Bc6 c@ "B4@<]6@#Zǃ 4^#R4K>K?)K?!K?K?K? @O?@!R`!R`߿ (7$ "`/B@??BςUK>6?k?1`_ (@B@7y4`&  @7g44 `  *4xK?1__%4 4@?@ςeK>ςUK>ςEK>ς5K>ǣoB@4\ςK>ˀK>ςK>ς}K>ςmK>ς]K>ςMK>7@*c  @7%|@b:/4AςK>ˀK>ˀK>CW 07\ *7C?@4@k?ok?k?4?Kw8Kx@Ky;) h x W W  araX4 P6? D X Ҥ `6 e4c_7`@ V   ֠ 476 m7 ` aH4P6? X ҃7 @67 D_4B`@ X  v 7ր 4\6 m7 7@ } Ku;)Ka85ku8K|@ kb@K?YK?K?@O?Ku=QKs=Y k?k?ok?4$k`0Ky;)ky877z2A_}ky@k| @4Z 4bHkz(4V b(k`(0k`(0k}(4|K?YK?@O?Ku=Ks= k?Ku<Ks<  k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K>4'k`;1K;)7Hk?K>7$7k? 6 4%Kt;! J4 0kj;)45_m474k|;!K0 4#C!0@K;)Km8 hk8Kn@ hk@Ko(%Kb@Kw8W%% @_4K;) 8k@kh8kh;)K;)& B4ZU&B&6 (4 0Z4 kv0 #*K};) 4 ZB :K?"B _-4"Km0A4 44 84 ?4z "5A ?5I:4!51Ky0_ - BK0J:_i !Z@0 6*61 J:@?}6*ku;) 6 kp;1kj0AW 24z "5JAW ?5JI:* 4 Ky0_ * BKw0I:_Q )`05+5) I:@?}5 6 46* #:@#K?@&Kq;) B &rKr0B__e4&BKa049ky04@+j_5YK0C@0Ka;)4,@0kl;)&4 t&C4= C4vS'"C,C+C+k;1Ku;)6 kj;) (k@K;)@z C4Z C J7`8k;) C?7C ?7k8:K;)" _6:WK;)Ks;)6k;)Kw@Kx8 ( 8_m4kh8K@Kw8 (k;)̟4Km(0̟7kr;) 4hkq;1Kh; BK|;)Ka? D H4:@4Y_@_1Kz0Kd0 k}0k`;Kd;)44~kp;)Kv;)6k;)A! IW 50kf;1Km; !7? CKa?l 84:@#HIW_7@@IWk? $49`CH__Kz0Kb0 ks0ICkc;h4~ "@7kb;) kh;1_YKz0Ke0K? k}0K? I_ID  44Kz; :7?Ka? H"4:@_Q6_Kz0Kx0 kx0IZkz;@0tt4~4Kq; Kl;) Ka?4:@C 2"HKw0_6@+Kr0k?"6PCH_1k`;K;)7kz;)7e2ake04~Kg; zKq Ka? 84:@!H5_5W(+!H5_a5Wkj;X4~C4 44 04 k;1K|;)7kj;)_=kj0K;)57Kp; 8@Ka?"H4:@6^5Wkj;@ 8t4~`4545+ +Kf; :Kv;)Ka?"d H4:@^6y`_ Kz0Ka0 ku04~Kr;)6Yky;) "AS I 5Iki;1Ke; 8@Ka?#$HIw4:@^79_ Kz0Kx0 ki04~ 0@K;)A*7ka;) kj;1_ Kz0Kd0 ks0K? K? @ -IId  44K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ko; :7?Ka? H#4:@^ 7_ 9Kz0Kn0 kl0@0tt4~4k`04k`;1k`0 "k;1Kt;)6ki;)K;) Ky; 8@Ka?!H4:@5^5Wkj;@ 8 t4 ~k`0d7kn;) km;1k?7K?k?_ Ek?K?Y@7?@ @K?@ @744_7784666x77Y7!4=74 44477w\4474 b6b:b8b<b>b@@6 @P@K?@ @Ku;Ks; k?k?o_4 (744|K?Y@O?_m4 | 274  w_4z`u4|@ @K?@ @k?ok?k?k?4@4744z  | f7C 04Hw7$Ԁ2_4?gHy@7HsHz d  thu7K?YK?K?K?@O?_e4 7Hv7H}m |@ @K?@ @k?ok?7CKZ@ ^]KD?4^=4zK?YK?@O?@ @K?@ @k?ok? k?k?k?!k?)KE7C7$ 4H 44H?H H!2Hz 4KH r F84^@54?}@]H_@]HK_^m@507G5?/KH d04 g4 sHHz ^KE?4 dH @HH@?@ g4 vK>K?)K?!K?K?K? @O?@ @K?@ @k?7Kv( k?Y7^eK?K?Y@7?Ku>1Ks>9 k?k?7K;A kz;I_4k|;AK?Y@7?k?oKs;A (7C_E4Kz;A \_47}-1 k?Kx;IKa?k?C4:@ 7w2q#$2@7w2^79 _54K>@O?k?ok?7C@04_ 4z 7_4z4K?YK?@O?@P@K?@ @Ku>aKs>i k?k?o_k? 077cpK?#7^-4zK?Y4|@O?k?7@@K?Y@7?@ @K?@ @k?7@`@K?Y@7?k?7@@K?Y@7?Ku>QKs>Y k?k?ok? k?k?k?!7D@"7%@"Kc0 @4&Hy_!4 bHc`?Hy" ZHy_4#j(4$4_4 āHz_4"@7^47_u4 |"74_=4(4'4_4 g^M47_4!`744_4Hz @^=@ f^47_M4 | 74_4K0 (@K_4@@K0 0kc0ˀ0K>`u@ (4<H|ˀK>ˀK>ˀK>ˀK>Ke0H jK_4`H@HH (@K_4_@H x H|K>K?!K?K?K? @O? _ : W ]  SV@ \CT x4@ӿ< 77Z<  @?@@Ku=AKs=I k?Kuhe>hf>hg>hh>hi>hj>hk>hl>hm>hn>Ka?H&7$7H7 %4%0Kh;QKj0 %IY_5 eIJ@?IY@%zIG@4^"!@^ 475s4 K?K?g~4` k?k?77h_5 @H4 D 4`5@ K?K?~  k?k?77h_-5 H?w5@$4_4!d5y0@ 07IY@ 7@ 5:75:@ 77^5z7^5 5 K?K?~4`  k?k?5y7@ @7!d5y0@ 77@ 55y@@ 7^-5:7K?K?~4`  k?k?A774 tp4 `55775)76 7,?5yP_5!5y`_y5!45@ H5X 75@4!I  @5 @x4!X@ ?5!2A7 ("5)A7 ?5)>E@  ˀ84~4 !M5h44~Hb>YHn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>˄}hmhk?ok? k?k?k?!k?)KG7C k?1@4zHc`#Hh( H0"jHf$4HsHw d Hg$XH: G_qK?1DRĄX@H}7G? ܋ #D!HHt( Hu0 刀 6# @#*Hx7G? Ջ#D?Ht(Hh  Hh#Jz H_YK?1?-HHa Hy' Hc "Hx C HwH Hh!J H_K?1>HHb H}G Hc!H C ^ K?1K?1_7Hs(76yHt76y?Hb07 E 7@=Hyˀ8K>Hx Hc!H CK>K?)K?!K?K?K? @O?ˀK>_@\E@_@\@_@\ H _@\E@_@\Hˀ K>_m@\H_M@\ H _-@\@_ @\ G @4ś7 Ş'H| ˀMK>_@\% C L҇L HzH ZD:D  "@6p#@7#$@7<#D@7\#@7"d@6|#@7 "@60k?o dk?_ )4z@ C @_4z  C `@_K? C 0@_4z` C04|PK?Y@O?C8X7? (7W6 ?7@6?k?ok? k?k?@ 7E@ 8Kc;Q(4$4_4 @(4$`kd;Q^547_k?! 7K?!4_ 4kf;Q ^-4zK|;QK>K?K?K? @O?k?ok>k>k>7#7^Mk>k?K>4k?7zP7k>k?k?k?yk?qk?ik?ak?Y@k?Q!7@ @4z X7^47_4"`74z4_4k?Y7?7? k?7?7?!k?7?7>k?7>7>k?y4z@k?K>^7K>k?47k?QK>4k?K?k?K? k?K>k?yK?k?qK?k?iK?!k?aK>@(K>! 7Ƞ4H @@4H H 4 `4 KX @@ J 4c ? ``4@44K>YK>K>K>@O>H @@4H jH  X4 K_ @x@ K:@  ?4?4^Y4z4 _ : W ]  SV@ \Ku!Ks>) k?k?ok> k>k>k>!7D4@KZ@" _4"p77>_4 K>48bb@_K>7" K>4g44_4!@ _ _4H B4% # 7 *!_48 !H7 H(4 !hHz"H!hHz H!hHzH C   !`Hz H C h !XHz(h(H!XHz0 Ch0Kg;a40kw;a_4K=_4K=K>!K>K>K> @O>^4zK=_@\}@_u@\ _U@\H_5@\H_@\h(_@\ C ^4z^ 4 Kuk?q4K>K?!K?K?K? @O?k?Ky`7?q_4>K;KKu;Ks; k?Ku k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=64 k>4K=ak>K=i^ k>K>K=q K=yK=K=CCK=4xk>cC 4yk>ǃC 4 `_#ª^ 157J (@^ u5!e6 J?@R4K=Y ^ 56O _!7#7K>K>5_ 4^K>K>4t_%566? 6@ 4CC*cCZǃCq> #ǣCr@$"K>7@ P5J>M@$jK=Q`$ZK>_K>7_4z@7>p֟t&a&i8G&qFq _Y4:(#7P64ǣ@ 4@ `4 @47`4 4eK=Y^5zM7^5ZU7^5:]7^4%7^457^a45746K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>47@X5ycܥ@4\7@ 5Yǃq>4\7@59Eq>z?@ V47@5ǣr4V7@`4r4X77@4`47@4eK=Q]E56K>_K> 4 @K> @K> (K>J I K>K>_]4 0o4oAj6 o!:4  40 ! Ǐ@K>K>_=4 7k?^96Zk?K>76Yk?5k?k?yk?qk?ik?ak?Y_k?Q - K>6X_uK>5?575?~@6 M KuKs>  k?KuK?1K?)K?!K?K?K? @O?_@H_@H!$59@H4ܞ=@_u@m@_@C8X7? (7W6 ?7@6?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK>76K>7I4K>4 K> K>y ` @ :C_ 4 4 r4V_ b4X R5)A? 8 (@ ( _8 ?5)K:: _4K?IK?AK?9K?1K?)K?!K?K?K? @O?? crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)? crt0: errno: tsdUsage: %s [-A | --format=sysv | -B | --format=berkeley] [-o | --radix=8 | -d | --radix=10 | -h | --radix=16] [-V | --version] [--target=bfdname] [--help] [file...] default is --format=berkeley Report bugs to %s formatradixtargetversionhelpbinutils/opt/binutils/share/localeABVdfoxinvalid argument to --format: %sInvalid radix: %s size (core file invoked as %s) %*s (ex %s)%-*s %s : %-*s %*s %*s %s: %s: %s %s: %s %s: hppa2.0n-hp-hpux11.00can't set BFD default target to `%s': %s%s: Matching formats: %sSupported targets:%s: supported targets: %.12s %.4s%s %ld/%ld %6ld %s %s /%s: bad number: %s2.11.2GNU %s %s Copyright 1997, 98, 99, 2000, 2001 Free Software Foundation, Inc. This program is free software; you may redistribute it under the terms of the GNU General Public License. This program has absolutely no warranty. --%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument %s%sCannot allocate %lu bytes after allocating %lu bytes undocumented error #%d/opt/binutils/share/localemessages/.moCPOSIXLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_ALLLC_XXXLANGUAGELANG/locale.alias/opt/binutils/share/locale:.risoHt@xPX !!!!!!!!!!!!!!!!""""""%%(8()<)@)D)H)d)h))))))))***$*(*D*H*d*h****+t+x++++--. .$../h/1123445T5556 6@66677t7x779 9<9999::::;;;;<8d>h?(?,??@`@d@@CC DDDDFFGHG|PXP\Q@QDQdQR`RRRRSSSST THTdUUVV,VTVXVVWWLWWWWWWWXZTZXZZZ[^ ^^ ^``aaaaaaaaaaaaaaaabbbbbbc\c`eDeHeeef@g ghX htiHiLilin nnnnno(o,oooop@pDsL sPu uw8w<wwww{H   . /l / 2 *4 5X 6 6 6 7 9$ 9 ; << =D = ? @ F GL Qh Rd R| R S TL U V W W4 W W Z e h\ ip n n u @"$Revision: 92453-07 linker linker crt0.o B.11.06 981204 $/usr/lib/dld.slERROR: mmap failed for dldERROR: mmap failed for TSD} }(}0}8@}@@bug-binutils@gnu.orga.out%lu0%lo0x%lx%lu0%lo0x%lx text data bss oct hex filename text data bss dec hex filename %7lo %7lx %7lu %7lx sectionsizeaddrTotal@*@2@:stXXXXXXPOSIXLY_CORRECT:   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000@B@B`?H3R|ip6GdfZuuiih\..euiGL<<nZF/ei6(73(.=/u3Xf(V6WW4/3p3@325X;45p4=D769$9n@@@@/$0X0X;hbinutils/binutils-RUN/opt/binutils/bin/strings010075500000000000003000001200000732753200300203530ustar000300000000000000@@XXPP(G(z, ,@  92453-07B11.17;^ 92453-07B11.046g0@ X" A ALX DDtX!YYX xhxhX 8PPX H((X I((X X(((>(@`>(@<>( @P>(@h>(D@Dt>(&H@H >('(@(>((H@H>(P@D@>(R@dY z,? ,@ $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$y<C\/# <(H<<p(O0hů;A8v˚v)8['VL /v'6!xy!xD!xry 4'Pנu R`aDg6mTLL''̃!xT(24/g6OXk )kX\T !x )'6С8VYY&hŒ'/+ 4gyhM5]tfAZAqVɘ 0,>>a9 ƿ<>?A˚v8vhů;An bRY;tltD8rP.Y;2Y;Y;'j>a%-P`  "  p@v@}@@@@@U@U@U@ U@U@U@ U@,U@U@U(U(U U PU#@U)U&TPU0SU6OUFP0UVQ(Ud-UiNUrQU=UTU<UU!@U 6=CIQY`glsz #*3:AJPV]fkqv|8""/tmp/libtool-17658/strings/opt/binutils/lib/opt/binutils/lib/libbfd-2.11.2.sl/usr/lib/libm.2/usr/lib/libc.2_tepv_ktepverrno__ismt__dld_loc_hex_valueoptopt_SYSTEM_ID_CPU_REVISIONopterroptindoptarg_FPU_MODEL_end_environ$RECOVER_END$RECOVER_START$UNWIND_END$UNWIND_START$ARGV__text_startmallocfopenctimestrrchrsprintfstrcpystrcmpreadstrchr_startcalloctolower_isdigitfclosefgetsbsearchfprintfexitopenrealloc_isalphastrcatqsortstrncmpvfprintfstrcasecmpgetcwd__filbufgetenvsetlocalefstat_isspacestrlen__flsbufprintfmktemp_isprintfputsfputcperror_isalnumfreeclosesbrkabortmemcpystrerrorbfd_initbfd_get_section_contentsbfd_get_errorbfd_scan_vmabfd_check_formatbfd_openrbfd_errmsgbfd_closebfd_set_default_targetbfd_map_over_sectionsxstrerrorxexitobjalloc_create_objalloc_allocobjalloc_freemainhex_initobjalloc_free_blockfnmatchdcgettextconcat__d_trapstrings_a_sectionalias_compareerrno__ismt_ktepv_tepv__iob__SB_masksbfd_target_vector7!?9" : B*= @ Z ]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]` =@ :7]@ k? k?k?@@K?@ @Ku#/744445 bנZRke/qke/y (4Ц @Ц D(43 H?(ਃ 43 ` 7+4>7D7%7744z#(74444@H@7D7%7#)7444Kx/7D7%77Kv 24}74444#0-7@@@@ 7K?@ @@@@k?7k?#C0k? 7Yk?4@4 @@K?K?7@4K? *@K? K? 7@@4K? rKa?H:@7?!#074@4@x7?!7?!7@4##0794@4Ka?@ xH:K>@7? 44@B7?@B?7?B?@k?ok?7?"0'E' 860.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?ok)4`@44` G>- ""046_4K>9K>Qki *K>y4ߟ444K>IKa_k? k?54@844? 7 C04Y 7z0_4h4k?4K>a5k?4@44?"H74@4Kk>7t/Qk>Khk>v k>Ks/qk>7g/ak>y 4 c?K?7}/yk>Ka?43k? Ka?44k?֠ k?Ka?45k?7vxk?1+4<P! k?!k?)#07 4_47=)"06P4_4 G=-"067z0_4+"c06y7z0_U4 #049 7z0_%4 k?)Kpk?9k?A k?Ik?Q@k?QKqK>Akf@ k?q( k?4?k?(k?47Xk?k>  k>7uk?y7>7>444? 7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4!4! <4?@@k?7k?#C0k? 7YPk?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?!#07`4_-4@x7?!7?!7_4##079p4_4Ka?_H:K>@7? 44@B7?@B?7?B?@k?ok?7?"0'E' 8600.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?7Kvh+ H4?P444757K?Y@7?K?Yk?4?k?474_4$4?7 k|_M@eK?Y#077z1Q_U4-K?Y@@K?@ @Ku=Ks= k?Ku>Ks> k?Kuk>k>k>k>k>k>k>k>k>k>k> 07Ek?7&4_444A (5A 5HkzA 4 k`p4(k`h7w1k>4?4Pkzx44k>44ki`@k`P!p74*Ka?"04+64 45?4? kipKt;B#RKs;B#4ރ_#R4ȃ#R5z@@84Xk?5z@@4Kxcj X  / 4"?kbxk?K>44@LK>>7K}x4`ktx_}@@X@K;y@4)k``Ka?4k?449k?@ 444|K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>`B _4!k``Kx;y7k;yKa?40@4:@4|k``kih4@5z @Kz;}k|x44A 84 Ky;@7}k?kip]kn5z@@4Ks;%kn4 ko4 kKu;kuP@4k?5?k|xKs;y @404Kx;y #C@@K?@ @Ku>Ks> k?Ku>qKs>y k?Ku>Ks> k?k?ok? K4 4 k?7# k?@v(6@HdHk?A4k?!K?44y_7 Jk?K?!4kXHx44k?@K?_K?!K>K? @O?_@̂k?Ku?!Ks?) k?Ku?aKs?i k?Ku?AKs?I k?Ku?Ks? k?k?oKyP_k? 7K?Y4@O?k`XKy1K?_4z_4z h@K?YK|X@O?4_4z?w+`_4zˀEK?Y@ K?ˀ%K?YKu;Ks; k?KuQKs>Y k?k?ok? K` k?_@ c0K?_4y 7K?_4y7 rk?K?44k?@4_4 j4K>K? @O?KxKa?4:@_e4y _K?ˀK>KxKa?4:@_4y _=K?ˀ]K>Ku=Ks= k?Ku>Ks>  k?Ku=Ks= k?Ku>!Ks>) k?Ku>1Ks>9 k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?yKrx7k>64%K>k?@6ZK>K>Ka?4+K>K>Ka?74,4 !0_6"@@4?4qI$@4c 02"I 6X?i _e:I(7i(M6_4 AKyx4 @4q!@4?4ҒI"4c \ R?m@  Kvx6_m@Kzh @K?_=5 K}p"JK""!"*50_69   JI?7?ah <IW6iYB_>IK>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O? JI66?a8 4I6iB?6@7? 7?W C]ӽ@7Z_7?14  @ ~7?14ċ?5@= )k?"04k? 6`@44 K?k?7@K? K?KuKs> k?Ku?1Ks?9 k?k?o_7C_7Ka?7 @4:@k?#0Kx7P_]4w(K>##0Kx_-79pK>@O?Ku=aKs=i k?k?7Kxk?#C0Ka?k?7Y4:@_k?K?K?_]K?Ka?H9@78?`Hh8@Ka?H?H7h7H4K?Y@7?K?_4K?Yk?77_k?17?9k?)k?!_k?9@,4K?Y@7?Ku?QKs?Y k?k?7#07_k? @K?Y@7?"046@L4 k?_e7K?k?_u7K?K?_7eK?Yk?ok? k?7D c0 Hk?!44y `@4 K?!_7HKa?44y @<4 K?!7_4Ka?H?K4 P4% K84y P4_%K?!H ?@K?!_ 4y K>K?K? @O?k?oKx;Q7Y c0_4z 44y @4 _744y 0@4 _e7_4K?Y@O?@P@K?@ @Ku=Ks= k?k?ok?k?7?1k?1k?)k?!!0k?944@ @ K?9 7B *7?6`Hw bB *7`?64c?`Hw?@K?YK?K?@O?_E4eԠH>7_4?ԠH@? u4@ @K?@ @k?ok? k?k?k?!k?)CB77$#7W7x5A444Z44^4\` _#Z J4~V#4T%jc@ V#"ςpK>@%`߿ ($% @?%B60B4 6046B64A`_ (@B6` @%4%Bc6 `$] jB ZB`_ (6B6 $` B6cĂ B6 ( r4~4^4T @!# @#B6 ( E84!4ˀK>قb :@$B@6 86b?@ ZςK>@ @Bc6 c@ "B4@<]6@#Zǃ 4^#R4K>K?)K?!K?K?K? @O?@!R`!R`߿ (7$ "`/B@??BςUK>6?k?1`_ (@B@7y5A`&  @7g5A4 `  *4xK?1__%4 4@?@ςeK>ςUK>ςEK>ς5K>ǣoB@4\ςK>ˀK>ςK>ς}K>ςmK>ς]K>ςMK>7@*c  @7%|@b:/4AςK>ˀK>ˀK>CW 07\ *7C?@4@k?ok?k?4?KwKxKy;y h x W W  araX4 P6? D X Ҥ `6 e4c_7`@ V   ֠ 476 m7 ` aH4P6? X ҃7 @67 D_4B`@ X  v 7ր 4\6 m7 7@ } Ku;yKa5kuK| kbK?YK?K?@O?Ku=Ks= k?k?ok?4$k`Ky;yky77z2_}kyk|@4Z 4bHkz4V b(k`0k`0k}4|K?YK?@O?Ku=QKs=Y k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K>4'k`;K;y7Hk?K>7$7k? 6 4%Kt;q J4 0kj;y45_474k|;qK 4#C!0@K;yKm hkKn hkKo%KbKwW%% @_4K;y 8kkhkh;yK;y& B4ZU&B&6 (4 0Z4 kv #*K};y 4 ZB :K?"B _]4"KmA4 44 84 ?4z "5A ?5I:4!51Ky_ - BKJ:_ e !Z@0 6*61 J:@?}6*ku;y 6 kp;kjAW 24z "5JAW ?5JI:* 4 Ky_ * BKwI:_ M )`05+5) I:@?}5 6 46* #:@#K?@&Kq;y B &rKrB__4&BKa49ky4@+j_M5YKC@0Ka;y4,@0kl;y&4 t&C4= C4vS'"C,C+C+k;Ku;y6 kj;y (kK;y@z C4Z C J7`8k;y C?7C ?7k:K;y"0 _ Y6 `:WK;yKs;y6k;yKwKx ( 8_4khKKw (k;y̟4Km0̟7kr;y 4hkq;Kh;i BK|;yKa? C0 H4:@4Y p_ @_-KzKd k}k`;aKd;y44~kp;yKv;y6k;yA! IW 50kf;Km;i !7? CKa?l 84:@#0HIW_7 @@IWk? #049 CH__KzKb ksICkc;ah4~ "@7kb;y kh;_UKzKeK? k}K? I_ID  44Kz;i :7?Ka? H"04:@_Y6 p_}KzKx kxIZkz;a@0tt4~4Kq;i Kl;y Ka?4:@C 2"0HKw_6 @+Krk?"06CH_9k`;aK;y7kz;y7e3ke4~Kg;i zKqKa? 84:@!0H5@_5W(+!0H5_i5Wkj;aX4~C4 44 04 k;K|;y7kj;y_=kjK;y57Kp;i 8@Ka?"0H4:@6_5Wkj;a@ 8t4~`4545+ +Kf;i :Kv;yKa?"c0 H4:@_ 6y_KzKa ku4~Kr;y6Yky;y "AS I 5Iki;Ke;i 8@Ka?##0HIw4:@_ 79`_ KzKx ki4~ 0@K;yA*7ka;y kj;_KzKd ksK? K? @ -IId  44K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ko;i :7?Ka? H#04:@_ 7 p_1KzKn kl@0tt4~4k`4k`;k` "k;Kt;y6ki;yK;y Ky;i 8@Ka?!0H4:@5_ 5Wkj;a@ 8 t4 ~k`d7kn;y km;k?7K?k?_ Ek?K?Y@7?@ @K?@ @7F44_774666x77Y7!4=74 44477w4474 b6b:b8b<b>b@@6 @P@K?@ @Ku;Ks; k?k?o_4 (744|K?Y@O?_m4 | 274  w_14z`u4|@ @K?@ @k?ok?k?k?4@4744z  | f7C 04Hw7$Ԁ2_4?gHy@7HsHz d  thu7K?YK?K?K?@O?_e4 7Hv7H}m |@ @K?@ @k?ok?7CKZ@ ^KD?4^4zK?YK?@O?@ @K?@ @k?ok? k?k?k?!k?)KE7C7$ 4H 44H?H H!2Hz 4KH r F84^M@54?}@]H^5@]HK_^@507G5?/KH d04 g4 sHHz ^5KE?4 dH @HH@?@ g4 vK>K?)K?!K?K?K? @O?@ @K?@ @k?7Kv k?7_ K?K?Y@7?Ku>Ks> k?k?7K; kz;_4k|;K?Y@7?k?oKs; (7C_E4Kz; \_47}/ k?Kx;Ka?k?C4:@ 7w3!##02@7w31^79_54K>@O?k?ok?7C@04_ 4z 7_4z4K?YK?@O?@@K?@ @Ku>Ks> k?KuKs> k?k?ok? k?k?k?!7D@"7%@"Kc @4&Hy^U4 bHc`?Hy" ZHy^4#j(4$4^4 āHz_}4"@7_ 47_E4 |"74_=4(4'4^4 g_ 47_4!`744_4Hz @^u@ f_ 47_4 | 74_4K (@K^ 4@@K 0kcˀ0K>`u@ (4<H|ˀK>ˀK>ˀK>ˀK>KeH jK^ 4`H@HH (@K^ 4_@H x H|K>K?!K?K?K? @O? _ : W ]  SV@ \CT x4@ӿ< 77Z<  @?@@Ku=Ks= k?Kuhe>hf>hg>hh>hi>hj>hk>hl>hm>hn>Ka?H&7$7H7 %4%0Kh;Kj %IY^ 5 eIJ@?IY@%zIG@4^"!@_475s4 K?K?g~4` k?k?77h_5 @H4 D 4`5@ K?K?~  k?k?77h_-5 H?w5@$4_4!d5y@ 07IY@ 7@ 5:75:@ 77_5z7_5 5 K?K?~4`  k?k?5y7@ @7!d5y@ 77@ 55y@ 7_5:7K?K?~4`  k?k?A774 tp4 `55775)76 7,?5y^5!5y^5!45@ H5X 75@4!I  @5 @x4!X@ ?5!2A7 ("5)A7 ?5)>E@  ˀ84~4 !M5h44~Hb>YHn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>˄}hmhk?ok? k?k?k?!k?)KG7C k?1@4zHc`#Hh( H0"jHf$4HsHw d Hg$XH: G^K?1DRĄX@H}7G? ܋ #D!HHt( Hu0 刀 6# @#*Hx7G? Ջ#D?Ht(Hh  Hh#Jz H^K?1?-HHa Hy' Hc "Hx C HwH Hh!J H^K?1>HHb H}G Hc!H C ^K?1K?1_7Hs(76yMHt76y?Hb0%7 E 7@=Hyˀ8K>Hx Hc!H CK>K?)K?!K?K?K? @O?ˀK>_@\E@_@\@_@\ H _@\E@_@\Hˀ K>_m@\H_M@\ H _-@\@_ @\ G @4ś7 Ş'H| ˀMK>_@\% C L҇L HzH ZD:D  "@6 #@7@#$@7<`#D@7\#@7"d@6|#@7"@6k?o dk?_ )4z C @_4zЀ C `@_K? C 0@_4z C04|K?Y@O?C8X7? (7W6 ?7@6?k?ok? k?k?@ 7E@ 8Kc;(4$4^4 @(4$`kd;^47_k?! 7K?!4_ 4kf; ^e4zK|;K>K?K?K? @O?k?ok>k>k>7#7^k>k?K>4k?7z7k>k?k?k?yk?qk?ik?ak?Y@k?Q!7@ @4z X7^U47_4"`74z4_4k?Y7?7? k?7?7?!k?7?7>k?7>7>k?y4z@k?K>^u7K>k?47k?QK>4k?K?k?K? k?K>k?yK?k?qK?k?iK?!k?aK>@K>! 7Ƞ4H @@4H H 4 `4 KX @@ J 4c ? ``4@44K>YK>K>K>@O>H @@4H jH  X4 K_ @x@ K:@  ?4?4^4z4 _ : W ]  SV@ \Ku=Ks=  k?Ku=Ks= k?KuKs> k?k?ok> k>k>k>!7D4@KZ@" _4"p77>_4 K>48bb@_yK>7" K>4g44_4!@ _ _4H B4% # 7 *!_48 !H7 H(4 !hHz"H!hHz H!hHzH C   !`Hz H C h !XHz(h(H!XHz0 Ch0Kg;40kw;_4K=_4K=K>!K>K>K> @O>^14zK=_@\}@_u@\ _U@\H_5@\H_@\h(_@\ C ^Q4z^A4 Kuk?q4K>K?!K?K?K? @O?k?Ky7?q_4>K;KKu k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=64 k>4K=ak>K=i^k>K>K=q K=yK=K=CCK=4xk>cC 4yk>ǃC 4 `_#ª^Y57J (@]5!e6 J?@R4K=Y ^56O _Q7#7K>K>5_ A4^K>K>4t_%566? 6@ 4CC*cCZǃCq> #ǣCr@$"K>7@ P5J>M@$jK=Q`$ZK>_K>7_4z@7>p֟t&a&i8G&qFq _4:(#7P64ǣ@ 4@ `4 @47`4 4eK=Y^)5zM7^ 5ZU7^5:]7^4%7^457^45746K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>47@X5ycܥ@4\7@ 5Yǃq>4\7@59Eq>z?@ V47@5ǣr4V7@`4r4X77@4`47@4eK=Q]56K>_K> 4 @K> @K> (K>J I K>K>_]4 0o4oAj6 o!:4  40 ! Ǐ@K>K>_=4 7k?^a6Zk?K>76Yk?5k?k?yk?qk?ik?ak?Y_k?Q - K>6X_uK>5?575?~@6 M KuaKs>i k?Ku=!Ks=) k?KuK?1K?)K?!K?K?K? @O?_@H_@H!$59@H4ܞ=@_u@m@_@C8X7? (7W6 ?7@6?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK>76K>7I4K>4 K> K>y ` @ :C_ 4 4 r4V_ b4X R5)A? 8 (@ ( _8 ?5)K:: _4K?IK?AK?9K?1K?)K?!K?K?K? @O?? crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)? crt0: errno: tsd/ // / / / / / / / / / / / / / / / / / / / 0/ / / / / / / / / / / / 04/ / / / 0</ 0D/ / / / / 0P0/ / / / ./ 0allprint-file-namebytesradixtargethelpversionbinutils/opt/binutils/share/localeafn:ot:v0123456789invalid number %sstrings{standard input}-rbr%s: %7lo %7ld %7lx invalid integer argument %sUsage: %s [-afov] [-n min-len] [-min-len] [-t {o,x,d}] [-] [--all] [--print-file-name] [--bytes=min-len] [--radix={o,x,d}] [--target=bfdname] [--help] [--version] file... Report bugs to %s %s: %s: %s %s: %s %s: hppa2.0n-hp-hpux11.00can't set BFD default target to `%s': %s%s: Matching formats: %sSupported targets:%s: supported targets: %.12s %.4s%s %ld/%ld %6ld %s %s /%s: bad number: %s2.11.2GNU %s %s Copyright 1997, 98, 99, 2000, 2001 Free Software Foundation, Inc. This program is free software; you may redistribute it under the terms of the GNU General Public License. This program has absolutely no warranty. --%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument %s%sCannot allocate %lu bytes after allocating %lu bytes undocumented error #%d/opt/binutils/share/localemessages/.moCPOSIXLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_ALLLC_XXXLANGUAGELANG/locale.alias/opt/binutils/share/locale:.risoDp@tPX      !!!!!!#$'8'(4(8(<(@(\(`(|(((((((())) )<)@)\)`)|)))*l*p*|***,,---|-/ /1  1p22 22|22223 3p334@46677889 9(99:4:P::::; ;(;P;T;;<\<`<<===>@T@XAABBCDDDMMNtNxNNOOOOP,PHPPQ$Q@Q|QRSSDS`SSTT TLTTTTU U$U(U@U\WWWWXXL[ [[ [^^^^^___ ___ _$_,_0_8_<_D_H_P_T___```bbbcc(ce e e efffgk0 k4kkkklDlHlllmm\m`ph plr stTtXttttxd   - - 1 1( 2 3 4D 9 9 :8 ; < < = D D N O O P0 Q( Q S SH TP Th T UD X c, e f k k r @$Revision: 92453-07 linker linker crt0.o B.11.06 981204 $/usr/lib/dld.slERROR: mmap failed for dldERROR: mmap failed for TSDbug-binutils@gnu.org@z0az8fzHnzPtzXTz`hzhvstXXXXXXPOSIXLY_CORRECT:   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000@"@"}8?` O3-c\X4rr3(fe3@9c,rfD:8kX4tD-cDf4D4\443Xr1@ctSH1XUDTh-1(92d292L;241k@@@@-/H9 binutils/binutils-RUN/opt/binutils/bin/strip010075500000000000003000010000000732753201500200240ustar000300000000000000@?@8XxxP((((GCP(+@?  92453-07B11.17;^  92453-07B11.046g0@  X"((LX 88tX!??X!??X &j&jX 8H40H40X HxxX IʐʐX Xʐʐ(>(@`>(@<>( @P>( X@ Xh>(`@0`t>(&0@10 >('0@70>((@7>(P@8@\@>(R@8dY ? +@ $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$y </#|=d'!0 <p(Ohů;A8v˚vbR b . b )٫JȀP8[XDgkR'i0HVL "f/v'6!xy!xD!xry 4'APנu R`aDg6mTL,שL'R'̃!xT/}(24!x݌/!xg6OXkQ0k\T/X\T !x/P )'6Y//]]! '/!x\T/Bj+ 4gyh!xng@M5]E Yœ03tftfpr͈ S)Lr*rZAYZA5axU)qVlGɘɘwqS 0| oN)bX,ҸW[\ip>>a9' ƿU{mo2geدH<9j%y{t57A$=;>t0;_u~klhSOŗ.l9Ҁ;ahslN;\wpan[Nz Gf^<,$"dsxُZD geX}|BK(.Z~_Wd8EjUjKCJ|+V 6YUD,_J9 ,A3׻8fC1Y+ulklh ]L./"æC  '@Bp{`wgx!$0bPDd}2Y|BQ4݀C.k~_M6/RpqR)J)rzȶVB6YO"d{?A˚v8vhů;An bRY;tltD8rP.Y;2Y;Y;'bXs,2K[\ip>j>a% '/Rb  "  r@:x@:@:@:@:@9@0U@U@U@0U@0U@0U@ U@;U@U@UʐUʐU xU HU%@U+U!U+U1dUAUQU_UdhUmLUUUCU?U!@4U         +8>EKQXagmsz  '/5<DKT_fov| %.5<EXm|'5IVj"<Oax0Eas)9GXiy  & @ a w   4 E T f r   ! 3 F Z j z ! : O g   ' ; I ] u $x$|$$$$$$$ $$%(% ,%0%4%"8%*<%2@%:D%BH%JL%RP%ZT%bX%j\%r`%zd%h%l%p%t%x%|%%%%%%%%%%&& &&&"&*&2&:&B&J&R&Z&b&j&r&z&&&&&&&&&&&&&&& &'' '' '"$'*('2,':0'B4'J8'R<'Z@'bD'jH'rL'zP'T'X'\'`'d'h'l' X' \'/tmp/libtool-17907/strip-new/opt/binutils/lib/opt/binutils/lib/libbfd-2.11.2.sl/usr/lib/libm.2/usr/lib/libc.2_tepv_ktepverrno__ismt__dld_loc_hex_valueoptopt_SYSTEM_ID_CPU_REVISIONopterroptindoptarg_FPU_MODEL_end_environ$RECOVER_END$RECOVER_START$UNWIND_END$UNWIND_START$ARGV__text_startfreadmemcmputimemkdirmalloc_isupperwritefopenctimerenamestrrchrsprintfstrcpystrcmpreadstrchr_startcallocstrncasecmpchowntolower_isdigitfclosefgetsbsearchfprintfexitopenunlinkreallocrmdir_isalphachmodstrcatstrncpyqsortstrtolstrncmpstrdupvfprintfstrcasecmpgetcwd_islowergetenvlstatsetlocalestrtoulfstat_isspacestrlenstrncat__flsbufprintfmktempfputcstrpbrkatoiatof__assertsscanf_isalnumfreestrstrstatstrcspnclosesbrkabortmemcpystrerrorstrspnmemsetbfd_initbfd_is_local_labelbfd_set_section_sizebfd_set_formatbfd_get_stab_namebfd_hash_traversebfd_set_section_contentsbfd_get_section_contentsbfd_hash_lookupbfd_hash_newfuncbfd_get_machbfd_printable_arch_machbfd_set_symtabbfd_get_errorbfd_decode_symclassbfd_scan_vmabfd_hash_table_initbfd_check_format_matchesbfd_set_relocbfd_get_archbfd_check_formatbfd_get_section_by_namebfd_openwbfd_openrbfd_coff_get_symentbfd_coff_get_auxentbfd_hash_table_freebfd_errmsgbfd_get_reloc_upper_boundbfd_set_file_flagsbfd_hash_allocatebfd_canonicalize_relocbfd_set_start_addressbfd_closebfd_openr_next_archived_filebfd_set_section_flagsbfd_make_section_anywaybfd_set_default_targetbfd_map_over_sectionsbfd_make_sectionxstrerrorxexitobjalloc_create_objalloc_allocobjalloc_freemainhex_initobjalloc_free_blockfnmatchdcgettextconcat__d_trapsetup_sectionget_sectionscompare_section_lmamark_symbols_used_in_relocationscopy_sectionieee_name_type_newfuncieee_write_undefined_tagieee_add_bb11_blocksieee_start_compilation_unitieee_start_sourceieee_empty_typeieee_void_typeieee_int_typeieee_float_typeieee_complex_typeieee_bool_typeieee_enum_typeieee_pointer_typeieee_function_typeieee_reference_typeieee_range_typeieee_array_typeieee_set_typeieee_offset_typeieee_method_typeieee_const_typeieee_volatile_typeieee_start_struct_typeieee_struct_fieldieee_end_struct_typeieee_start_class_typeieee_class_static_memberieee_class_baseclassieee_class_start_methodieee_class_method_variantieee_class_static_method_variantieee_class_end_methodieee_end_class_typeieee_typedef_typeieee_tag_typeieee_typdefieee_tagieee_int_constantieee_float_constantieee_typed_constantieee_variableieee_start_functionieee_function_parameterieee_start_blockieee_end_blockieee_end_functionieee_linenostring_hash_newfuncstab_start_compilation_unitstab_start_sourcestab_empty_typestab_void_typestab_int_typestab_float_typestab_complex_typestab_bool_typestab_enum_typestab_pointer_typestab_function_typestab_reference_typestab_range_typestab_array_typestab_set_typestab_offset_typestab_method_typestab_const_typestab_volatile_typestab_start_struct_typestab_struct_fieldstab_end_struct_typestab_start_class_typestab_class_static_memberstab_class_baseclassstab_class_start_methodstab_class_method_variantstab_class_static_method_variantstab_class_end_methodstab_end_class_typestab_typedef_typestab_tag_typestab_typdefstab_tagstab_int_constantstab_float_constantstab_typed_constantstab_variablestab_start_functionstab_function_parameterstab_start_blockstab_end_blockstab_end_functionstab_linenoalias_compareerrno__ismt_ktepv_tepvbfd_und_sectionbfd_com_sectionbfd_abs_section__iobChunkS3Forced__SB_masksbfd_target_vector7!?9" 7]!9ӽ9Y4!:ӽ9Y4T ;|ӽd Y"ӽ9"ӽ@>B! @ Z A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  a@@@ @7]]@]2@@ @] @@ @@ @ @*@ :7!?9" : B*= @ Z ]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]` =@ :7]@ k? k?k?XZ]XZ]XZ]XZ]d@"Z]> ZZ]> ZZ]9 Z8 =@Y :Z @Z@ ZZZ] ZZ @"ZY :ZZ@= ZZZ@= Z ZY :Z]ya: =]: =]  : =@4ZBu ZZZZ ZZ]ya: =]: =]  : = @4ZB ZZZM ZZY :}@4Be]yZZ5@*Z@ya AZ@ya AZ]ya A @Z@] Z]: =] y a: =4Y(ZYY8Z@] Z]: =] y a: =4Y(Z YY8Z]Y Z @*Z@YA AZ@YA AZ]YA A @ ZZmZ@@K?@ @Ku3QKs3Y k?#a87{7 +~h#+~h8 'y 4yEe'y 7D7%767+4>#"@744445 rנjb+~h%+~h% (4Ц @Ц D(43 H?(ਃ 43 ` 7+4>7D7%7744z#*74444@H@7D7%7#, 7444+~H8 7D7%77Kv؆ 24]74444#0/7@@@@ 7K?@ @@@@k?7k?#Yk? 7Y k?4@4 @@K?K?7@4K? *@K? K? 7@4K? rKa?H:@7?!#7 04@04@x7?!7?!7@4#979 @4@4Ka?@ H:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 86 0.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?ok)4`@44` G>- ""46 _4K>9K>Qk<+~H<K>i *K>y4ߟ444K>IKa_k? k?54@p44? 7+~ Y4YP4:p_4h4k?4K>a5k?4@44?"p74@ 4K+~k>44k>Kk>v k>+~H3k>+~4'k>y 4 c?+~K?4=k>Ka?43k? Ka?44k?֠ k?Ka?45k?7vk?1+~4<!0k?!(k?)#7 P4_47=)"6 4_4G=-+~"604:p_M4_+~"y6y@4:p_4 949P+~4:p_4] k?)Kk?9k?A k?Ik?Q@k?QKqK>Akf k?q( k?4?k?(k?47(k?k>  k>7uk?y7>7>444?U7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4!4! <4?@@k?7k?#Yk? 7Yk?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?!#74_-4@x7?!7?!7_4#9794_4Ka?_H:K>@7? 44@B7?@B?7?B?@k?ok?7?"'E' 86`0.&40N 1N 7?9AE'E1!881N 0N 9!F'F9AE881N 1$N 1A'1a0 0 1$N 1DN9aJ'J2 9@9@2N1dN2 ' 8G1@' X1@ 2N1dN 2 ' 8G 'V1@ 9G4`1dN9%G'X:E1@ 'E887A`1dN'W3N:Et"1DN 8K7C`0 'E18 V!9eG1!6`8:G' F9eG1DN 1$N  'G9aH9GS9G' H9AE4` 'E'G'F6 # 4W`7=$ |6`6`= 37`!/K?YK?@O?k?7Kv+~ H4?44477K?Y@7?K?Yk?4?k?474_4$4?7 k|_M@eK?Y#+~74:_M4%K?YKu3Ks3 k?Ku3Ks3 k?k?ok?7# k?44pU |4 KxK?_5744U <4 K?_744U 4 K?_7KzOK?` J#47-!U4 +~K?480_U7_u4zK?YK?@O?k?ok?7# k?44-QU4 KxK?_7#47U4 K?_u744-U|4 K?_=7KzOLK?` B44-!U$4 +~K?48`_7_4zK?YK?@O?Ku3AKs3I k?Ku3qKs3y k?Ku5aKs5i k?Ku4qKs4y k?k?ok? k?k?k?!7F4 4X_4 74464_4 ?44|K>K?!K?K?K? @O?4_]4!?_e4=46464_4 -?464_4 _464_4 464_]4 464_%4 M464_4 474_4 474_}4=47!_S 44774_}7 k?14447AUt4 7O4447U<4 +~49O74Ku3!Ks3) k?k?ok?k?Kc7D` @7%Hz_}4 (@Hc`?@ 244|K?YK?K?@O?S 04X7k k(k8k0k@kHkPKMk|k?ok?7D7#S4H |K?YK?@O?Ku6AKs6I k?Ku2Ks2 k?Ku2QKs2Y k?Ku3Ks3 k?Ku6Ks6 k?k?ok> k>k>k>!k>Ak>I_7>cK>#h@S7"K>A7_67Ⴠ#7K>44z_4 @DW: 448!U4 K>AO7_U4K>z 4 K>7= `@"044F4@4 J@? #B# 04?4@( "4c@(0@x(0p4 0J7C7(0  ?7 0jC7( *6B(0@B !ڀK>I_4z4@v=4K=K>!K>K>K> @O>"467U4 Ka?H:7_u7K>A4O7K> 447Up4 Ka?H:7_7K>A4O7K> @04✍@ @04]@k>1#478QU4 K>1k>174OK>AK>1k?o7# @k?Hy_K? 8@Hc`?@4K?Y@O?ςK?Yk?7K4 7?P+`Kw! 0KzD K}0 @Kw @Kx K_4K 0@K h@Ks  ZK J4K?Y@7?ςK?YˀK?YςK?YςK?YKu3Ks3 k?Ku7Ks7 k?Ku6Ks6 k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?y7CKZp4k?K> ]i04 7$64F4Ka?4*4+4,4 4 Ka0I I@P6 7Kb0 zHsHB0B0 R B_ : 6 _6 6PKr0 j _ I _ K 2HxC0B 8 Kw 4@!*$:PI _ u6R7HB077HxC0 >@_M6 Q@**I K3JtJҠ_B - 4Ky0_6>@4Ky0_u6>@4I _4z!@4_m5 BUKy0 _ "I _ K 8@K 4@?@Ky0ǑXK 4 4@@Kr0R04w 4?]@K 4?5@ 4?@4z_%504߂@! JKu0 Ky0_U6 Iנ?׿i - @Ky0_6 0@Ky0ɀ @@_6 "I4>"iK?  /44Z7 K? 4K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?k?ok?Kd0 @7CH_ 4z @@H?@4|K?YK?@O?HKu4Ks4 k?k?ok?7d0Hk?` hk?Hy_ K? @Hy_ K? 4dHc`?HyR4K?_7 |_K? ` | K?YK?@O?#478U 4 +~K?49 O7Hy"469U p4 +~K?49@O074dKu1AK=  73844CY7ZKx19  @Ku19Jv66Kt1A76e67@v@}Ku7Ks7  k?Ku5Ks5 k?Ku91Ks99 k?Ku7Ks7 k?Ku71Ks79 k?Ku6Ks6 k?Ku7Ks7 k?Ku8Ks8 k?Ku8Ks8 k?Ku8Ks8 k?Ku8Ks8  k?Ku7qKs7y k?Ku6!Ks6) k?Ku9AKs9I k?Ku6Ks6 k?Ku9Ks9  k?Ku4Ks4 k?Ku7Ks7 k?Ku6Ks6 k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>YKT7E7$K.J44I 4 -H`_4-Ku p4)#479U4 HI7k?HK8H_5HK1!%4#K  Kvx v 蘀74 HHV4u7n7R @k|1Q47k|1IHIv7k>ɋn7Ky0 @Ky1QA047K ڇ! Kz K}0 Ks0و Kt0ш Ku0Ɉ zKv0 jK| ZKa JKw0 :Kb0 *Kk0 Kl0 Km0 (@+~H9Kx1Q_4K>7R  k|1IK>44k?Kw1Q_ 7k>Ka0 @027>7w1I4@ 5Y,@Ky1IK>_M4+~H94_4Kip 0R4I:k?4I9(_I8 ,I) ?4Kv1 K|1!*" (5(R D5Cy1 57_7H`@4 C(7Kx@KH h  ,.5k? 45X_5+*  ? 5h_=@HH6P447* Z44Y;AU4 _}7_7H4N74 hkg11HK}1) _m4'P@HKM 4Hp_] '@HK*X_]47_u45y75V457&@H`_ 4'H@Kz1Q @_@Kz1IKs1Qz @_@+~H94_4Kjp !4 IY_4i\(&7IX_4'@IZ_a4 (7 IH IP?4IY(_m4& I( BI0IA(h=8IB(h]0IU(B(ןb(I8 IS( I@ j}8 IZ( K\` k\`IJ@>_IYKw1 @Kx164 H R5zk?+~H977?_4+~H744_5YR\5z745x_7Kt1!5L? !x4 K _C(-D@KH 5t K88KW8  B  _4 B  55k%@Ku1!45:T4 K_7_755yN74 kl11Ku14w4 5J? C(7CHK8KHKx '4 _=43Kx#:479;T4 IJ_e7_75z5YN74]ks11 449qT4 N7K=NTH4ke11N,H4kx11!45:T4 74_757_ 455Z_ 75Nd7H`N TH4kw11 44:T4 _ u7_ 7IY4N74`k11N H48kn11N H4 km11_ @U _@✭KxN H4 kl11N H4 kk114 hkj11N H4 @ki11_=@u@N lH4kh11K=K>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>Ku2Ks2 k?Ku8Ks8 k?Ku81Ks89 k?Ku8Ks8 k?Ku8Ks8 k?Ku8AKs8I k?Ku4Ks4 k?Ku41Ks49 k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>a7$7CK:k>qN7%k>y4_7#Hth4_4zKs1174`00X4&+~4)4*4 4IK>yN59`K>q7_U7Kx7 @4IK67>57"`74R @77"pHy`_u4"4_5 5_ 5_5 @NIkk11Kw 7>A5K>q_e5 4z5 _u75 7_5Kz11@ =4 _4!@NH4k|11"46;T 4 Ka?H:7_7K>y5N7Ht#47;T4 IN7]4N54kb11K=K>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>N$H4eka11_4z (@NHz4kv11 8@_}H_HH?@_K>yK=Ku7Ks7 k?k?ok? 6k?k?_7 @7NK?4k}11K>K? @O?4_-4z 0Ht0JK?_4 (7N$K?4Uk114z_45K>7?4_m4z!0Hs0JdK?_4 (k?!NdK?4kw114z_7_K?! (@NK?45kx11_4z>@NK?4ky11NK?_@ @NK?_K?4kz11@P@K?@ @Ku9Ks9 k?k?ok? k?k?k?!K6 7#7DH7K% 0Kt%zKu0%jHz_474 Kb@ 0 H%Kz $H $Hy_4 7 44<1T4 ȼ4Ky1@( ? h8`(h0"H8Ks1 h8Hx`h`"`Hx HH@(?@H}HKx1A@ @Ky19 = 7Z?44_97 44]H0H( BH0@( h8`(h0HH8=+@(H0h8`(h0H8H8=+>@H@ h8Hx`h`Hx HH4 HP ?X4_q4 r 44K?!K?K?K? @O?@@K?@ @Ku8Ks8 k?Ku7Ks7 k?Ku8Ks8 k?Ku7AKs7I k?k?ok>k>k>k>k>k>k>k>k>k>7&Ky117E7 %4#H H@K$ғ 0KzD$K}0$H_Y4Kh7 0H`$H@Ki $*H $@(-CHXHHk?Y7 04_u4ch7 !444_e5HHH#bHH#RHPBR K?Yk>K?Y4_a7K?Yk?44K>_5#@NH4ka11R`5zKw1Q744_u7b07KzH @R5zk> `4 5+7 `KJK_)Ky0ـ @ ` 5J5_5k_5:K>5M04 4558_5HHh@@(H ݍ`(RK?YK?Yk?7444_7!@NH4pkv11_!@4œ]k?YNHH4 kb11N H4ku11K>YK>K>K>K>K>K>K>K>K>K>@O>Kw1A@7?Y_4K?Yk?445_Y4 (@N(H4k|11_4K>Y_qK>K>Y@ @K?@ @KK6@@ @K?@ @K_K7K J @B@"K8J8B@4@4? _K8@4 @4?KHJH @4 4@@ @K?@ @k?ok? K#X7$k?)`# k?1_e4c 7"@RP7K?)K?174_e7b7bp4Ka?4?KKa?xP6x?H947Ka? } JK T(4"7_@a} 6JHS S( 38:H5u (@JuֿjuJKJ|K S( 38:H4t (@Jt֟jtJKHJ S( 382H"S "Jz_jzJKHUJ S( 382H<| "Jy?jyJK~E7 ` @_A4zK>K? @O?K?)H:N 8k?K?K?)HZN k?ˠeK?H5k?! (Jԟ (j (J (K 7k?ok? k?k?KV7CJ 0 Z44Y=T4 HuJ7NHy4K>K?K?K? @O?I 4zK>7?ik?7?yk?7?a7?qL4z ˀeK> 4=_ 4z74=_ 4z7 0K?q4z_ 4 @K?y4z_ 4 z4h`"h`6 4zk?!_ 4 (@K?!4z_ Y4 j44=1T4 _ q7_ 7Hy4N 7ˀK>K?qk?44zK?a_4 :K?yk?44zK?i_Y4 j44=T4 _7_7Hy4N 7ˀK>ςK>k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=+~47 k? 4>ak> 7H7'Q|k>444 !4Ka?4*4+4,#4-744444? $"4k`11 54_4wKz11#@Ky 7>@5 @ Kx@l5kl114^5Z 5Z@^4k?K>54Q K> >@ @N4>Kv 84)K| @Ka04 0kbKl1ɐ`04  *5`Ka?4:@^4b@4*Ka?4+ Kt=Kl11 ^m7>}@44>TP4 Iz^7 5Np7@ Kf1Kc1Kc1Ýk?Kz1^ 4kokrkqkpKz1^ 7y0ek?Kz1^ 7y0=k?%Kd1kokqkoko"k?k?N X ɼk`11_!5 @_Y5]44K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=Ku5Ks5 k?Ku3Ks3  k?k?ok;k;k;k;k;k;k;k;k;k;k;k;k;k;k;+~ zk?474x>k4y_644ySl4 Cx1 7M6?Ȁk?Kz1Mt4y kg1k|x}kg044yS4 +~490M7Ka144yS4 +~49PML7K|1Kz1M4y@kg1!k|Kz1Md4y`Ka?}h<Ka?eh'Kz1^7y0Ek?Kz1^q7y0k?Kz1^I7y0k?Kz1^!7y0k?Kz1^7y0k?k?44yS4 M7+44yS4 Ka?H:^)76Z7ML5K04k1aKy1a K?_4y+_4yK|11K?YK?@O?Ku4Ks4  k?Ku31Ks39 k?Ku2Ks2 k?Ku6aKs6i k?k?o7?(a4>hdhehfhg 7%_4a744_4`7+4'?44_@X744_4 44_M_7Ka?H'_}4_m4`ˀHb?ϟHb?Ka?H%_%4Ka?ϟHh%Ka?H&_4_4Ka?h&4?Hb?Hg HfHeHd4~@O?Ka?ϟh'Ku2qKs2y k?k?7K70k?K8@7?k?_k? @K>@7?#:479S 4 k?Ka?H:^a7K?K?M7uK>Ku5Ks5 k?Ku2Ks2 k?Ku4QKs4Y k?Ku3Ks3 k?k?ok>k>7k>7:k>_7>ɋ 7G>> J G>݆b @K>_K>!7 @K>_e7>^mK>4K>YK>K>@O>K>_-K> 7?4G>K>_K?qK?y_-K>_W4G>K>_ҹ%4"46S 4 k>Ka?^ AH:K>K>M7^ K>4#47S 44 Ka?H:7^ 7K>4MD7k?ok? k?7C7@k?!7!7?k?K?!4z4@(4!@HwJ" :7?k?K?!4z4@ 4!:HK *4z4@7?!@K? bH}K`0@:K?!4z4Kl4 4k?K? :449PS4 HyM<7ȀH4Ȁ84Ȁ(4Ȁ4Ԁ44K>K?K? @O?Ku8!Ks8) k?k?/,ok>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yk>k>K= k>4@, 7e1qk>7k1y7Ck>44k>k>k> k>K> k>4zK>_K>K>7S_U4z7 0@(8CHHk?Q 5Z744z4_7#A(?DIHk?Q 4k>44z5_a7#ڈ BK>k?44yK>BK>$7K>42 44 F4HpJP5z7HoIh75z Al7HnIP75zY7 75(.5k  4k?7>K>K>Ka?4:@k? :7?Hx49'00N8D]'D5kjHp@@^4K>6р K>B4$*4K=K>K>K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>O>@/0,^@Bk?^IK>7^aK>k?Ka? Z .Hx4:@4Y]@ˀK=^ @k?^K>^7k?K>Ka?4:@ : MHx]U49ˀ=K=ˀ-K=K>   0 ]67? !b5_R7]6 b@?Hw5zJPq74 M6bE?]6 b@?Hw5zJP74 MP6bE? 7^5]67? % 65/7k?55k?5@6K>45B 5;5k@0@@ @ˀK=ˀK=k?ok>k>k>k>k>k>k>k>k>k>k>k> 8 7#k>77E4 ك 7+K>4Z4 4 HI7?I4Iy 7C?QH" :k?K>44B04w#(7 K?Y5]4 7? *!5߁5Q77]77?  IK4M57^55Q@77]-77?  IK4M57^15 @^55]57?  555k?G?eҹ5C?a@K?IK?Ik?5G?eK>B C?a 5kfH@@ K>B5 4K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>ˀK>Y@X@@@ˀUK>YˀEK>Yk?ok? k?7#k?!k?)_}7p 074K>K?K? @O?@(?@HHk?Q4k?1K?!44^7 ˀmK>K?)K?!4E \K?1 *ˀ-K>^@̂Mk?^K?14ς yk?ok? k?k?Kbk?!7F7cHB z7%@ 7^@KK?!7}0 f7y87x@  QHKw6RA4! 6ku  <K>K?K?K? @O?Ku7Ks7 k?k?ok? k?k?k?! z44yS4 Ka?4:@k?1] ]7K?1] E4y4$Kf7e0צ H !_H (7K?1] 4yPHH K?1] 4y H] }4y0HK?1] ]4y@HK?1] =4yPH@ @HK?1] 4y`K?1] 4yp4RX7K >צK>K?!K?K?K? @O?k?ok?7cH4? `@ ^ I@ `_4c k`K?YK?@O?k?7Ka?7X#4:@]7K?Y@7?k?ok?k?k?7#76P4@744@^7 K? h He H@P$4744^y7  eH4 K?YK?K?K?@O?k?77KX h7?KX Rk?KY 9(77_=7K?Y@7?#:479S4 _7ˀK?Yk?7P4hk?44h^7K?YK?@7?Ku5Ks5 k?k?ok?k?7$"7C 06PP4744^!7 P4744^7 H  e@H "+~4:049`_4 d d4 `h` h`(K?YK?K?@O?k?ok?k?7CH7$"z 06dP!*K bHC_@ *CW@ ] 4!H?@P4744^7 HK 6J?64 eK?YK?K?@O?#47`S 4 _7ˀK?Yς ek?ok? k?k?k?!k?)7C7$7#Z 07DP H64K>K?)K?!K?K?K? @O?Hy B#47S 4 _7ˀuK>P4 4k?744^7 P<407440^7K> 4?4zi 4 Hw64hh _ e ˀ]K>k0ςEK>k?ok? k?k?k?!77'7D 06H! H P4(744(]=7 gK>h e fH7_K] @KK ?@4K>K?!K?K?K? @O?ˀK>"z46y0S4 _7ˀ}K>k?7K] bK_ RKW BK k K?Y4@k@ @7?"46S4 _7K?Y4@7?"z46ySx4 _]7ˀK?Yk?ok?k?KS7C` 7%Ht P$407440]}7Hy 4?h Hx 7K @KK?@4hd K?YK?K?@O?"46 @S4 _7ˀK?Yk?7K_ RKW @@J j K?Y4k_ @7?#7 4S84 _7K?Y4@7?"46 S4 _7ˀK?Yk?ok?k?k?KU7C7%!7H( JKH}] 247 ?!6?@P ,4744]7Hs 4?48 47h`4k H(0Hv 07Hhf(K?YK?K?K?@O? Z44Y PS4 _7ˀK?Y7`  ς] $k?7#47 S 4 _7K?Y4@7?k?7#47 S4 _7K?Y4@7?k?o7 0ˀ:4_4 k004K?Y@O?k?/,7p (0H 4K?Y7?@/0,4 _54 ˀK?Y7 ς/ k?ok?k?k?7 0064 _4 @7׀4K?YK?K?K?@O?P4744]-7 4 uh0k?7#47 PR$4 _ 7K?Y4@7?k?ok? k?k?77? `06KW @KW ʐ  Z604k?7_ m4!7ˀ8K>KX 47(4K>K?K?K? @O?#:479 R|4 _ ]7ˀK>#7 4R44 _ 7ˀMK>P,4744]7 K>4  h0k?ok?k?7$7P4 744 ]7 4 K?YK?K?@O?k?ok?k?k?7#74_ 4 @744K?YK?K?K?@O?Pt4744]7  u k?74_=4K?Y@7?k?o778_40K?Y@O?k?778_4K?Y@7?k?778_]4 K?Y@7?k?778_4 K?Y@7?k?ok?k? 46_7 8744K?YK?K?@O?P$407440]}7  k?ok?k? 46_72C`Pt407440] 7 K? K?K? h h(K? h( d4|K?YK?K?@O?k?ok?k?k?7#74_4 @744K?YK?K?K?@O?P4744] e7  u k?o2CˀJH| :4_4 0 |K?Y@O?k?ok? k?k?k?!7#7 H644K>K?!K?K?K? @O?4_4 74PX4744] 7   - k?o2Cˀ*4_ 40K?Y@O?k?ok? k?k?k?!7#7 H644K>K?!K?K?K? @O?4_-4 74P4744] 7   - k?ok? k?k?k?!77' 0064_54 P7Ԡ44K>K?!K?K?K? @O?P4(744(]7 K> K>  h E k?ok? k?7# 8744K>K?K? @O?4_4" 7Ƞ4P`4k?!44]7K?!= k?ok?k?k?7 007#4_4$ H7Ԡ44K?YK?K?K?@O?P@4744]7  u k?ok? k?k?k?!7%7 H644K>K?!K?K?K? @O?4_4& 74P4 744 ]u7 K>    k?o2Cˀ*4_4(0K?Y@O?k?o2Cˀ*4_U4*0K?Y@O?k?o7#k? P74K?Y@O?_4 p7ˀK?Y7??蟽@"46 @R 4 _7ˀeK?YK?@h4y=K?Yk?ok?k?k?7&76P4 744 ]7 K?4   K?YK?K?K?@O?k?ok?k?k?7&76P407440]7 K?4 K?h h(  K?YK?K?K?@O?k?ok?k?k?7&76P407440]%7 K?44  h K?YK?K?K?@O?k?ok?k?7$7P4744]I7 4 K?YK?K?@O?k?ok?k?k?7&76P8487448]7 fK?4| eK? dK? K?hw hx(hy0K?YK?K?K?@O?k?ok?k?k?7&76P0487448]7 fK?4?4| eK? d hw hx(K?YK?K?K?@O?k?ok? k?k?k?!77% 0X7DH@ H z44,_ %4 7`44|K>K?!K?K?K? @O?"z46y R<4 _7`4|P04744]7 44 fH44k?_79 `4|k0 k?ok? k?k?77# 07FH B 44 R4 _7Ƞ`4H4.u HH64y]iJ BԤ44K>K?K?K? @O? z44y 0R4 _7Ƞ444._4 7ȠM4P 4k?!44] 7K?!44 H4x4k?_Q6 Ƞ4k0K?!} \k?ok?K?7 8X7##47 Rd4 Ka?Hx4:@7\ 4 d4K?YK?@O?k?ok?k?k?KS7D`!7#H H( rK bH 8@HC_@w \=4y!ZH?@H?e@HJ H jK ZH 2HCX@y \4y H?@H?m@4K?YK?K?K?@O?"46 R4 _ 7ˀK?Y}H0mH0k?ok? k?k?k?!KE7# 7H H K H Z H0K: 8@HC_@w \4y H?}@H?E@H?@4K>K?!K?K?K? @O?H0k?oK?7#k?7?Փ !" 07K @K?@k?k?Hs6t?ՎHuJJ K?_%7?|4|#47PR4 k?K?4y@4Ka?K?4:@\74|K>@O?H|K7?_UK?|4|k?7 4K?Y@7?_4 ˀK?YKK? 8@K?KJ ?@@K4, 4. @4K=K@J| ZK< RK?7?ՎR :K8KK ?K<׀4@ˀ@K9eK9k?7 4K?Y@7?_M4 ˀK?YK4& * ˀK?YK}KKeK<k?o 7K?Y4@O?_4 ˀK?YK4& R ˀK?YKK zKK?YJ|@O?KK= }KK?YJ@O?k?7 4K?Y@7?_u4 ˀK?YK4* Z4( : " ˀK?YmK]KMK=Kk?7 4K?Y@7?_4 ˀK?YK7? ˀK?YKK 0ˀK<@ 0ˀK<@ K? @K< @4? K? @K<(@4?k?ok? k?k?k?!k?)7C7$k@XKZ8k?1Hx07hz@He!0hy0HhwHh`PHK?1KH7!"H 44H RK B4zK?14@H5!I?4zH K?14?4z@4 H>H4K>K?)K?!K?K?K? @O?ˀK>و>4HHK?17>@ˀeK>ˀUK>ˀEK>k?ok? J67$0k?!j""҇  hk?Hw04@K? *HHyK?7 ˀK>Hw04@K? ˀxK>k?Hw04K?@`J ˀ0K>k?H}04@ K!ˀK>ςK>HHyK?7K>H0H(K?HyKK7XK>Ht k?4Hs0k?@pHwK>HHy7Hx0)7K>4v .7?/HHy7K?K?7hK>Hu0JK?H Hyy7 K>]@4K>K? @O?k?ok? k?k?k?!6J4,k?1K>7D7# 44. :HJKH0Y%Z4. 78%B jH0 H ( 78:H "+~4:p49^4HH`4?"6 H @K K 4k? 44yK?1_H(Hk?K?1HvHH H(7(@HJ4 ?Gk?HvK?17K>K)4k? 44y_ K?1)HK4 ?k? 8H ,84k? 44y_K?1,RHH4 ?k? Hk?H44y_ K?1'ˀ`K>k?H44y_K?1(zˀK>k?H44yK?1_uK(ZˀK>k?H44yK?1_%J)*ˀxK>k?H44y_K?1+ˀ0K>k?H44y_K?1+ˀK>HH0K$KH@JHJ4K?1HvH57 `K>ي 2HvKK?17 K>44_ 4 07HvK?17 K>H 04  zH jKH@@@HK344@Jy0ˀ HHHH$K?1HHvH7 K>"46R4 ^}7ˀpK>HKHW *HvK?17 K>k?K?14_4yK>HvK?17K>Hv HK?1HM7xK>Hv(HK?17@K>Hv0HK?17K>Hv8HK?17K>H KH@S@44@4;Hˀ`K>+~4:49^4 HH HvK@4Hk?4H04K?1m76@ˀK>ˀxK>k?K?144y@x48K>H @Hv@K?14447K>KK4K?1u7K>HvHK?1E7pK>k?H44yK?1_H0ˀHJ6M@4?HH4K?1HvP7K>ˀK>HvXK?1M7xK>HHv`K?1HYHX70K>k?H44yK?1_H :k?H44yK?1_MK0ˀHHvhK?1KKK -7XK>HKK?1Hvp7K>k?H44yK?1HW_m@ :k?H44yK?1_-H70ˀzHvxK?1-7XK>k?H44yK?1_H70ˀHJ3K4?HK Jk?K?14_=4y ˀK>ˀK>HK(4K?1Hv4K7 K>HvK?17K>HvK?17K>k?H44yK?1HW_@pK>HK44yk?K_K?1 K>\5@4K>K?!K?K?K? @O?k?ok>k>k>k>k>k>J67Ek>K>%7$44H|k?(4k?h84Hvk?04K>H447&@H$@K!:K`!(4k? 44K>_ H&`@H JHHK>H H 7 ZˀK>YHk?K>HHH H( E7%HaH?4 >k?HgH K 4k? 44K>_ uH%*HHK>HH e7$@H|K4 ?Wk?HfH "jK"X4 HK>H 7$h@HK!4 I70 0k?K>4_ %4$ k?I744_ K>#I?( k?I8 k?I90(4k?K>HI9I8I7 7 bˀK>YI= k?K>HI9I8I7 57#@H5 @>w HK> 7"@HvJ 4 = HK> }7K>YK>K>K>K>K>K>@O>KH@="44@4x! HH0K HxK( h8Kk?K>44_=59U@ˀK>YKH@BZHhI4K>HHw7uK>YˀeK>Y+~4: 49p^4juHhˀK>Yˀ K>YˀK>YˀK>YˀK>YˀK>YˀK>YˀK>YˀK>YˀK>Yk?ok? k?K>7#k?1Hk?!K@k?)!k?H4yK?!_5K?)!@K>04Hv0K?)K?17!ZH k?H4yK?!_K?)!"Hv8HK?)HH 7 H?k?H BK?!K?)4y@4 H?K?!HvPK?)7K>K?K? @O?ˀK>ˀK>ˀK>ˀK>ˀK>k?ok? k?6J7$k?!@Pk?)!H( @Hw 2H@HyK?)7!@H( RK BK?!K?)4_4!RH?K?!He H@K?!K?)4_4!H?K?!Hw K?!4@K?) @Hx( @Hy *HHHy K?)u7 z4K>K?K? @O?ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>k?ok? k?k?k?!k?)KFH7C7$k?1 6HyP444`HP  p@  @HKK?1HX7 HxP7uhwPHhzH7F@?-h`P4K>K?)K?!K?K?K? @O?ςK>ˀK>k?ok? k?k?k?!K77C 0@7% 0"+~4:49^4|HHHu@jHgX HJxH  XH H4z@H4 bHH"HC  2C_@ \ 4?u@H?%@Hv86h}84O 744\7  H|X hfX4K>K?!K?K?K? @O?k?ok? k?k?k?!7%7C "7"H :HHEH!@H"?@H :HHH!@HB?@!H4, H4.!z4. H!H!HH&!7?ā!!H` 2K K!K?@k?A7?9 k?IHb`4Pk?9hf`H6?󶠇4?u 84 XK>ˀHK>ˀ8K>ˀ(K>ςK>HK4z_-4 K>HK84z_4 K>ˀK>ςK>HH _84 XK>ςHK>\@ˀK?9H H84K?90ˀJHz@@K 8ς4z4@4hK?9H H840K?90ˀJHKJ KH C_C8 rHH Z\@ B4H44@ 4H ?C_H84' @H84K?9HH_-4zK?9HHJK p@JK_4z BHHJeJ0404 (ˀ0ς H bH R4z_-@ 24H 4H?4zH84%rH84XK?9HH_4z(K?9HHJK 84 JK 84*JK_4z 4HHKJ 84 KJ=84*K J S84KJ_=4z 4K?9HHKJ 84u#KJ_4z 4XK?9HH4zH9_uK7 4"HH4zH_%H 4K?9HHJK JK_4z @HH4zK_}J BHHJK0404 4(ˀʐ0ςH bH R4z_@ 24H 4H?4zH84!"H84K?9HH_54zK?9HH_4zK?9HHKGKH[J704 BHH4zHHX_e@ 4K?9hw`K>K?!K?K?K? @O?k?ok? k?k?k?!k?)K$k?1KHHe0404&HH|0404&zH Ha u049045&BH(Hb(8484V& !H!rH!bIHCCB"%IH%@IH%I %H [%@%p@I[H%@IK?1^4HK?17^}4K?15_7%4H 4H>IH$H@$H( Hx(_K?1$H H HeH JK5$rJKV$ZJK$BJK_]K?1$4H 4H?gJH#@H#H "@H"Hc Hg"rHHCAC3a#r[u@#ZHH0404#"!@H!H!rHIC]C!"HIb"HI"H I "H(I("zH0I08484"B[5@"*HI_ K?1"@H0 @I0_ K?1!4H 4H>HH!H !4H 4cHg=HH!P@Hg!:4K>K?)K?!K?K?K? @O?ˀK>ˀK>ˀK>ًY I(H(:gIˀeK>ˀUK>ˀEK>ˀ5K>ˀ%K>ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>Ku6Ks6 k?k?ok?7$k?N7:K?77_u4d 4|K?YK?@O?Ku51Ks59 k?k?ok?7$ KCKa?4h 7Y_mKZ7 X@Ka?H7 : B4 4K?YK?@O?@x#047`Q4 7@4z4k?7#0k?47QP4 Ka?K?4:@[ 7K?Y@7?k?7#0k?44 k?Q7Ka?K?K?4:@[ u7K?Y@7?k?ok?k?k?7&76N\4744\ 7 fK?44 d e Nhxh|74?4|hypK?YK?K?K?@O?k?oK?h7# Xk?A4y @Hyp^ yK? h`h4?hwpHc` RHx04Hy^K? H |Hc`?Hx4K?Y@O?ˀK?YˀK?Yk?ok? k?k?k?!k?)7#K9 7k?1K>6 K>4Ȉ "@ Hz( @^yK?1%h`@Ha 4haPH|0Hb(h`H0hb0hzN,4h|h` 4?O4?"6( HeH &Hh$Ha0Hv8$  ^ K?1$@K?1A4y$Htx6(huxHfh @@ 4Hp ߘ7K?1A 4y$h@K?1^4$Bh`h4?hgp@$(@Hf $"N4ph| @!Hh% Hh Hy8 $ K?1A4y$@K?1^ 4#h`h4?hdpHbH@ $bK?1A4y"@H|0Hu8  ^K?1"Hsx6}?Ch}x :0449 Q 4 Ka?4:@[]7ˀK>ـ @Hp'hdp4t[e4 @C4̂ 4 Hxh @Hp 4 7K?1A4y"@K?1^5!4?h}pHh4hyh hd8k?K?14y4k?@4" ˀK>ˀK>4 Z044YQ 4 Ka?4:@[U7ˀK>ˀK>ˀxK>ˀhK>ˀXK>ˀHK>ς8K>4^ N4(h| 44K 4h| \4hd(ˀK>ˀK>ـ r 04P[E4 4Hhe@4p[ 4 4hv@4h|H4K>K?)K?!K?K?K? @O?K?1] 4?4ˀK>4z4A 4K?1]4?G4ˀ=K>A 4zK?1]m7>4ˀK>4z4A 4>4ˀK>Hz8 D K?1^4>w4ˀmK>K?1^4>?4ˀ5K>K?1^4>4ˀK>Ku3Ks3 k?Ku5Ks5 k?_@/0$@k?ok>k>k>k>k>k>K>7#7k>4t4[K>k?!/@4tC B7k?![4t/k?!C?7@4HHz@ /4@4?.4_.4ʃ.4.4."046Q4 7_m4K?! (@@4@V%24%"Ȁ@K?!k?K>44y@7?!/7k?704K>]%4/rK?!C4v$*k?7K>4k?!4y@7?!/K?!C?k?4(8@K?!C4v#k?7K>4k?!7?!@`4y/K?!C?k?47?Yk?K?!7?!C 0k?!K>4y@4.7.HgK>^a4.7K?Y (H|(4cHxKCA@' [=4(HcHw?Hx@K?!C4z+z77k?!C4_+4Ҁ+4ʋ+Jk?K>47?!@ 4y+7K?!C]4X+\u@K>74^4x ˀK>Y7?Yk?K>7?!4y@ h4,X7,ZK>^!4,JK?Y 4K>YK>K>K>K>K>K>@O>_m47K?!Ka?H?7k?!(C  *K?!C4P 4Z(4 k?K>47?!@ 4y)7K>4]4>4ˀK>Yk?K>47?!@ h4y)7H}HgKB0`xHiI! H:C] 87ZCW@ [4 4?_5)4k?PI9PK3 PK4PJv0P k?K>4y4A<4=4ˀK>Yk?K>47?!@ 4y(7k?4 K>4yk?A4Y74k?!K>7?!@ 04y'@K>44^17K>^7'k?K>47]4;4ˀK>Yk?K>47?!@X4y'7k?K>4]4;4ˀK>Yk?K>47?!@4y&7k?4 K>4yk?A4:o4ˀeK>Yk?K>47?!@84y&7k?4K>4yk?A 494ˀK>YHvHuJ |94K>4^a4%K?Y =4k?K>47?!@4y%x7k?4K>4yk?A484ˀK>Yk?K>47?!@4y$7k?K>4]E48/4ˀ%K>Yk?K>47?!@4y$x7k?K>4] 474ˀK>Yk?K>47?!@p4y$7k?4K>4yk?A@474ˀK>YςK>Y_4ˀK>Y+4$7K?!K?!+4$_@7k?!C87?{4?" 6 _4ˀK>Y_4ˀK>Y_@0HK>]454ˀK>Y\ @K>7]%45G4ˀ=K>Yˀ-K>Y_4ˀ K>YˀK>YˀK>YˀK>YˀK>YˀK>YˀK>YK?!C4h8%k?K>47?!@`4y8k?ˀ=K>Yˀ-K>YˀK>Yˀ K>YˀK>YˀK>YςK>YˀK>YˀK>YςK>YˀK>YˀK>Yˀ}K>YˀmK>Yˀ]K>YˀMK>Y_4ˀ-K>YKu4Ks4 k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>iK= 6H7#h`Ka?H?7k>qH44(k>yAz4 ?4?*  HC4 P z4Z jk>k>HA5ҷ 6?U4?#Z 7X 4@7>*H@04z0* :K>@*K>ɀ@4zAX7> <H7 4 Bb">H4 P4 Z4 v4 4HI6)pB <>HB W( w8>M@ 05A)"5A?@5 C) 84HCi?HHK>q44y_4,07HC4 X,k?7K>q4 4y_4+7N4PHC4 v4 7 4 +5M7m( 5k N057k?K>q44y_4 +@HC?M5H5l ( 5E?  ^1K>q*k?k?K>q44y_4)7HC4Xp)k?7K>q4 4y_4)x7K>q]4܀X@C4+b7 K>q4y4A 47+K> *K>q7>4yAh4+ 0@K>q4^ 4044K=K>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>C4F;k?7K>q4 4y_4'7HC4v'zk?7K>q4 ]4ܞ%@C4 ꁿ#4 #4ʁ#!045P 4 K>y_7H44: [ 4xH7[4t4 x4 t#`7` g@, rAx4 H5g4| X8 #7?4@?@@I#  ZH '_U4 0@H ' 4  0hlk?H 4yA0K>q4ܛ 7? 7?1@4"H@K>K?1\":K>K?9" @] K>q7K>;M@K>q7>4yA4;@4_@m4K>q4yA7>ܛ=4_)@@_AK>y4\7RT6҄VH̟HHu4H]4HE4_K>yM4 <4<@4_AK>y44 K>q44yk?_54=74k?K>q44y_4K>q]}7ܘ@k?K>q44y_4K>q]7ܘU@k?K>q44y_54K>q44]E7ܗ@k?K>q44y_4K>q]m7ܗ@k?K>q44y_u4K>q]}7ܗ=@4_ K>y44}4_ K>y]4M4_ qK>y-44_ AK>y4444k? K>q4 @4]5ܕ@7>k?K>q4y4@H4ܕ@K>q@ 4ܕ@K>q@4ܕe@K>q@4ܕ=@04k?K>q7>k?4y4@4ܔ@_ K>yM4k?K>q44y_ 4K>q7]4ܔ]@_ K>y444k?ok?k?KD7%4P@ 07C 4_ 94z 4 s4_ 4z H4XC 7 }4_4z H4RCU Z7 v4K?YK?K?@O?_ q4ˀK?Y_ Q4ˀK?Yk?ok>k>k>k>k>k>k>k>J67k>64k>_7?A$K>KK?A 84} KK?I K84I?C4zH B #K>457k?_ EK>ك#x7I?C4 vt 7 'I<k>7?_Y5:I?C #77 *7?_5:I?C7"7 9K? K?  !:0K>59 _40 *59`4._5Z"p@K?@0 "595Z_m40"R :0449`P4 7_4z!R"0""  B*0BB0"Z r4#" ZcB4#b# K>4] 4K>Y0pЀ_7J 5 *4h#ן#?#҈_4zˀK>YˀK>YˀK>Y_Q4zˀK>Y_14zˀK>YK>4]4pK>YK>4]4@K>Y]AK> K>YK>]94K>YK>]4K>Y z04yZ4 0@K>4]4hK>Y4yZ]4 0K>4]y4K>YK>4]I4K>YK>4]4K>YK>ѕ]4K>YK>4]4XK>YK>4]4(K>YK>є]Y4K>YK>K>K>K>K>K>K>K>@O>K>4]4K>YK>4]4UK>YK>4]4%K>YK>K>A7?A Z#047 P4 7_4zK>4]4K>74] 5eK>Yk?ok? k?K%47#k?!@ 4 Ԁ44 C4Ƌ 7 b4^4zHC4v `@^4ˀ K>^44K>K?K? @O?7 v4^=4zHC4v @^=4ˀuK>7 |4^4zHC7 0v a @]IK?!K>K?!ә]Y4K>k?ok?7$H4k?4^k?HC4v 74^4HCW4v p7f ` `0 j]K?K?YK?@O?^eK?ˀK?Y^EK?ˀK?Y]K?K?Yk?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?aK$4 Z7#k?q@7 R4t *He4 b@F?@Hj5K kM4P7M4PHzC_47!4 4v!z4 X?!j4 tCSs 7M5A?5^U M5 t74^4zHC!75N7P x4 4M,574M 57 , Hz5C_ 8 >CS  K?q H74C0v g]4K>K?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?^E4ˀuK>k?oK>k?6k?!4k?1k?)^k?k?9K?7?QK?!@K?1!7?ak?K?7?YK?!@K?1!rK>k?7?ik?K?K?!K?)@K?1!"7?qk?7?yK?k?K?!4w@K?1 @K?a :K?Q *K?i K?q K?y K?Qk?K?ik?K?qk?K?yk?K?K?K?9]K?YK>@O?ˀK>K?YK?K?]K?9K>k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>4 B6K7k?@i"k? 4 4^}4HC4X7"7 4M 7!4 4 b4 d!04 v4`HB_"B"@H45P `4 7^=44H7 4^M4HC7"zk?7K?4 K? _i4"P7k?K?68]5 " HC"5)7&}  4 hK>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>ςuK>Y^4ˀUK>YH46} C띟4 נj=4H45PP4 7^4HU4MH=H^4ˀUK>YˀEK>Yˀ5K>Yˀ%K>Yk?ok>k>k>k>k>k>k>k>k>k>k>k>K>674v4 K4k>4Pk>M lk?HA 74 H4 4 t4 \5̀"4 M 47A ?(! AY H7]  K>K>@4!JHA?=54 gK>YK>K>K>K>K>K>K>K>K>K>K>K>@O>5Z4t 7Bx?7 k? K>4k?@XK>>HˀK>YˀK>Y^ ]K?ˀK>Yk?ok? k?k?46K7k?!@ k?)^ 4ˀPK>k?44_ @F44_ 2Yˀ4̀ 4Ā #047`P4 7^ 4H Z0C4F4t @^ 4ˀ@K>HC 04]K?! P7"046P4 7^ 4 :049@#Z04J7ZPHܞCk?7K?!4 K?)_ 4k?1H4XC5 @^ ]4ˀK>7 4^4HC4vt 7^ 4ˀpK>k?74K?! K?14]Ak? |04K>K?K?K? @O?k?ok? k?k?k?!K7&7k?16^4k?944^ @ (Ƞ7 wB4dZ B4` :Hbx4Hb`4ȠPHb#047Ot4 7^M4Hb44G gk?K?144_ 4w @74K>K?!K?K?K? @O?HC4t 7 zZ4v 7^4ˀeK>k?Hz^ G4 K?17K?9]4K>|44K>:4Xw ^ 4ˀK>7 v4^4zk?AH4XC= @^4ˀ-K>7 u4^%4zHC4v @^%4ˀK>K?A7  a04k?K?14k?K?9]YK?AK>ς5K>k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=K=4v6k> Jk>C]k>1k>Ak>Ik>)k>!'8k>" 6 Xk>94tZ!@&7@4t&HzCU4ވ5 *CV4V C\4H!J^ F4ȼ x!5 4Hs6z zZA4v'(7K> k>5Y]a4&< 04 K>7?Q]5Y04 Hz^ M5 A4 b&70` 4 74 f@4\ (0*4@4 \ ?44\%Hz^ F4 7M4P474 4k?K> 44w_K>%(7H}C4t=Hs^EK>ˀ8K=Y"0460O4 K>^u7HC4~7 44\W&J4TW& 7 x4^I4zHC%"7 Cӑ(%@5%`47 u7 yZ 475z_444%X44 K=K>@xK>%7K>]!5Y%k?K>17?I5k?K>4k?K>k?k?y@k?q$7ˀK=YK>5X] 5 \ 4@%HyC? 5i:@ I  H7CK>)6 wK>AѠ2K>A5k>A M0K>Ik>IK>45X]K>IK>)k>) |HzCRD84tK>IK>) 4K>IK>!@ K>I (K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=^aK>ˀ]K=YˀMK=Y^1K>ˀ-K=Y4 7 CӳK>96w?4?W 447 |7⚝ b7š a7 oše4]H^1K>ˀ-K=Yk?K>44w^=K>HC4t:7@p@^K>ˀK=Y"0K>^6 47 v44 :@k?I5+ˀ"4 Mp47k?K?I;k?k?K>5X5]k? G ˀK=Y^iK>ˀeK=YˀUK=YKu4aKs4i k?k?ok>k>k>k>k>k>k>k>k>k>K> 6k>@04 k>K>k>K=k> K>@04  Ka?H?$@ \ 4  @@)04  R@ 04  2!054^404  @5'(4 "4zZ 404@04J@0H4 0\4@(04B Z04Y4^404_ : k?!Z07?Q5Y55[5:4 Z5:  Z4@4 "@6@w4""@4H_ 4\!4I 4z"7ZQ4M 74y4ZI75ZZA45Z_}59 5Z_]45Z_E4 @ HK>7?1@ K>#7ˀ K>Y 4 K>K=+` 4, 4-`04,04- !Z07?Q5Y55[y5:]@M5z7] @^@@Z)4|K>YK>K>K>K>K>K>K>K>K>K>@O>5ZZ4y5Zk?M4K>7K>\K>%K>YK?1k?K>K>\K>K>Yk?ok? k?k?k?!k?)k?1K>4v7 K>6 Kk?A@% k?I4 iHC4!7 C4zw 4V 4Z 7 bHC4J!r7 i7?q_4z!RK?qI_ *K?yI< 4  iK?A44wk?^-K?IHC 2 "7C ?7 7 4K>K?1K?)K?!K?K?K? @O?ςK>ςK>ˀK>^ 4ˀuK>k?ok>k>k>k>k>k>K76k>7?Ik>7?Q_qk?I!P@K?Q!K?Y!HB4z?!b"0K>\u6 @ 07K>4\4 7K?I 0C Ka?H?CZ!84 07 Ka?H?!B \׀4K>YK>K>K>K>K>K>@O>k?K>44^ K>HC74v>7^ )4ˀEK>Y^@ 2HC4Z 7 44^y4HC4v>U7^ y4ˀK>Y^!@ 2HC4Z 7 44^4HC4v 7^4ˀK>Yk?7K>4 K>^ 4 7ˀK>Yk? 4k?K>4\ U5%K>Yk?ok?k?k?7C7%7M`40H`7HwXHzk k(Hy78 hxHzh|`Mh|Xh|H `K?YK?K?K?@O?K_X @K\PKkYXKWK  k(K_X @K\P@Kk?ok? k?7KX7k?!7CKZ MPhh|Hd` H HY-K?! H?@ `@HyHz75? U H(4K>K?K? @O?"046 POx4 K?!^Q7H}Hs7? | e @k?ok? k?k?k?!k?)K>7#76 0K>Hh Hw@ HxH M4(744(Z7Hy 4   i hhK>K?)K?!K?K?K? @O?k?44\4K>k?ok? k?K$7# hk?!H k?K?!HH\1H ZHZ4?4h`4K>K?K? @O?ˀK>k?ok?k?K$`xK#KXb@#047 O04 Ka?4:@7Y 4xˀ`K?Y"z046y O4 Ka?4:@7Y 44K?YK?K?@O?KW4 e`` H 2Ld4 47Z 44c?ሣ_HH 2L4 47Z Y4H6 k?7K7 k?K`27:_7 87ˀK?Y@@K?Y@7?K<?@K?\4K?Yk?o7:6_7 04K?Y@O?k?ok? k?7`hk?!4?D@R7# d 4?4?# 7 8  :0449 Ox4 Ka?4:@7Y -44K>K?K? @O?"0K?!46 @\14K?!#0K?!47 `\4HK?!K?!4\4 04 p Z0K?!44E \y4K?!#0K?!7 4\94K?! :0K?!44% \4PK?!"0K?!6 4\4K?!"0K?!6 4\y4K?!K?!4\I4"0K?!6 04\4pK?!"z0K?!\6e P@K?!#0K?!7 `\4K?!#Z07E pK?!\4K?!#:07% K?!\4K?!#0K?!47 \4XK?!#0K?!7 \i4 K?!"0K?!6 \4K?!#0K?!7 \4K?!"0ˀ6 K?!4\4 0X4  Z0K?!4E 0\q4(K?! :0K?!4% P\94K?!#0K?!7 p\4K?!"0K?!6 \4K?!"0K?!6 \4HK?!"0K?!6 \4 K?!"0K?!46 \y4K?!"0K?!46 \94K?!"z0K?!46e \4PK?!#0K?!47 0\4K?!#Z07E @K?!4\y4K?!"z0K?!6e `4\94K?!#0K?!7 \4XK?!#:07% K?!4\4K?!Zy@K?!4\7d  \k?ok? k?7#6k?!]U7K?!74\ 7 7Z44He!bHC_@ YE4 H?@4(L<@744(Y7Ht 44 K> K?!\ h heH 4K>K?K? @O?HK>0 Z4H ?}@4(k?7#0k?47 O4 Ka?K?4:@Ya7K?Y@7?k?ok?k?Ka?H?7CKTB4 4$ < zHvB6 S wH s 75?B p  Ӝ?Hv4K?YK?K?@O?]u@-@]U@k?ok?k?k?Ka?H?7CKUB7$!* <!2ˀK?Y]@ Ka?HHeH?@4 X@  73?! }  Ӝ?@@40 b0 4K?YK?K?K?@O?]@>@Hf@6? He4Ka? tH?>}B u]@Ka?H?k?77_k>4k?qk>4k>k>k?k?ak?iL tk?yk?7?a7>@k? :K>Bt j7?a@7> H@K? @Y@K>4@7?Y}K?k?K?q B#047O@4 Ka?4:@Y7K>K?yK>K?q@7?Ku6Ks6 k?Ku61Ks69 k?k?ok? k?7#4k?!K:Yq47 7C?7@!z7E?#07P_47?Hu 4% h@Ka?H?! @ <! @@4!4 Ht X@Ka?H?!@ Ӝ @4X @@!@K?!4y@4`K>_Hzˀ@K>]@>@4 z4K>K?K? @O?]-@@@D 4@d?4#:079`_4 7C @_mHzˀ-K>K?!@04yK>_%HzˀK>k?oK#7k?`? Z04Yp4^ !4z j@4H 4\ B4a k?K?4@7? ˀK>@w4 x@@z_ b@x4ފ J@y4 24|k?K?4@\7? 4K>@O?ˀK>k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?YK.7#7Dk?aA4 4 !4 44444 4 "r#"!?#Z_#6?B444@4y"4 ˀ(K>44@x4y05"@Hz 4@5"z4 4 444@4y"4 HnA>@ *444@4y"4K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?44@4y H} 4@5 ɀ4 44@4y05!(@Hy 4@5 ɀ 4 ˀK>5 x05>Hn45 w05ˀ-K>5 s444@`4y4 ?]4 ˀK>ˀK>_}K?aˀK>ˀK>ˀ}K>k?ok>k>k>k>k>k>k>k>k>k>k>k>k>K#47$@7E$@77?B@u 5?4k H5M 4 #85(?4 4 5 HC 7 HC== Q44@p4%"k?YK?QHH7_ K?QK?QY %7 "*ˀPK>Y_ 4HY7z!ʀ 4H\57 4 H]5I 75\H$7H\)6 7Y5 @  ?5@6 Y 5  JH] 5H7\y77Y ]5 J 4k?HHH_5"7H  <5? 4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ka?H?@z4*!4h <! @v4` @Z5I_@z 7 Ӝ :I_5 A Ҝ?5A 5 _ 54zˀUK>Y] =@>@v_4zˀK>Y] @@] @-I__4zˀK>YˀK>Y_e4zˀK>YˀuK>YˀeK>Yk?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK#4n7$k>7:k>_.(k? Y HK? H  7? _4(K? #(4!z Ka?5g P4&44 4 \4 HA&z5 K>4@4"rˀK=ـ" HC0 7 HH)x@:  JH7S H)PBz |?HHCO 7 H)B Ѽ JH7= H(C ќ?HHCn 7 H(B \ H7 H(CZ <?HXK? B7?a_4(@@HK?a  K? 4@K>#Hr]4z 0744H 77Y544H47Y4'j4_ 54'J4!4 \ 4@4|Jah5Y?C] *CA 8CF? 77ZC] *C\ 8CE? 77ZC] *CV 8CC?x 77ZC] *CU 8CB?X 79^7Z79 C] *CH 8CI?8 7?7ZK>]!4Y44K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>K>4@ 44 4444!4A? Z7?{4? 44  @?7?{!@HC2 7 HH!`@Z :K? H7 H!0B Ҝ?HK? _Y4zˀK=_94zˀK=ˀK=B4  B4Y@Y@BU4BE4B54B%4]@@]@ǀ bHC1 7 _49/K? _4zˀMK=ق6@_A4 0@_4zˀK=]@}@]y@@]Y@@]9@ @]@M@]@u@_4zˀ K=_4z @YY4ˀK=k?ok? k?7K87#k?!_7:HzX7 @_K?!ˀHK>ِ H Hw  y4K>K?K? @O?k?ok>k>k>k>k>k>k>k>k>K)4 7#k>77Fk?Y 6L 4P  k?aH4C(0z4ʁ!j4 4 7?Y4  7("7 vX"k?q7?y_4z""K?yH(*K?q6a?` k?qk?K?y 7?H W7?a4k?@84!K?q7??k?qHC(0 >@ HK?a Hl4 A *4 Hx7 y4K>YK>K>K>K>K>K>K>K>K>@O>7?q_4z=7?y_K>ˀeK>Y_K>ˀEK>Y_K>ˀ%K>YˀK>Yk?7?a44y@ 4>HˀK>Yk?ok? k?k?707?k?!K%7&64@HK?!!@HK?!@4  K? K>Hz7XK*6HL HHv K?tH|7 a4K>K?K?K? @O?ˀK>ˀK>k?ok>k>k>k>k>k>K&# 7@Ҷ6?`4? 7%7D74 @? 44 @Ka?4)HI?'B <'HB6 X C?  7\?  ?oHHC4 '27 44_4x'$R#0H[%7 @ @H4[54k?H47k?[uHy |7?97?A4_54&HC4&7 44_4x&#(@HHyK?9[K?A |7?i7?q4_e4&HC4&7 44_%4x&"ZHK?a[=Hx( |A44%Ґ`07?a4_4%HC4#7 k?aHKa?@Sk?ig04k?qH5 H?$B \>H_q4HXe7jH  `> 4k?H5_ IH>k?aˀxK>Y4 44_4x"j @H[]Hy |4K>YK>K>K>K>K>K>@O>4 7?)_a4"JK?)H(RH  7?1k?14_4x?'4ˀK>Y4 44_4x!`>4H[Hy |4 7 HC4":7`;U U44 44_4x"ʀ`=4H[-Hy |ˀK>YˀK>Y] @8oH_ i4ˀuK>Y_ I4ˀUK>YˀEK>Y_ 4ˀ%K>Y_ 4ˀK>Y4`9 4ˀK>Y_ 4ˀK>YˀK>Y] @U@_ Q4ˀ]K>YˀMK>Y_ !4ˀ-K>Y_ 4ˀ K>YˀK>Y_ 4ˀK>YˀK>YK?qk?HyK?a[K?i} |4 44_4x;G4ˀ=K>Yˀ-K>Y44_4x:4ˀK>Y44@ 4x:4ˀK>Yk?ok? k?k?k?!k?)7'7DK:k?17444444444HBt!!b!r!6s 6 Ka?H?)XA )Z7?q4_ 4)R'@K?qH\e Sk?9H[ 7 |YK?9Hu'"k?K?qHH _IH& |ˀ@K>6u8 6t 6v Ԣ4>@HB4? Z 4A < _K?1  J Z0H4Y P[ e@  |[AH |H7  p@+ 49 049P[ H ( |H5[4 |H6  p@+ 49p049[ 5H ( |H5[A4 |H6X  p@+ 49049[ H ( |H5[4 |H6  p@+ 49049 [ H ( |H5[4 |H6y  J :0H[ u49 |H[)4 |H7   H+(49@+ 49`049[@ | "H5[4 |H7W  R#0H[=7Ј ( |H4[I4 |H7?`  J"0H[6  |H[14 |H7  J"0H[E6 p |H[4 |H6p  J"0H[6 ` |H[A4 |H7  R H[Hy | @H[Hy |4K>K?)K?!K?K?K? @O?` 44_4 `?4XK?4k?H7H^%K? |X-K?H|>@ˀK>\5@67?q^K?1ˀK>ˀK>ˀK>^K?1ˀ}K>k?ok?k?KW(7C7%K_0077h0Hz K h| Hy Hs( 3 4EHx H}(  Hu(6hv(K?YK?K?@O?k?77?7] p7k?CKa?"{k?K4:@6y`KJX @K?YKKa?"J4:@X6K?Y@7?k?7#k?47NP4 K?4_7K?Y@7?k?ok?7$k?K 7:K?77\ 4d 4|K?YK?@O?k?7@4K?Y@7?k?ok?7CK:HuUrC_47Z@:4@ 4@#7D?$4` ςH_4zˀ0K?Y4 4K?YK?@O?H}7? _ 4?]_U4zˀK?Y!P6?]Ks 7?K!@"S K!4"_"HaR@ Kւ 7?K3B| K$45Kׁ K=C K#4t4K K$@ K"4S3Kֶ K#@t K!4=Y~=4 ςK?Y#47M4 74z_4ˀ-K?Yk?7@k?K?Y@7?k?ok?K=7CKZhK?C47:`x=Ht!7?$4_4z4K?YK?@O?4Z P@C7=Ht \_]4zˀK?Y4?@CC7u 6Ht˶} S "46M\4 74z_4ˀK?Y4K3 z 5 ςK?Yk?ok>k>k>k>k>k>k>k>k>K"7?7%k>7C7444  4 !{4z_4#HsJ# K?yKЃ @K?@"RZ7ZTbK0 47?aH7?i4z_4!K?i H@RU6ҵaK?a u7?aHB`6 >w7?y7>J45yMd4 74z_57?aRV6a4?H?HT?  \m4G4?!H? 4K>YK>K>K>K>K>K>K>K>K>@O> 44@M4 74z_}5ˀUK>YˀEK>Y 44M4 74z_5ˀK>Y 44@M\4 74z_5ˀK>Y 44M4 74z_e5ˀ=K>Y!450M4 K>7_ 4zˀK>Yk?ok? k?k?4x7k?!7C4}X !rHsk?)4@ 444?#07_ @K?)4Z4 [4Y 7 @K?)[4܀K?!4?_4zK?)Zu774|X @ ZK?)474vX f4K>K?K?K? @O?+4:49Z4=4|X ;449pM4 K?!7_e4zE4ZK?)#;ܞ=79K?)4Z4#ܞ7K?)4Z4"ܝ6K?)4Z]4#ܝ7K?)4Z%4 [ܝ]4Y K?)4Z4 ;ܝ%49PK?)4Z47#7pK?)4Zu4"ܜ6K?)4Z=4"ܜu6K?)Zm4"ܜE6K?)Z=4"{ܜ6y K?)Z 4#ܛ7 K?)Z4 #[ܛ7Y 0K?!4&_4zk?1K?!4z_e4 4?k?4K?1k?K?)4ZM7#;ܛ 79 `K?)4Z4#ܚ7 K?)4Ze4"ܚ6 K?)4Z-4#ܚe7 K?)4Z4 ;ܚ-49 K?)4Z47#7 K?)4Z}4"ܙ6 K?)4ZE4"ܙ}6 0K?)4Z 4"ܙE6 PK?)4Z4"{ܙ 6y p [44Y MT4 K?!7_ 4z4+4:49 Z4*E4vXk?ok?k?k?KFH7C7$ـ704@ Fğ@HzPK(&h|PHzH F4 XHsHHPצ3  ? 7 hfH rHtP H JK4 4HzZEH 8 4K?YK?K?K?@O?ˀK?Yk?ok? K777Dk?_ 7?0ˀJK?4RK?_4 |04K>K? @O?7>k?4_ 4 ˀK>K?HP4m }k?ok:k:k:k:k:k:k:k:  7>qk;I7;Y7j?4xj?!j?)j?1j?9K;Ij?Aj?Ij?Qj?Yj?aj?ij?qj?yj?j?j?j?j?j?j?j?j?j?j?j?j j(j0j8j@jHjPjXj`jhjpjxjjjjjjjjjjjjjjj6k=Yk;1k;9k;Ak;Qk=ak=ik=qk=yk=k?ik?q k?"6#4444 4 4 4wk?@ "6k?B?  _@"* B?!_!ڋ!27;1@7? *ˀK:Y7;1@7?!rK?/4wK;Q7;Y!ςXK:Y"46 MT4 7;17_4y4K:YK:K:K:K:K:K:K:K:@O:"46 M4 7;17_ 4yˀ]K:Y7;1@7?>K?ˀ%K:YˀK:Y7;1@p7?>_K?ˀK:Y7;1@7?>'K?ˀK:Y [44Y 0M4 47;1_7ˀMK:Yk?ok> k>k>k>!k>)k>1K)587(A&87C_m7>(P47>7>4z_]5(4)4? „̊""Ȃ4?7>7?4z_5(K? ?7>K>_K>'7HzZa4$ˀK=Hu( RK>_K>(7HzZy4(4h|(7?)7?94z_5(R7?I4z_5(*7?Qk?7?17?A4z_5'4 ?7?a4z5_I7?Q'@K?Q@#J"?7?a8H 7? 4z_5&"7?4z_5%7?4z_ 5%@K>&@HzZIK?%h4 !JĂR" 'rK>_9K>$7HzZ14$@Hz84 ha(X@h`8HzP h`0X@h`PH8!xh`HKhiHKIh|PHw87HxHJ\H 7>4z_5#7>4z_i5#7>4z_5#h@K>44z_ 59!X7ˀpK= [Hz4Y pZA@"4h}(H 4t(j 44 M4 47_A4zˀK=7>k>4_4z"BK>HwP%Hz[5 @Hz[a57K>_K>!7K>k?45HzZ!4>H ˀK=k?4_4z"ZK?HPEHz[5 @Hz[Q57K>_K>!7K?k?44HzZ5=}@ˀK=ˀK=ˀxK=ˀhK=ˀXK=ˀHK=ˀ8K=ˀ(K=ˀK=׀4K=K>1K>)K>!K>K>K> @O>ˀK=#;K>\ 79  ̂UH K?47>4z_59>7ˀ%K=ˀK=ˀK=ˀK=ˀK=ˀK=ˀK=7?i4z_5 7?q4z_5 Z7?y4z_i5 27?7?4z_5:H ˀK="46 M4 74z_)59ˀK=0 Hs 0 gHu 4Ht Ha 4" 5hb k?ok?KW 7_(7C7$6?hw J4 "Z#j !R!!rK4h|@Ha0Hz0 Kp Hb@ \H|0Hz@  KZ\AHy8K4h|8HHH}HJ]Hw8H}8HdHK[HyPHs846zX 484"6?Jj!?6?4K?YK?@O?7?4z_4! @Hy K4?4K?HzZ6?g4ˀ]K?Y7?4z_i4 K?HzZA6>4ˀK?Y"46 M4 H7_14zˀK?YˀK?Yˀ}K?YHzZJ>O4ˀEK?Y7?4z_Q4>4ˀK?Yk?ok? K77$7Ck?_A7?y 7?7?4z_94 bK?y4@r"46 MH4 K?7_4z׀4K>K? @O?7?k?yHd004@ D@ Hz8Jd h|8H}0  s  4 X  hd0K?yHz8 K? T4K?yHy8 s K?9 5k?ok< k<k<kk<4_4z7HC4D77 7<4z_ 48 K<4@7?kI4_e4z:K>IHwP K>QJ J0k>Q5p"5k J57k?K>1k?_ yK>9K>QK17>94z_49K>A97>I4z_ a49r7>Q4z_ 949H@K>I /7>4z_5YK>Q k>Qܞe4,"5) J 57k?K=y_ K=K=k?7K5lˀ0K;ق67=4z_ !46K=р 5MJ5J 5J4575:J57K=_K= 6 <K= , 5k?7=7=4z_ 4>K=ˀK;7=4z_43P@Jt4P744PX74 4 7=Qk?7=A7=I4z_ 42K=Q`25,5*"5J Jl57K=A_QK=I <?Ok?ˀK;7>q4z_45J7>y4z_45"7>4z_I447>k?7>7>4z_ i44@K>?k?KyZ Ky4KyK>yK4z^=4-7> 4z^4,@K>X04K> ZK4z^4,7>4z^m4,H7>7>4z^m4,K> ,K>ɑ04K%K<7>4z^4,z7>4z_!4,RK>,,JK>Z9K4z_4+ 7>4z^4*k?4z5Y_4 K>k?47K>Z K4z^4'@J<4P4 74  7>A7<4z_4'K<47>7>4z^-4(K<0ƴ4ZiKKˀ K;ˀK;#;479 Ll4 74z^ 5yˀK;K>ZKk>k>k>K'7$7C^}7?%27?!4z_4% H7?)4z^%4$K?!k?i"{6z @k?a(Hf7?94z^ 41R7?A4z^ 41*7?yk?4z47?a^7?i0K?)4| K?940K?A 44H@_ :1"7?I4z@4 :ˀXK>Y4z47?a@|7?i1K?A4Y4@7?k?Hf0߀ @Hv8  !K?)4|#J߀04߀@ F@ Hz8J h|8Hu0 !   4WM hf0K?Hf8  # @7 @YK?Hg8 9 K?! G  Hk?aHk?i HfK?! ZY4 K?) " 0 7?dRJ4 K?!44YMHk?! K?)7?`4?#;78 4z4@7?I%ˀK>YˀK>YˀK>YK?) *7?94z^4K>Y 44 L 44 74z^4ˀ8K>Y 44 PL 4 74z^=4ˀK>Y ;449 L 4 74z^4ˀK>Y7?94z^40ˀJK?a^K?iK?! 7Y4k?!4 h K?9k?K?!44yY 4K>Y7?94z^40ˀrK?a^K?iK?! 7Y 4k?!4 h Hz@K?9k?K?!44Y 4 K>Y7?94z@$40ˀK?a^5K?iK?! 7Y%4k?!H 4w( K?   "4h (K?!4h K?!0 4K?9k?4Y m4K>Y4 h ςXK>Y4 h ς0K>Y7?94z^]4 R7?A4z^54 *4z47?I^=7?y0ˀK?y:w4z7?Q4z4^7?y:?4zˀHK>YK?9K?IY54K>Y7?94z@t40ˀK?a^K?iK?! 7Y u4k?!4 h K?9k?K?!44yY-4@K>Y7?94z^m404K>YK>K>K>K>@O>7?94z^4 *7?A7?y4z^4 ˀmK>YK?a^K?iK?! 7Y 4k?!4 h K?9k?K?!44yY4 K>Y [44Y Ld4 74z^4ςmK>Yk?I47?9k?Q4z4^uk?Y R7?A4z^M4 *7?I4z4^U7?y ˀK>YK?y 7?Q4z4^7?y ˀmK>YK?y :7?Y4z4^7?y ˀK>Y#47 L4 74z^4ςK>Y7?94z^4 *4z47?A^7?y ˀ]K>YK?y 4z47?A^7?y ˀ K>YK?y J7?yk?7?a7?i4z^m4 ˀK>YHC4Ĉ 27?I4z@4 ˀUK>YςEK>Yk?A7?94z^a4 R7?A7?y4z^i4 "7?I4z@<4 ˀK>YK?a^AK?i7YE4K?Ik?47K?A 44Y4wK>YˀK>YK?y R"46 L4 74z^4ˀK>YK?A4z@x4mK>Y"46`L4 H7^i4zˀK>YˀK>Yk?ok? k?K?77$k?!7C@ $7?I"(@K?I4 p4?4?"Z4_"4!"4!4z@4 ˀK>7?i7?4z@ ,4"7?q7?4z@ 4!7?y7?4z@ 4!7?4z@ 4!4K>K?K? @O?7?Q4z@ |4!"HHu4C4?w47?Y7?a4z@ 4??4ˀ5K>ˀ%K>#47L4 K?!7^a4zˀK>4z@x4>4ˀK>ˀK>ˀuK>4z@<4>G4ˀ=K>k?ok;k;k;k;k;k;k;k;k;k;k;k;k;k;k;K<77Ck<7<@4k<4zK<7<7<@ 4z4ZHd@4X4?HK7 01bK>k?5K< YH71zK>Yr&1_K<7?17?A@4z2@K<7?Q@4z2h@K<7?97?I@4z20@K<7?Y@4z2@K?I15?4k<K<7=@(4z,4 K<7=7=@4z,@K<7=7=@4z,p@K=K=^ 5?K=? 487H|0Hp8 1 P JK=ي J[K=Ƀ 6(0@0eJYK< IK< Y7'7-*k?K< 568k?Y57-:K<)5.ՠ2K<)6k<) I47   .K<7>Y@4z,@K<7>q7>@04z,p@K<7>y7>@4z,8@K=9L 5?k>aK<7?@4z-K?ǿ@K<7? 7?@X4z-@K<7?@X4z-ZK<7>a@(4z+J5?K<7>i@4z+*K>YmD 5?Ha0Hm8 P@IK> I[IK>y 5(͟@͘@K<4^4zK< 44Y97ɼe@ǟ K<7?!7?)@4z+ʭ4_?K>yK>P 4 4^@K>YK=9ǡ7*k?K< 55Yk?ɼX@Hk?K>a55k?K< k?Yk?7*rK<9 P4IK> I[K>q 5?5(K<1BKq4 K>   i II 73*7i IID II ] I6"iI B `/7=90`4K<9I 746I 9^  (K< Yq7h )h \55)(h V%K<9k?Hk?Y K< KK?K?K? @O?"46pKl4 K?!7]4zˀK>ˀuK>ˀeK>ˀUK>ˀEK>"46K4 K?!7]54zˀK>ˀK>"{46yKl4 K?!7]4zˀK>ˀuK>k?ok>k>k>k>k>k>k>K%7$7Ck>@`7?$ K? *7?!7?14z@4#7?)7?94z@4#K?"444f04 4H6?Bz H Y I8"*I?K?9"I:[K?)!K?4!#I7 !⁘@H #@HzYH#X@K#47YyHz#P7K?)K?9[5 @V5K?9# 4 ?u44![5YK4 K>7]u4zˀK>Y=4Hg@=Hp@I7 04 5?}5J?فa4w4 4He@!HK?!C]C5 B[K?1 (@VqHK?1<=@H?}@m4ˀxK>YˀhK>YˀXK>Y#47PKD4 K>7]4z4K>YK>K>K>K>K>K>K>@O> >%@@XI$"K>6] 4zˀMK>Yˀ=K>YH  <4HzYH R!;459K4 K>7] E4zˀK>YHzYHHzX7 04EK>Yk?ok? K#47$k?@w k?"46PK4 K?7] =4y4K>K? @O? K?7?] 4 ˀK>4 CW "g Y6}?7"46PK4 K?7] E4yˀ K>K?K?]4K>k?ok? K#47$k?!@wk?!Pk?4 CW "h Y6}#!b7 K?7?] =4!@K?7?] 4!P@K?7?] 4! @K?!K?4!K?K?4]K?!K>K? @O?#47K4 K?7] 4yˀK> 44K\4 K?7]4yˀ=K>ˀ-K> [44YK 4 K?7]U4yˀK>k?oV=7#  `p 4c@4c?K?Y4|@O?k?oV7#  `p$4c?@4cK?Y4|@O? 4@ k?ok?K77$ 07CI4   dH4 K?YK?@O?K BK7 K:0? _K=@4k?ok?KV7C4JUx7$I4HK H}K|H} |HyK?74  DHx4K4#kK?YK?@O?k?ok?KW47DJ7#7j6 4u 4HH\4ԃ@HH44K7k  hy_47 4?M@0K?Yy_e4 4K?YK?@O?k?ok? k?k?47%8H7C4 7?`??4?7?ЁjHwJ4ԃ7j6 44 ZHxK@6k7 W 4?44K>K?K?K? @O?HwJ4ԃ*7j6 ς%4z_=4eK> {44yK4 Ka?4$@7Ue44y 4UE44y0U-4ˀK>4_}4z>-@ˀK>@_E4z>M@ˀ]K>k?ok?k?k?7C7&U%7:47HwJ4ԃ7j6  ςHwJ4ԃZ7j6? 444z_-4"*@ b4HxKj6k7 4 ?44K?YK?K?K?@O?4žןHwJ4ԃ䠲7j6 44HwJ䠒7j6_ ςe4z_u4>u@ˀK?Y4_=4z?gHw"4z_ 4> @ˀK?Y4_4z=4zˀMK?Y ;449@K<4 Ka?4:@7U4ˀK?Y_=4z= ˀK?Yk?7"k?k?6_ k?7 4 "K?_uK? 4(@K?_=K? 4K?Y@7?k?7"k?k?6#_5k?7 4 "K?_K? 4@K?_e4 4`@K?_-4 4(@K?_K? 4K?Y@7?k?ok? k?k?k?!7C7'76Ip4P744PV7 @H  K> 4`HHy hdK>K?!K?K?K? @O?k?7@P4K?Y@7?k?7@4K?Y@7?k?ok?k?KD7C#7%"H "@H\2HbP!4yP_4z#2HwJ4ԃ7j6  4 34HwJ4ԃ7j6 _ 4 44_4z"`@Hy(_4z":04yPHe0!4y0_4z"2HwJ4ԃ7j6 44HwJ4ԃ7j6 ? 4 U44_4z!b#7 @_4z!:4y04 _4z!ZHH4Vh4K?YK?K?@O?+4:049PX 4"04_4z=_Hw"4_4z=4ȠE44_u4z>/HwȠ 44_=4z?@=4Ƞ4k?ok?k?k?7!6'8 E7EH` 2H HwHc`?@I4744Vq7 f dH 0@K7K?@  4K?YK?K?K?@O?Hs 昀 f dH?4KHw4HzKW wHzVKD?% dHHHz4k?ok?k?7C7%H<4744V 7 H4 hdK?YK?K?@O?k?o7Ck?KY jHzKXk?K_V 1hK?K?4_]4zK?Y@O?+4:`49X4#:eHzk?77k?673k?46wk?@4?K?Y@7?k?ok? k?k?k?!K>77Ck?1$h7&xHd_ 4z&*HwJ4ԃ7j6 ? 44HwJ4ԃ7j6 444_ 4z%Z#;79 @_4z%2k?K>4z4_K?1!27_4z HwJ4ԃ7j6 _ 4 <4HwJ4ԃz7j6  444_ 4z (@Hy(_ 4z>k?h7HwJ4ԃ7j6 44  44z_4 44z_ 4 4HwJ4ԃ27j6 4ςb4_u4z 4 4z_4 4HwJ4ԃᢲ7j6 4ς He4htHd4hK>#07 @ *_]4zK?!K?K?K? @O?4_4z:7Hw74_4z?@E44_4z 4+H%7>k>_4&4_7>&7=_7>&7=_7>&7>!_7=у&7=_i7>1&b7>A_I7=у&B7>Q_)7=у&"7? _ 7=у&7?_7=у%+4904X7=у%@K= @@07=у%k=+H97>_57=K=و%K>"z7=_17>&2K=J4ԃZ7j6? 44K>_7=у%"6 @_7=у%K=J67j 44K>_7=у% @K=J䤪7j6 4x4K>_7=у$4_i7=у$4B_I7=у$jK=J*7j6  4A47=7>_7>$K>k>K> k>k=7=_7>1#+H9 4zUU7=K=و#K>1 7=_A7>1#@K=J4ԃZ7j6 447=7>_a7>1#0@K>0ςz 4U]4zk=404"#(78K=Um4z04Ј"K> 4KK? K=U4z04":K>"(4Hk?44zK=U4!HH? ׀4K=YK=K=K=K=@O=ˀK=YˀK=YˀK=Y4_7=ы:@4_q7=ы;@R4_A7=ы;e@"4_7=ы;7=ˀK=YˀK=YˀK=YˀK=Y4_7=ы<7=ˀuK=YˀeK=Y40 h@U@U7k?Ka?Hx4:@4pU4ˀK=Y_7>_7>ςK=Y@ @K?@ @k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?QKE#h7$4444 4 4 !HX#H04$X40_4z$"HwJ:7j6 J4HwJ棚7j6_ +44_4z#r5 @_4z#RHmH5h|K梊6k7 44z_)5#H@H _4z#"HwJ27j6  4H_4z"@HwJr7j6 44z_)5"H@HXJ  Z"*4_4z":4_4z"H<@4K>K?QK?IK?AK?9K?1K?)K?!K?K?K? @O?4_14z<@44_4z=4z44_4z=@44_4zK?K? @O?ˀK>ˀK>4_ A4z=4ˀK>4_ 4z?@44_ 4z>@"4_ 4z>4ˀK>k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?YKUP x7C4yP_4z*HwJ4ԃ說7j6 4 4H|p"P@Hb`@*4e`4z_14*HwJ4ԃ䪂7j6 4 Z4HwJj7j6 4 =44_ I4z*!;59 _ 14z)4_ 4z)4_ 4z)Hf4?_ 4z)r4xp4z_Y4)J4z_4)*HwJZ7j6 4 }4Hd4?_4z(Ha` r4y`_4z)*HwJ4ԃ7j6 4 Z4Hex *444?B04z(Hf 4y_!4z(HwJ4ԃb7j6? 44Hz UaHyh BHwJ*7j6 %44xP4d@4z_4'4x`4z_4'4x4z_4'4z_4(HwJ4ԃ7j6 44HwJ7j6  4 44_4z'p@Hy(_4z'J 4 @4z_4'4_a4z&4_Q4z&Hg#44 HaH,H #8HI0m"A("FIH I?@ "H K5\ A(K=F`I0IH rHH XHK5S :A(K!FI0IH HI _͢ 4 HwJ7j6 E4HwJ7j6 (44_4z%R4z_4%24z_5%@I7_y4z$4z_Y5y$HwJ"7j6 4 j_4z$Z4z5x5W_4$:H<@HwJ7j6 44ςHK>4^]4z>'44^-4z>@R4^4z5e@ˀK>+4:49W94'*M4e`ˀhK>4^}4z5Hwˀ0K>4 ^E4z?@44^ 4z?@Hd4^4z77HexˀK>ˀxK>4^4z74ˀ@K>4^U4z74xP׀4K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?ˀK>4^4z84ˀUK>4^e4z?@-4U@5 U@♕ U@ 4^4z:E@ˀK>ˀuK>4z^4;@ˀ=K>@ @K?@ @k?ok? k?k?k?!k?)7$C9(79A(H0HHHe 0 H@H?@4 rHb2"4z4@4 H濕HK>4z44@4 B40 }Ua@He4 zK>K?)K?!K?K?K? @O?k?ok? k?k?k?!k?)KS`7C7&7"X64y`^4z$:ˀK>4HwJ4ԃ礊7j6 44HwJj7j6 4\44^4z$:#7 @^4z$4z^U5#H6^-4z#4z^ 4#HwJ磢7j6 44^4z#:4K>K?)K?!K?K?K? @O?HtJ4^_4 7H x4k?14\_7 4y`^4z!HwJ4ԃr7j6_ 4 (4HwJZ7j6  444^4z @K?1^4z 4 @^4z 4^4z 4^u4z `@UK?1H _۽@Hw4^54z>HwˀeK>4^4z?@44^4z;Hw"4^4z;4ˀK>4^]4z?@e@ @K?@ @@4@ @K?@ @k?74k?4^4K?Y@7?@ @K?@ @k?74k?4^4K?Y@7?@ @K?@ @k?o7#0 @7h *d b j$(k?(k?,4k? 79^=4xK>@O?#47J4 Ka?4:@7TU4xˀK>@ @K?@ @k?o4 ? @7#x *p h b4(k?6k?84k?4^4xK>@O?"46Jh4 Ka?4:@7T4xˀK>@ @K?@ @k?ok? k?4 7# @7D` `0"h!zH 4H !444 Y_4!r4^E4!R#7 @^-4!*HK`0h` h 4K>K?K? @O?k?4 X^4K>k?4 X^4uK>#;479PJ4 Ka?4:@7T 4xˀK>ˀK>@ @K?@ @k?7_4K?Y@7?@ @K?@ @k?ok? k?k?k?!k?)k?1k?9k?AKC7D7'764 4`$4 ?Hy##Hs`#ڀ H  H 4 K  C_C8 jHs(j JT@ 25J H  ?w  Ht #j *H    #2"4 4k?4k?44k?^58# @ 4^ 4"ڀ 4^ 4"€ @H p4 ^e4" @ ^ %4"j5k ?  ? jG407440U 97HK a gH bhhe 4hf( d4K>K?AK?9K?1K?)K?!K?K?K? @O? 2@C5 T4ˀK>ˀuK>ˀeK>ˀUK>@ @K?@ @k?ok? k?k?KW7D4BH^m_4@724_)4!(7Hy !"444^4!*4^u4! 4^U4 Р_HР_K:Р_ z4K>K?K?K? @O?k?44@4^4K>ˀK>k?44^4UK>ˀEK>@ @K?@ @k?ok? k?k?k?!k?)k?17&7C74`4G 4?@x7 HtBH4Ҡ_7^4z <_5)?Ha`4Ha@"H@_4^54z7` 844z^59"7H "4z^e7?i"k?47?ik?44k?4?^4z!4^4z!4^4z!4^4z!b4^4z!B4z^m59!" 4 ^=4z `J4 ^4z ¤_5U4 4B^4z 4^4z ˀ`K>ˀPK>k?44z^ 4K>׀4K>K?1K?)K?!K?K?K? @O?ˀK>HhK?iK?qi i( Hw J ςMK>@ @K?@ @k?o_7C0ˀ"HCH4cHK?Y@O?@ @K?@ @k?ok? 7Ck?KXk?CH_k?)K4z^ k?!K?)K?!4z^47 4 "4^4z 4@K?^4z 4@K?^Q4z 4b04^4z 4(@K?!^4z 4K>K? @O?@ @K?@ @k?ok? k?k?k?!k?)7F7$^7HCHg_4^UKk?I`P47?Q7&&8G&FrK?I^4!07H 8@K KE!K?@445^ 4!*04^4 @K?I^4 Ҁ 4^i4 4^I4 ˀHK>ˀ8K>k?K44^-5K>K?)K?!K?K?K? @O?ˀK>ˀK>و x@G |4 744 T7HJ   Hv hg ςK>@ @K?@ @k?oKW7CBH_^k?k?K?44^ }4z7 4 "4^!4z 4Z4^4z 4(@K?^4z 4K?Y@O?@ @K?@ @k?7^k?^K?K?4_}4K?Y@7?@ @K?@ @k?7k?k? k?^@K?K?_UK?K?Y@7?@ @K?@ @k?ok? k?KW7D4BHJ_k?)^ k?!8k?14^7!7Hy !K?!K?)4^ e4! 4^!4 4^4 @K?1^4 Р_HР_K]Р_ }4K>K?K? @O?ˀK>k?K?!4^qK?)K>ˀK>@ @K?@ @k?ok? k?KW7D4BHJ_k?)^k?!8k?14^7!7Hy !K?!K?)4^-4! 4^4 4^4 @K?1^4 Р_HР_K]Р_ }4K>K?K? @O?ˀK>k?K?!4^9K?)K>ˀK>k?7D*D B@ *4K?Y@7?T@ˀK?YςK?Y@P@K?@ @Ku7QKs7Y k?k?ok>k>k>k>k>k>k>7%7D7 64 #44444_%4#7I_#(4K3"߂KG 4`744`Te7 I\h IV  FH H5WhhX4^ a7?i"k?47?iK>k?H44k?^5"z 4^4"J4^5"* bHH 64241Kjh H E4HK?iK?qk0k8HBH# bHK>YK>K>K>K>K>K>K>@O>#;7?!794U 584ˀmK>YCPҀ__4KK?1K?)K?!K?K?K? @O?4]4z!4 $ 4z] 4!444z5]4<@ˀ%K>4]q4z!J4 $ 4z]m4!e44]4z 4z]4 =4+4: 49 U m47~4y`ˀ-K>4]4z: 4ˀK>SE@ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>ˀuK>4]4z;4zˀ=K>@ @K?@ @k?ok? k?k?KS7C7$BtH7]i҆?k?!H|8$hd0484k?44?k?4z4]=k?$r4]4z$R4]a4z$24]A4z$4]!4z#@K?!]4z#@]14zk?)4yH] 4z#ʈ(h`XHf4ha4yp] 4z#HwJ4ԃr7j6 ? 4 ]44z]4#B#7 @]4z#"6#] 4z"4z]4"4]i4z"4|]I4z"4])4z"r4] 4z"R44z]4"*044z]4!4z4]y4!@Hz`@!4y`] q4z0"Hu(H64ht(KW6k74 4x 4HyK"4Ԉ:HtJ 4 Hs6j6e ςS -@5hd047K>K?K?K? @O?74]4z<4z7+4: 49 @U-484y` 4 ]i4z 474] 4z 474z] 4 474] 4z 4g7K?)] Y4z 4-74]Q4z 4>@=Hy@ @K?@ @k?ok? k?k?k?!7'KY(7C7"!x6FX407440S7 4z HCH?]A h 4` h(H}` @KK@?@4yH]4z @H]I4z HsX6thtX4K>K?!K?K?K? @O?+4: P49 U}49 WˀK>k?ok? k?k?KE`7C!4H  #Ș4 k?H44])4z#HH4zCH cH4H` 4H_ H(#JH?H "@He4h|4y`]A4z#"HwJ4ԃ7j6 444z]4" ;49 @]4z" H4Y#]4z"Z4z]94":4]4z"4|]4z!4]4z!4]4z!44z] 4!@Hx04z] Q4!b44z] Q4!:Hd` P4H "4z4] 4 H?4Hz` SKD?4h``4K>K?K?K? @O?SE@ˀK>ˀK>ˀK>4]14z=?4zˀeK>ˀUK>@ @K?@ @k?o7Ck?\7Y`!@Hb(B P@K?]14z @_m4z!jˀK?YHwJ4ԃz7j6 4|4HwJ4ԃj7j6 4 44]14z #7 @]4z 4]4z 4]4z @K?]4z bK?]4z ˀHK?Yˀ8K?Y4\u4z>Hw4K?Y@O?4 \-4z?44H(7ςhw(@ @K?@ @k?ok?7$7C\u7Y` HwJ4ԃ7j6  4U44?\4z R4z]4 Zˀ8K?Y4\4z?4?4K?YK?@O?H}(H7? 䨀hdςht(@ @K?@ @k?oKW(7C"4y8k?H(7?hx(\4z"@HyX\e4z"4yHk?\]4z"Z4\4z"8@HbP!4yP\4z":HwJ4ԃ7j6 4|4HwJ4ԃ7j6 444\4z!h@Hy(\4z!B4yPk?!K?\4z!X@K?!K?\U4z!*h`0K?\e4z!@K?\=4z h`X4K>@O?+4: 49 U4:4y8ˀK>4\4z>'HwˀuK>4\4z?@54ˀ-K>ˀK>@ @K?@ @k?ok? k?k?k?!K] 7C7%7'(6Htx&Hu&Hv *4y\}4z!ˀK>Hahap4y4zHb4X\%hx&HwJ4ԃ禒67j  44HwJz7j6 4 44\=4z&@Hy \%4z%HwJ7j6_ 44Hyp\4z%z#7 @\4z%P@Hz hzhHzxRHyh#X@Hz RHyh!JHwJ4ԃR7j6 4X4Hz R}Hyx @Hyhyp4HyH75huK6k77 44Hyp\4z$ 4 @\4z$@Hz RHyx!@H|h|p4HsH6whwK"6k7 W 44HwJ7j6 ? 4 44\4z#@Hyx\4z#HwJ磢7j6 44Hyp\4z#: [4Y @\4z#Hsxhsh"6#\4z# @Hyp\4z"4\u4z"4\U4z"@Hy\-4z"4\ 4z"p@HypHx\4z"Bhex4hdhfK>K?!K?K?K? @O?+4: 49U 4:Htx4\]4z9HwˀeK>4 \%4z?@44\4z?@Hyp4\4z:@ˀK>4\}4z;-@ˀK>4\E4z;@"4 \4z<4ˀK>4\ 4z?@eHypˀK>k?ok?k?4 7#%``7DH 2F 4 47Sy44c?ሣ_HH 2F4 47S4H7 # K?YK?K?@O?k?ok? k?K>7Dk?)KXk?1K8 k?!K>K>` K> K D k?04K?!k?K?)4k?@K?1K>K?K? @O?KPK@b@мKHмx@ _  : p6Wk?K?!4k?K?)k?K?1_=k?7U4zK>x@]: zk?K?!4k?K?)k?K?1_k?447U4zmK>x@!0ȠG4 7G""@79G6 jG!!@79G5 G< <@ 9G4 @k?K?!4k?K?)k?K?1_Mk?k?4K?!4k?9K?)4?k?K?1@k?k?K?947k?U4zK>"{46y @H4 7B 4ˀMK>_%K?)7K<@4UI4zK>k?ok? k?k?k?!k?)K>7k?1K>@(K>4 u@4 "4`4?"{6} 44UI4܂U14"{܁6h 44U94#܁p7 44U4#[܁87H 44U4#;܁7( 44U4#܀7 4U4"܀6 4U4#܀h7 4Ua4"܀86 44U4!5 7544 U7 ``4 `@ 4K>K?)K?!K?K?K? @O?44U4 [ܟ4H @44U4 ;ܞ4( `44Ui47#7  2444U94܀8K?1k?44w@k?7K?1_-4= 2444U4܀8K?1k?44w@k?7K?1_4 *44U!4܀(K?1k?@47K?1_4%Ku8QKs8Y k?Ku8aKs8i k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=7'6k>H4P4ETk>HK=74 3B4 HHBj4 4 4$4H 7>K>_=6"4H4RhC?H6v HhC?02K>46_7?!"7?!C? :#  *J K0J 4 @!k?G?46Wk?K>k?K>_ k?k?J74zk?U!67"`75p@"5 E47 /HI` 6 HH}4 04D 4zU4K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>"46 Hx4 RE7Re74zB7ˀ K="46 H4 R7R74zB(7ˀK=J J0JG?- 7 ˀ]K=k?ok>k>k>k>k>k>k>k>k>k>k>J7#4k>E4P7E4PHx74 B(4HHwB 4 4 Ha ? 7?y5_K>Ⴠ!Hv6hbC?Hy7 y hmC?_!"!"5-@J4 4E574E|57I X I J0I -x#47 H4 R7R74zA<7ˀK>Y4 8@H` @HH|~Ha  K>4U 4K>YK>K>K>K>K>K>K>K>K>K>K>@O>k?o7K>k?C$4k?K>!0K>4"" # 0"" !"  K K04K k?UK JˀPK>UIK"h7K?_ -K?4K>@O?K J04K v k?U)K?4ˀK>K K> 4J0K k?UK?'4ˀK>K H304 K3 k?UQK>4ˀK>K HT04KKT Tk?>g4ˀ]K>K Hu04K k?T5K>4ˀK>UK=4ˀK>ˀK>4 _(@0 @4@4k?ok= k=k=k=!k=)k=1k=9k=Ak=Ik=Qk=Yk=ak=ik=qk=y67>ik>4 7Ck=4 4 j?4 4j?4 4j?4?j?K>K=j j(j0j8j@6k=k>k> k>Fk>!44K= 4z5_7? '@C?/K>7: O K>I7k>"k> 26Y @RY6# 'k?H|ѳ7>k?KPb@ѳk?K8   Sk?7>!4z_5'7_5zI H!074IA k?59T5'B C?/@0 G?9@ 7?I_I  PJ+05J @  T4& H?5J4 4 4 H444z5_-7?1$7?1 2C?-' ""[6Y T 4%"C?-4"4?!7?1䂒$4ʃ=7"[4ȃ& "Z 0 B!J!Rk?G?)7>4zk?7>!5k?_k?&rk?7? 4zk?7>!5k?5_k?!ˀK<6Y R6!R$I J04IQ  7T5$4G?) HxK@v@G?)KH ׽]!H@C?/6 7C6I I0IK?9    HjIV4z577K>K=zK=4K4zk?7>!5k?_k?!k?7? 4zk?7>!5k?5_k?>K>ˀK<#7 4G4 R ]7R }74zA7ˀMK<"46 G$4 R 7R 74zAD7ˀK<ˀKˀKI JW04IT ;K>ˀK<ˀK<@ @K?@ @k?77\k?@ k?K?\400ˀBK?K?\7 4?k k(K?Y@7?k?ok? k?k?K>7C7$k?! k?)HtȠHJ4z844]4 "K HtJ#7 4G4 R}7R74zA 7ˀK>He0k 4H(0h| R h|(Hw0Ht7  hs0JK`47?}7D @ g?HdHHx7?K?!-7HfH7?K?)K`7HuH6?" YhyEHz |HvH| 7?V4H7hw4K>K?K?K? @O?k?ok? k?k?7C7k?!6E@4HK?!E7 K>74 h h(h0h8h@HxX hdXK>K?K?K? @O?k?o7?k?7"k?6 @7?ak?S}7K?K?4_m7?aK>@O?k?ok?KCX` X7DHhX4zHwR]k?K?K?YK?@O?+4:49T4}Hk?ok= k=7E7k=q46k=k=!Ek=k=+H9h4k=)7=k=yk=\%k= K=)\7?! k=44k=7=4HRk?k?Q4?4k?A44k?I7=qk?Yk?a_k?i zˀPKk?Hw`6#k?7 7?Ah`SQ6K?44z_E7?AK>@O?@ @K?@ @k?ok? KYh (7C4_4zK>k?Hd`4"hdh6 7?Ah`4S144z7?A4_%4K>K? @O?@ @K?@ @k?ok> k>k>k>!7#7D 7`p p44w? !24_=4xK=ٌp"*4 0W7>(k?p"4 We7>k?47>4_4PK= 44 G4 7A4y4K=K>!K>K>K> @O>H`4h` E 4 7>4S4 4 W-7>hh@Q}7> ֖t@7> 7?S4 ]k?h=@4 W7>%k?RY@k?h@Q7> :z@z@7> 6?S)4 puk?R@Uk?@ @K?@ @k?ok>k>7# 07D4?4 4 244_4 Jˀ K>Y4_=4xK>YK>K>@O>_4k>H`4 (h`4?4 Ek?"K>6 7?!SQ4k?RK>47?!4_-4K>Y@ @K?@ @k?ok>k>KD`47%k?"7Ck_`67?!4SQ4 Xk?4z7?!4_54K>YK>K>@O>@ @K?@ @k?70 0784?_@K?Y@7? *  4?4?!@@ @K?@ @k?ok? k?k?k?!k?)k?177C7$6 4 4Q47H :4Q]@ 7( @?5)E5!7!;59@R15H!RQ4EH7"{76y04Si74k?444z_ M4 ˀxK>444_4z"4z4_ 4!R154K>K?1K?)K?!K?K?K? @O?+4:@49`T 4|u@R4ςmK>He`4hy`!;59P54S4H X@Q5   Sq59p 4?459W 5>k?4k?444z_ 5>%@ˀ5K>ˀ%K>k?ok? k?k?k?!k?)k?1K\X7C7k?A"`6HXKP"k?K _ 4z7Q7E7"K?A767S 4R!4444z_4!@R44Hg`4hs`_ 4z7k?Q%7D7(#7K?A74S 7k?R!5:H '4z45_}4!@R 54K>K?1K?)K?!K?K?K? @O?+4:49T)4uHXˀ}K>K>HȠ04Ƞ@ H@HD H 4 R 9 H =@HzXK] =}@_}4zR !74z4_4>?4ˀ5K>ˀ%K>@ @K?@ @k?77_xk?7Wp4T_%4K?Y@7?@ @K?@ @k?ok? k?k?k?!a(7C %HXK  *_4zR 7@_4z7Q 7D|77k?47S4R 4444_M4z @R 4^HX4yk?44w4z_=4K>K?!K?K?K? @O?ˀK>@ @K?@ @k?77_k?7W4L_4K?Y@7?@ @K?@ @k?ok? k?7K_X7Ck?!K k?)K_]k?k?1Q 7D7k?9#K?!7K?1S17k?RK?1K?)K?94_ 4z *4K>K?K? @O?R)K?9ςK>@ @K?@ @k?/,opk>k>k>k>k>k>k>KAX7C7$H' 7_6k> 4 HvXJ 4HwX& 4z_EJK>Q77Qm5Z D7:ȉ !h7 4 k?Q5k?#K> 7S4R1K>R!5ZX:7>x&a9G&iEi k?4z558_94 4K>YK>K>K>K>K>K>K>O>@/0,Hi`5:hz`#75Sy58]4R5ςEK>Y@ @K?@ @k?ok? k?k?7%KYX7C_K& k?!Q7DT7< 7 4k?Q4#K?! SA7 RK?!4z44_!4 4K>K?K?K? @O?He`4hw`#74R44R4ςmK>@ @K?@ @k?ok? k?7CKZXKE _4zk?! 4 HxXK $ 4k?_Q4zk?)QK?!K?)Q}7 D6k?1#K?)70K?!R 7RyK?)RiK?!K?144z_4 *4K>K?K? @O?QK?1ςK>@ @K?@ @k?ok? k?k?k?!k?)k?1k?97C7 6_4z$HvXJ _a4zDk?AȀ04D 4? @x7 4 @HXK 47_4z \?_5J? @_4z#Z 4 H}XK  47_)4z <4 4 HtXJ 4_4zK?AQ 77Q4 `87H4Q  B_5)D$5!;K?A759@7R=4QK?AQ4`Z459PW5 W5QE _459WI5 @Q4k?44z5_a4!BˀK>D 47_4z 4 @H|XK ? 47_q4z̢U ˀHK>و<4?=@Ȁ@׀4K>K?9K?1K?)K?!K?K?K? @O?Qm5ςK>@ @K?@ @k?7K_X4k?K_ 4K?Y@7?@ @K?@ @k?7K_X4k?K_ %4K?Y@7?k?ok? k?k?k?!KG7C77%604Ǡ@ G@HzD 'h|Hw   4Q hgHw ZHz` Hs`Hy6} h}`Hg Hf H K>H|HA Hy(?JK> Hy?K>K?!K?K?K? @O?@ @K?@ @k?ok? k?k?k?!7Ck>4Pk>k>Dk>K> 7 Ƞp47>k?K>4_4z`7"{6y`4Re44Qi4K> 4#K> 7pR4K>k?4z44_4 B׀4K>K?!K?K?K? @O?D4HtXj(4HuXJ(@ @K?@ @k?ok>k>k>k>k>k>KVX7C7k>J 6_AJHsXJt(!7H}XQaK(K>QI7 Q14 D6dK>`7!z!`#7  ŀ!bk?HxX7 5:k?K>k?K(R]k?HaXQH:(H|Xk( HbX4 hC 4K>YK>K>K>K>K>K>@O>+4:490S 4 >5H}XQ@#7#7k>474 F6Hyk>57K>K9k>@K>K>@ @K?@ @k?ok? k?K_X 7CK( "+4:P49S }4 HXK 4zk?)Kk?1K(k?!K_ k?k?9Q7K?!Q7 D,7Zk?A#;K?979PK?!R E7QK?9QK?!K?1K?)4z_ K?A *4K>K?K? @O?Q5K?AςK>@ @K?@ @k?ok? k?k?k?!K>7Ck?1K>k?9k?A K>Ȁ04HyXK$ _ 4zK>7k?K?14zK?9_-K?A0ˀB!  HsXJt`"+4:490S4 D4(H}X"K76`R 7hHzXQ4D`7#7p77R 4Q 4HzXkF@ HuX4 j 4K>K?!K?K?K? @O?@ @K?@ @k?ok? k?k?k?!k?)K]X7C7k?1K _!6HxXK( 7HwXQAJ(K?1Q)7 Q4 Q 4 Dp7ZX7 r P"+4:P49S4 p-HwXQ @"(6"6"6k?HX65k?K?1k?RK(HtXQ -J(HsXjh( HuX4 j 4K>K?)K?!K?K?K? @O?@ @K?@ @k?ok? k?k?k?!k?)7CKZX7k?1KD 6_I4zk?9Q 7D72 b4`7!!4d  K?1K?94R4QMK?9HX K( "+4:49@S4 H}XK0@ 04KW 4F ?44D %4 HsX j|0HgX4h 4K>K?)K?!K?K?K? @O?Q @4`M 4b5 @ @K?@ @k?ok?K_X7C k?K( "+4:`49S4 ZHzXKZ8 0@QK?D7Ȝ`QY@k?QAK?K?HxX 79DXK87Q4"K? R6HsXjd84K?YK?@O?k?ok? k?k?k?!k?)k?1k?9KVX7C7k?AK>64^J  Xk?I 4 HtXJ 47^U4z7HX K8 "+4:49S4 r!z!4dK>!xK> 4 !zH}XK8Q4~K?IQ7K?AQ ! k?HX4 k?K87P Dk?HwXj8HzXKJ8Q!5ZK?IK?A R4QMK?I(@QM@4`u4b 4 >H}X XH}XK8QY4\K?IQA7K?AQ) \k?K8Q4TK?IQ7K?AQ \ k?Q4k?HX 7Pk?K8D HwXj8HzXKJ8QA5ZK?IK?A R4QmK?IH|XK8Q4K> 4R4Q4 HaX4 h" 4K>K?9K?1K?)K?!K?K?K? @O?@ @K?@ @k?7K>k?K>4k?K>k?_k?K>@7?@ @K?@ @k?7K>6k?4k?k?_}k?K>@7?@ @K?@ @k?oK_X 7CK8 "+4:49 S4HxX"K8V6K?Y4@O?@ @K?@ @k?ok?k?K_X7C 4K( "+4:@49S4HxXPeKHyXK:(PE7HXK0 !x6dK8@!HxXK@@!@D h4HwXJ7Q 7HXK0@!@HwXJ(V4HXQK(HeXh(HbXHY8 "2#[7YV4HuXJ@ ":H}XQAKH}X4K?YK?K?@O?J>u4(P} HXK04  ?@%K8P%@HxXP@ @P4"4 R6HbXHZ04KT h@E V4H|XK0Q % HvXJ04E ?E Qq@HaXmh 0V}4H|XQ1K8HvXj8V=4HtXQJ@HsXj`@@ @K?@ @k?ok?7C44\]7Z 7H `"+4:49 S4XH H(^4zK?YK?@O?@ @K?@ @k?77?k?_9k?` 74K>@7?K?^K?K>@ @K?@ @k?ok? k?k?k?!k?)KXX7Ek?1K^KK?1P77P4 Dx6(`A(7 K?145R4k?Q4444^ 54 B4K>K?)K?!K?K?K? @O?Qi5K?144\54 7k 4]k(k?H`4 h`K?145RA4wk?44 F4 Qak?9Q7K?9@7ˀK>@ @K?@ @k?ok?^=k?k?!P}K?K?!Pe7 D67k?#K?K?!70R7QYK?!K?44^ 4 4K>@O?Q4zςK>@ @K?@ @k?ok?7:k?P%k?!D7(7k?#K?!K?7@R7K?44^u4 4K>@O?Q4zςK>/0'@@@K?@ @/0'k?/,o0H k?!7:Pk?)D87(7?/ "K?)76`RI7k?K?!44^4 "4K>O?@/0,QY4zςK>@ @K?@ @k?ok? 7k?^ -k?k?!K?Pek?K?!PM7 D7("K?6K?!7R 7k?QAK?!K?44^4 "4K>K? @O?Q4zςK>@ @K?@ @k?ok? k?k?k?!k?)7C7k?1^ k?9(7!"B"R* Q@ 4@4Ka?H?@ 4"4  Hh`5h`P4C|7(k?A457R 4Q 4K?A 44k?PmK?17PU4 C7K?1744R 7k?Q Q4K?944z^4 4K>K?)K?!K?K?K? @O? 4L4 4L4U @@Q i5ςMK>@ @K?@ @k?ok? k?k?k?!7C7k?1KY Hz؇_ "+4:@49Sy4T^4z7k?K?1 4P @7P 4 CL6#7K?177Ra4k?H44h4H^ 4z :4K>K?!K?K?K? @O?Q I4ςK>@ @K?@ @k?ok? k?k?7k?!k?)^k?1 7 :Z!: Q @4@444k?P K?)7P 4z C<6#K?)774RQ7k?Q4zK?!K?14^4 b4K>K?K?K? @O?444@4Q4ςK>@ @K?@ @k?ok? K_7C X7$HvHx  4JK`6y74?hwH؇ RHuHw 4JK6`674?hHa4< h|Hw 2k?44z^4 P@HbDhx4K>K? @O?ςhdˀK>@ @K?@ @k?ok? 7CKX7$Hw hd :k?44z^4 B4?h}Hz@ JHy77? hhwׂ4K>K? @O?+4:49R4Hyk?H4 4z^4mK>@ @K?@ @@4@ @K?@ @k?ok? k?K_7C7%k?! 6Hw 䨀hd4P Hy :k?444z^4 hek?Hx 4zK?!^i4K>K?K? @O?+4:49PR4HwˀK>k?oQQ7CQq7Ka?7 @4:@k?# Kx7P4w(K>#; KxP790K>@O?k?7_@C4K?Y@7?Ku4Ks4 k?Ku5Ks5 k?k?7Kxk?#[ Ka?k?7Y@4:@Pk?K?K?_-K?Ka?H9@78?`Hh8@Ka?H?H7h7H4K?Y@7?K?_4K?Yk?77_k?17?9k?)k?!_k?9C 4K?Y@7?k?77_k?17?9k?)k?!_=k?9K?Y@7?Ku9!Ks9) k?k?7# 7P_k? @K?Y@7?" 46F4 k?P]7K?k?Pm7K?K?_-7eK?YKu5Ks5 k?k?ok?7C 44F4 KxKa?4:@k?Pa7Hw 8@ `K?P)4 h?4cK?_4K?YK?@O?k?ok? k?7D {  Hk?!44y F4 K?!Pa7HKa?44yPFX4 K?!7P4Ka?H?K4 P4% K84y4PK?!H ?@K?!Py4yK>K?K? @O?Ku5Ks5 k?k?ok?4^[ k? 7@xk? `PyK?C 7K?7P 7" 6V4+49V4_4K?H C d4+749P 7_44K?YK?@O?Ku7Ks7 k?k?74k?k?_7?K?C 7K>7@7?k?" 46F4 K?k?7K?_K?uK?k?oKx17Y { Pu4z@44y`Fh4 PE744yF84 P7P!4K?Y@O?@ @K?@ @k?ok?k?7?1k?1k?)k?!!0k?944C@ K?9 7B *7?6`Hw bB *7`?64c?`Hw?@K?YK?K?@O?P4eԠH>7P4?ԠH@? u4k?ok?7#k?PA7:k?@wPK? X7K?4U 4y 2@Pa4?744K?YK?@O?7KYC77, WǷ@44?@7?Ƿ# 7 .& U KYC87?'00N9F8G'I  J79YC3 X6?Ǹ_M w @7? ]ǽ2KA4<\C XǸ_@4?@7?k?oK_4C7Cx x7 b@Y7v, _ǿ@_4zHC4] 2ϟ@K?Y4``J4r@:6?7 aK?Y@O?ϟK?YϟK?Yk?74_ 24 4X 2ςK?Yׄ4K?Y@7?P@K?Yk?7N:N!JJ ‡FF BbB B@ "P=@K?Y@7?# 7P" 6P# 7`#[ 7\#; u7<# ]7"{ E6|" -6 k?7_ @_7K?Y@7?Ku2aKs2i k?k?ok? k?k?k?!k?)k?1k?97'4Pk?A+7444( X 4* ` GP  | B G 7 (@  K?A_4x j4?@4K>K?9K?1K?)K?!K?K?K? @O?+48 P k?ok>7#4k>4P 7>k>#7>  Kw1  #Zk>K>^?*E$K> p7K>?@Z"K>@ 4yȜ84K>@ 7>7@ 7>4K>YK>@O>k?oK?7Cr Z:7? 87='Hz'8G'FC  |K?Y@O?k?ok? k?k?k?!k?) 7Ck?44 U9k? 44c 4@4#4x#4V4z! @P 4z0 _ w 67B7 @ R4@4 Z@_ 8"@?7044K>K?)K?!K?K?K? @O?C48"Z|4_77?7?_45? b K?7, VǶ5?@J w  TǴ26?` @ w  Yǹ_6?@2 w  "6? x ' (4 w 0H64`4@| S4 y X@ w 6  <]m7 w  Z Y? w }? 5?4\ 7\ w  w < w 6 u < w 4P 14z77?7?_4@y4x: (K?4P4y444Q4x4k?ok? k?k?k?!44k>k>KEXk@XKFPKD`KCpK>kPK>k@pK>k xK>!C`!B|7?QK>K_^7>A@7?Q7 (@K>7>A87?Q7 @@K>C "K>7>@ (7?Q7K>KP 2# 7B7?QK>jPKX 2" 60B7?QK>@jXKxB *# 7pB\7?QK>jxK>7?Q@`4K>hPK>k%XK>kD`K>kpK>K?!K?K?K? @O?k?oBh7CHz@ @P@Hz@ @Pu@K?Y@O?k?ok?k?k?7C@7$44zTA4HH @H@@4H0!jH Ax4H8" H(B4H"H B4H@#RK?YK?K?K?@O?C0  |HPy 7C4Ha% \4HsHe  T4H@e_m@H0Ch u |HP % 7C(4H 4HtH  T4H _wHH8C  |H E P@7CX4Hx  <4HuH % T!4H(_e@EHC -h|HP 7C4Hz E 4HvH  TY4H_wHHC4h|B 7HzBHeK?Yk?ok?B X7CHz@ @PI@ `h`HHw H`X4HHw  P@HwH4_@PHzh`Hz@ (@Bp@PiHzh`K?YK?@O?k?7_k?_5K?K?Y@7?k?ok?k?7#_-7 4B4z84# 7P4B4zHd4K?YK?K?@O?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK27D7%B_744444)4 +4, k>4+ k>4* k>4. k>! 5@7j,! 4 4?47W?u4? w ǚ6\ C(b _ AǡRH6V B((@ _ VǶ_@k?444A4x (7H Y4A6YH^4 rk?444A4xH7^4 6S  06Qh`_@Hp Thp 0HH7 Hy@ 82H6 @? ?@HC0 7  bhh44@T4x 06Q (7H ?4A69H@ ^_HC (4 244A7?Y P7Hǡ K>@K>Bp7?Y4zB7?Y 46B H4^ޟ4^_ B8444B4x$7H^_HC#7 7?A4A847B7?Ak?B7?)k?B7?A 0H447?A@7?) (7H "4A469Hǹ@K>@K>BX7?A4zB7?AHXB5BP7?)4zB7?)HX7?hXHP HX*4zB7?)HP6?hPB7?)B7?A 4H@ @9 @B7?qH52 44A7?qK?qK?y] 75B7?q4zBX7?qB7?q P@H^rk?44k?4@@4xHPH4ZҠ_4 H7H^r44A4x47 ! bHƿ@4^_ A444AL4x74 !*HB_@67W? :H^"44A4x7 H H` # 7B`4zHp@ ZHoHp " 6B4z_Hp7B4z5<K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O> %@k?ok? k?k?k?!k?)k?1k?97& k?A74B77?iA44 !x4K?i A`44x4 7 7 K?A4_4x!7K?i@ 4B 4zHC?m@7 4B 4z`K?iK?A4AX7? 74zB 7?B 7?K?i4_4 HsBz?4| 4B 4z4B 4z4K>K?9K?1K?)K?!K?K?K? @O?B 7??GHsK?ik?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Y77#k?i 4k?a47B k?qHz7_ 4C4(04+4( P4) X4 4K?aK?i4y@PK?q 7HwB( H}Cf!44K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O??4O Hz474 LO (7 Hy_5x :5? L@>H}UK?a4K?i4B 4 , B K?iK?i4B 4Hx  yK?i4B P4Ht6 uk?ok>k>k>k>K747#k>B!j4!4!r444!4# K>7B `4Hy7: z_4z7 " 6 7?QQY4K>BX7?Q@ * "HC7 0 g44K>YK>K>K>K>@O>4y_u4ܟ44k?K>4A4yܟe44? jB J K>4B4Hx7 } 4̂5@>%@_Q4z@k?ok?K!7#4k?@?? "4y_4 K?Y4ڋ_ :# K?7B4Hu6 vHtB7d, YǹX@HyK?B84Ha45 uB Sdz_HyH|C4\ "{ K?6y0B4Hv6 yC? XǸX@HyK?B`4H|7 tB ]ǽ_HyHuB4ʊ # K?7@B4Ht6 xC WǷRHyK?B4Hv6 sBb ZǺ_Hy4K?YK?@O?k?ok? k?k?k?!6K77$k?1B47E!46 _14 87H H`_4 4|!4ڊ :# 7K?1B4H4 " 6PK?14B4_ 4@`4|!r`4|H " BK?14|K?1B4h4|>@K?14_4|(4|\ @ g?aK?17?aB4K?14B44| _ Q4>@#[ 7Y`K?1B 4 `4|#; K?179pB4(4| *K?14_m4|4| !4? B4k?K?144@4|4|_ !477R 2# K?17A4HB4k?9H7OE4K?9 F _H (k?A" K?16PA<4K?A 0K?1AK?AOK?A@ATK?9OK?9H  4|K>K?!K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>K>77)K87 97CK>6444 $4 AD4z7I?C40#7 ,_5:$7Hy @HzLD_5:$H$ A,4 $Hx A5z" 4z@597A$7?1'r'44z595_5'7 II B 6Hx <6Hw S IHu 4A5A5K? 5kxd4J>7?17 ?4z59_ 4&7_5:_m7OI:WK? 5A4I94A\5 p@B D5Ha+ \5Hv S I9Hu I4 u /_5:Ak? OI:K? aHpǰ8 ! I:5T 404  @I9K? A4 @I9K? A5zI5K?  ? " 6pA47? @5:!"5A7?1YK>K>K>K>K>K>K>K>K>K>K>K>K>@O> zK? B$ h|K? 4haK? `2Hs  7K? @K? a4 4 4 ! 5A4I?C;@7 74z59@\7?1=74A$7?1=@K?9K?1 YB5Hs k 5H} SK?1H} o 7?1 @A@K? 7?qAD7O4z @A54 *" 6PA4`@HBz?4|] " 6A4" 60A4 0]@HH ? 8484zAx4 5k?ok? k?k?k?!K_7G7$K>76^"{ 6y^54  b7 }^4z""H   C4X!@H^_ 4^4 P 4^]4 ( 4^54 H4" b^4z!BH   @C4 7ς z4^4 ` 7 f^M4z H   C4 4K>K?!K?K?K? @O?ˀK>7ς }ˀK>ˀK>7ςm yk?ok? k?k?k?!k?)k?1k?9KH7#7EK976h 8 & 4#7?Ik?7?A4_4%@A 7?YHyK?A *A\4Hh_ HH hh! 5pA |4K?I4 4 7?YA ,@K?IC7#R!47?I@7?Y$*4 t44y@7?Y 4A t7?YHsB 8 4A d4A <7?YHCR" 777! *44yA H7?Y?/440A 4A 7?YHC70 w0K>7k?I7?IA 7?Y"z847:O 4x @Hy <@ @A |4(HyHy4A L4Hy4  hA T7?YHh HH hh 4pA <4444 4 44yA7?Y>40%47k?I47?I@ 7?y 5A 7?Y7?YA <7?y5A T7?YK?IC j7k?I7?IA X7?Y :4A 7?Y5A4K?Iu7?YA@K?IH4"?h50Al4Hj@ Hz4S%4 zHwB4V ZBB B7z1O y "4 A4@HjHh7hh4HyA4Hj F  K>K?9K?1K?)K?!K?K?K? @O?k?ok? k?7#4k?!7:^=k?)77ȠJOHz@0@K?!K?)4y_u444K>K?K? @O?k?ok? 7C7?k?4Ak?A4zk?!K?4z_7?!@HxPK?HsXrHh K? 'k?K?A7?H}X8@HyP76?hvPk?K? $848A 4zK?K? ? 848K?!A4zHb+@߿49 @_49 0A\K?K?A7?4AT7?4K>K? @O?# K?A7HzX7U?huXk?ok>k>k>k>k>B67#k>K%7D4"H^޿^_" 6@^ M5"h@Ad7>K>AT7>44O}7>7>^]4A!z44K>4yA(5K>4_!4y! 7 eAK>K>A|7>4^7>5C @C :7C b?7C?7 ("7C ?77?A@>4_7>A7>4K>YK>K>K>K>K>@O>4K>44yA85Ÿ}4k?ok? k?k?k?!7#7DK:Ok?14Z" Hz6PSu4  2# Hz7`SE4  @Hy7: z4hx#@7s, VǶH"4(ȠhHPHƟ@ ^_b [ Hz4YSu4"2H}7 |4hPO9HzZ Hz4S4!*HtB7z1YNu@!HCC!bC4 R7 v4K?1hX4@4y!@44 7 u4K?1hP4@4y 4H^ _@ Hz4pSm4=HHs6a a4hXHf44N47 7C?7 4? 2# 7U54@ 7? <H`ȠHPHz!J@7u, WǷ@:4 *4_ 4? 4 Hƿ@ ^jǷb4 f^E4zHyAK?1NHzHt x wƿ@:^"^_HP7^_hP4 bHƟr@4v Z@4< BN@K?174_ 4y4_@4 @4ڂ *4 b@4 }( BN@K?174_ 4y4!@7t, VǶ@4 ^޿ ^_K?1@4z!@ 4@?4#[ 7Y@^4 7B0ȠzK?14_=4yȼ4@ 2K?144y_4ȼx44HP HX BHyK?1A 4NHzHa  b4K>K?!K?K?K? @O??4EHPKu5Ks5 k?Ku6QKs6Y k?k?ok>k>k>k>k>k>k>k>k>k>k>K?47#k>C7D4 P4C7z1YN @ HC#@HC C :C4 + "C4 C"4 7 :C4 "C7z1N5ҙ"HC `@C! әN5 *7i1Hz_}59$7 Hz4S4'XHz4PS4 *HC4҃'4̂'44K>YK>K>K>K>K>K>K>K>K>K>K>@O>_7y17HyK>AP5Hw  }7_7y1"*Ƞ4Ha49 y^ 4&7Ƞ47 sHX6hXHC: 7 jJ A_7 iA?5:!+4( P4) @7j,4+4 4 J ( k?K>44@ @4yȼuHzk?K>44k?_4yȼ-Hz _ XǸݽ@^)4zHzN7}HyHz_7y14 ZH=@H`߿95AK>Hy7: zHzC_>m@ { A4y4Hy78 x4 C R4 4 k?K>44@ 4yȼ:k?K>44k?_4y7!rȠ=4^4z@7N}Hz@ Ƞ4@@Hz5S%4 HC46 CC rN}5: P@K>A 5 HbF  z_59@HHyK>A4Hh   H>u@7 yH+߿49 `K>_49 pA @NHzHyK>7A 7H}  b7W w^4z97Ƞ44P7?!K>A 7?!K>A 4O 94N HzHz \ 5 a7 nA+ 84' 4 (4'  R4 4 zk?K>44@ 4yȼjk?K>44k?_ 4yȼ(@K>4@ p4y7 "HtB Ƞ4K>ᐠ A 844k?ok? k?k?7F6k?!7#Al6Hy77R]4 H^4 87K?!A X4O4 @HyK?!A 4Oq4Hw  xK>K?K?K? @O?k?ok? k?k?k?! 7CKZk?14`SQ4" 4H}7k?C 47?^@!K? k?C C 7k?K?Bv?7?Hx7 wB@ 44z^@!7N 5Hz`HyK?1A 4Hw  C H@CF 0@K?1A4Ht6 gHuB ?4zK?1AP4(4Ƞ4Ԡ44K>K?!K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>67D7&@7k>4 4 4 0@HPӀ_HXӇӀ_'A7?9A7?QHB4H#6 ^4 H |@r44K>YK>K>K>K>K>K>K>K>K>K>@O>H A7?9 c5I?+4- k>4: k>4 4 5,Ah7?QHCW 4 7 HCw"k?44k?47?9_7?Q#7K?9< A7?9"4 @ZJ^4"744_57?9PK?944@7?Q"877?9A7?QK?9K?A ? 848@ 4 `2Hǵ K>@K>A7?9}5)?K?9 ^q4 7Ƞ4B4?67?0 Ƞ4 ` g?1O}7?1HC74 7 H7 <}@4=H7 ^ A4 H }'HȠ-@4K?9K?A ? 848K>@ 4 H+߿49 _49 @T7?9HX!; 59@$7?97?9@7?QK> "4z@7?9p@HbHfF :H+Ѐ߿49 Ѐ_49 @|7?94zA7?9@7?Q@7?94KA@77, S`_ˀ7?5KT6WB ]ǽK=46B S \6? dz_60V0=4@k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7D7&k>@<7?1@,7? @K>+4" @k>4- 0k>![ 44447i,5Jx!{ 4 4 44T4LHB?7? 4? Q 4*?HHC6?QB4 w)4 )4)K>4@ 47`04@? @K>K? K? R#[ 7Y@|K>K>@47? @7? @@7? )`04 4|6 HǴ@5y0@ 7? `04?6 5yP@7? `046 K? K? H@C ( *5y@T7? 5y@7? 5y@7? HCM *444^ 7? 7HC 7 5y@d7? 6 7>_4 K>H@@"4=WK? hK>H 7?!Mk?!6 K? K?_ H@C ( *5y@7? 5y@L7? 44@ \7?  (@HC (0 Ƞ@&J;U@7E 6 045y@|7? HCS 84HǼ K>@K>@\7? HC? ? ]ǽ@^q4 k>NHK>@ Ƞ@H@7? HK> X 4 4! 7?Y4_ 47?Y@7? 5y@47? @HC4 4 4? *^H6 7H7 4CS!Ƞ5@ k?@7?qk?444^7?q8e7K?qK?y 8@7? @7?q5y Bk?444_ }7? >=7Ƞ-@"44@<7?  HC Ƞ@7 HӠߒ 0/K? K?_ 5y@|7? ^Q6:7@T7? 6 HbK? K?Q 5y@,7? HB^:7@7? H6% k?K>44_ 4ȼU@7 7>_4 K>H(vGHȠxK>7 ]4 87H H`]4 4K>@@@7? 44|K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>H " @K>@K>@|4̢K? Ku6Ks6  k?k?ok>k>k>k>k>k>k>k>k>k>k>k>7G7&k?977?A44@D44 ![ 4 4 4 44HC ( 8""#B#Hh@HHz_ 5Y@4zHB]Ӛ7@4zH6 4Ny4c?%N1H4H   47?9_}4K?94O 4HhHo 4@ 4z4z@ t44K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>4k?4k?44^7?A74z@ d7?A?47 HyHt 5Y@ <4z5Y@ $4z7 HxHsx 5Y@ 4z5Y@ 4zb7 HwH} 5Y@ |4z5Y@ d4z@4< HC:@4? ; 4< ( @47 HuHi5 " 6@ 4z"{ 6y@ 4z47 HtHh # 7@ 44z#[ 7Y@ 4z47 H|Hk| #; 79@4z# 70@4z%47 HaHl, " 6@D4z# 7@@$4z47 HvHjV ! 5@4z! 5P@4z547 HuHf !{ 5y@T4z![ 5Y`@44z̨47 HtHe !; 59@4z! 5p@4z̪E47 HyHv  4@d4z 4@D4z̪47 HzH|\  4@4z [ 4Y@4z̬U47 HsHbS  ; 49@t4z# 7@T4z̬47 H}Ha= " 6@4z" 6@4z̬e47 Bt7, X_ȀH4 4C.77?!7" @X 8p47?!HB  6yH6` C9 ?HHA 4Ƞ47?!  H6M NAHH@ p47@7?q44^7?q @K?qK?y ? 8484@ 5H}Hb] ! 5@T4z4z@ 7?q@4@|7?qȀu@k?ok? k?k?K747#k?!B 4 6 a@7404 *4 K?!@44Hb4_ C7e, _ǿ@׀4K>K?K?K? @O?4 ˀK>" K?!@|6Hf4ςu ǿp@4&HzC_7y1c1@K?!Hy78 xC Sdz_@ # K?!@7 ςK>k?ok? k?K?7#4k?!C7D *4K>K?K? @O?7 s] 4z`7ˀK>#[ 7YP@K?!A@4k?)Hy7R14K?) E ]H 8k?1K?!@07NK?1(H}HyK?!@4H}  tN1K?)ςK>k?ok? k?KW4Z7Ck?!B jc1K?!@H7y1Hv6 aHuB7d, _ǿ@:ˀK>4V?Hu6 |ǿp@4%HzC_7y1c1@K?!Hy78 xC Sdz_@4K>K?K? @O?k?ok? k?k?k?!k?)44HC!7 ]4A8h|@"HC!Z7 444z7CK(7%7@7H_-@Hy7? ph}ˀK>A H4h|@`7Hx4z_Y4 ˀ(K>@ 44K>K?)K?!K?K?K? @O?ˀK>Hz@?@@@-HxHy@p4H 4z@5ς5K>k?ok? k?7CKZ7@ k?!Hx@HH`b *4htHA x40 | WhwHHzA  |A (4K?!77R 4 `H@7hy@H} K>K?K? @O?k?ok? k?K_077Ck?!KX @b *4 hs0A 4(0 | Whw0HzA |A4K?!77R4 H 7hy Hz _ K>K?K? @O?k?o7CKZ(H8@b *4 h}8A4(0 | Yhy8HzAh |H|(7h(Hx  K?Y@O?k?ok? k?k?7D7k?!6A7K?!77R4f H K>K?K?K? @O?k?ok?KW 7C@jH6?hd   *N@Hw HHw _6?Hw(@jH6?hd(  *Nq@H  HHw(_6?K?YK?@O?k?ok?KW@7C@jH6?hd@  *N@H HHw@_6?K?YK?@O?k?ok? k?k?k?!k?)k?1k?9k?AKG7C7$k?Q4X4!{ 5y@H7HA ![ K?Q@5YHC4(0 4ʊ HvcZ4!; 4 4 ("B7 C *7?_)4 ˀK>k?H@ ^_Hy@4c]4k?CH^ޟ ^_K?7?k?K?cHs@czHx`K?4A?Ak?HyK?:  0k?Hs@K?Q@597?4z_7?a"H}@K?Q@p7?a@7?aHt_-4K?7? k?H "HuK?Q@594z4_7?a" HtK?Q@7?a@7?a4HC(0 <@Hx\@HC4ʈ" b7 HwB #; K?Q@ 79# K?Q@ 7 Hz# K?Q@ 74K>K?AK?9K?1K?)K?!K?K?K? @O?ˀK>7?_4<7HˀmK>ˀ]K>ˀMK>ˀ=K>k?ok? k?KD7Ck@H7hwHe_}h`k?!Hz@ @@ @hdHy78?hxK?!heK>K?K? @O?k?ok? k?k?k?!k?)k?17%K977D6 7@ 4z4@ p4zHz@4 Hs:@4 "444^4wH^ޟ ^_J HzM4 0&H@HzM4 @&HeH `ZC4ދ BC49 *C7z1M !@HbHz B *`R 4] 4 *HhA 7z1M 9#HC4%0@C%C4ފ C4$8$C7x, UǕC ZǚĨ@C"Z+444' P DM u 0@Hb 4Y]4%z4?@K>HsH ` 74])4 +444( PHxHz X E  M e6?< *H  7]58#4?}@K>+444' PH|Hh D  M6? *Hy 79]5#R4?}@@K>4‹""C "+444' P DM 0@Ha 49]!4#b4?@K>Hg4 k?7?4_)7?i!0@@4z4`@4z4z@7?i@H7?iK>7k?7?4_7?i @@p4z# 7`@h4z4z@ 7?i@7?i0K>HP7hP@4zK>K?1K?)K?!K?K?K? @O?HX4EhX@4zK>@`4z4@`4z+4& X @84z4@ 4zK>@4z# 7@4z+46 X @4zK>@4z!; 59@x4z+45 X @P4zEK>@4z! 5@4z+44 X @4zK>k?ok?7CKZ `7$`@4@@4 |  | dK?YK?@O?HwH _K?Y _k? $  Y@@7?@ @K?@ @k?ok? k?k?k?!k?)CB77$#7W7x*444Z44^4\` _#Z J4~V#4T%jc@ V#"ςpK>@%`߿ ($% @?%B60B4 6046B64A`_ (@B6` @%4%Bc6 `$] jB ZB`_ (6B6 $` B6cĂ B6 ( r4~4^4T @!# @#B6 ( E84!4ˀK>قb :@$B@6 86b?@ ZςK>@ @Bc6 c@ "B4@<]6@#Zǃ 4^#R4K>K?)K?!K?K?K? @O?@!R`!R`߿ (7$ "`/B@??BςUK>6?k?1`_ (@B@7y*`&  @7g*4 `  *4xK?1__%4 4@?@ςeK>ςUK>ςEK>ς5K>ǣoB@4\ςK>ˀK>ςK>ς}K>ςmK>ς]K>ςMK>7@*c  @7%|@b:/4AςK>ˀK>ˀK>CW 07\ *7C?@4@k?ok?k?4?KwKxKy1 h x W W  araX4 P6? D X Ҥ `6 e4c_7`@ V   ֠ 476 m7 ` aH4P6? X ҃7 @67 D_4B`@ X  v 7ր 4\6 m7 7@ } Ku1Ka5kuK| kbK?YK?K?@O?Ku5Ks5  k?k?ok?4$k`Ky1ky77z"_}kyk|@4Z 4bHkz4V b(k`ؓ0k`ؓ0k}4|K?YK?@O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K>4'k`1K17Hk?K>7$7k? 6 4%Kt1 J4 0kj145_474k|1K 4#C!0@K1Km hkKn hkKo؍%KbKwW%% @_4K1 8kkhkh1K1Ƀ& B4ZU&B&6 (4 0Z4 kv #*K}1 4 ZB :K?"B _4"KmA4 44 84 ?4z "5A ?5I:4!51KyQ] - BKJ:M A !Z@0 6*61 J:@?}6*ku1 6 kp1kjAW 24z "5JAW ?5JI:* 4 KyQE * BKwI:M ) )`05+5) I:@?}5 6 46* #:@#K?@&Kq1 B &rKrB__4&BKa49ky4@+j_}5YKC@0Ka14,@0kl1Ƀ&4 t&C4= C4vS'"C,C+C+k1Ku16 kj1 (kK1ɉ@z C4Z C J7`8k1 C?7C ?7k:K1" M 6`:WK1Ks16k1KwKx ( 8_4khKKw (k1̟4Kmؑ0̟7kr1 4hkq1Kh1 BK|1Ka? \ H4:@4YpMY@M KzKd k}k`1Kd144~kp1Kv16k1A! IW 50kf1Km1 !7? CKa?l 84:@#HIWMI7@@IWk? <49CHMMKzKb ksICkc1h4~ "@7kb1 kh1M1KzKeK? k}K? I_ID  44Kz1 :7?Ka? H"4:@M6pMYKzKx kxIZkz1@0tt4~4Kq1 Kl1 Ka?4:@C 2"HKwL6@+Krk?"6CHLk`1K17kz17e"ke4~Kg1 zKqKa? 84:@!H5@L5W(+!H5L5Wkj1X4~C4 44 04 k1K|17kj1_=kjK1ɋ57Kp1 8@Ka?"H4:@6L5Wkj1@ 8t4~`4545+ +Kf1 :Kv1Ka?"| H4:@L6yMKzKa ku4~Kr16Yky1ɀ "AS I 5Iki1Ke1 8@Ka?#<HIw4:@L=79`LKzKx ki4~ 0@K1ɉA*7ka1 kj1LuKzKd ksK? K? @ -IId  44K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>Ko1 :7?Ka? H#4:@Le7pLKzKn kl@0tt4~4k`4k`1k` "k1Kt16ki1K1ɉ Ky1 8@Ka?!H4:@5LM5Wkj1@ 8 t4 ~k`d7kn1 km1k?7K?k?_ Ek?K?Y@7?@ @K?@ @744_774666x77Y7!4=74 44477w4474 b6b:b8b<b>b@@6 @P@K?@ @Ku2Ks2 k?k?o_4 (744|K?Y@O?_m4 | 274  wM4z`u4|@ @K?@ @k?ok?k?k?4@4744z  | f7C 04Hw7$Ԁ2_4?gHy@7HsHz d  thu7K?YK?K?K?@O?_e4 7Hv7H}m |@ @K?@ @k?ok?7CKZ@ M1KD?4M4zK?YK?@O?@ @K?@ @k?ok? k?k?k?!k?)KE7C7$ 4H 44H?H H!2Hz 4KH r F84M@54?}@]HM@]HK_MA@507G5?/KH d04 g4 sHHz MKE?4 dH @HH@?@ g4 vK>K?)K?!K?K?K? @O?@ @K?@ @k?7Kv k? I7LK?K?Y@7?Ku6qKs6y k?k?7K1 kz1_4k|1K?Y@7?k?oKs1 (7C_E4Kz1( \_4+~4= k?Kx1Ka?k?C4:@ 7w"#<2@7w#L 79_-4K>@O?k?ok?7C@04_4z 7_4z4K?YK?@O?Ku4!Ks4) k?k?ok?7# 04 _E4zȜ@_m4y7 @_4z4K?YK?@O?k?7Lk?7_]k?k?K?7PMK?K?YK?@7?@ @K?@ @k?oLEk? 077c0K?#7PN 4zK?Y4|@O?k?/,/-/.ok?97C4@"(k?@"K?B 4Z":cr@x4"6.`7?a \ &00N8E&E_7?aa"#\7T. . 7?aK? ''001n0N 1A 'I9 @B7`!7?a$'('(08G'0G0N9E'8E0 8_7?a4K>K?9O?1/0./0-@/0,7:B4` K|1ˀK>}K|1mK|1k?ok?_4(70`"K?B4z04K?Y4|@O?k?o@ MKC `?4zK?Y@O?k?ok?7DKZ7#K]KS } `@K_77? ҕu B p4@ P4HK_4xKVB 0  H4ˀ K?YK|1?HK?YK?@O?K|1?@k?o7C_4 7 K|1Hwk 4 K?Y@O?K\K @_K_@KK_@K_K @kK_KK  P4@ K6? \0@4@KWJJ@  k?ok? k?7DH7k?!4Ak?)!@7HK4KK?) B @K?!!@H H? J@@ _h H(7_] h( HH(6 h4H( @Dԃ DK>K?K? @O?K|1A4K|1H(4h 7A4eK|1 `BKW7`2KZ( Y CӳK@ˀ@k?7_ 4 0K?Y@7?k?o7CKZ@ _@M4zK?Y@O?K_ KW0Y j Y@k 0K\K ??@@4@K_0?@kY0k?ok?7CKZ0Y 07$K__h0Hz0D?@K?YK?@O?@K\0k?ok?7D_ e4@ 0744|K?YK?@O? d44h d ` `Ah`0 h|8`}4|Hw _ ڋ?Mh|(AHz8`54|k?ok?7CKZ0@ _KD?4Hx7?`2H( A\4?@LUHz(_}HzAHz8L%4zK?YK?@O?k?oK_7#C 7ˀHk]Ks1 "LM6k|1Ky1#K|1K?Y@O?k?74_-k? BK?_ 4 @@(K?04K?Y@7?k?o_u7Ck?Hw4HzC_JJ 8  k?i4 r@4z "@K>AX4z 4z_5K?4K>@O?7?a@4z?@H|C?4z4?w4zK?a??47?iA4z?M@%4zk?ok? k?7D_ 7#k?!H44@_ Pk?I4 b4"4@4y"K>A 4"x `HC@0C4!(@H76hK_KW"6A "47?I@4!4H@94  0@K?!4_m4!X@A4!:K?I04 }4A4y?GHK> `7?I@4 @HC<4 p@K?!4_e4 P@A4 2K?Iz04 z@ `4K>K?K? @O?K|1?@7?Ik?ok? k?7Ck?!_%4!7Hd@4䃟 4? 4_!:AD40!74z@4HzKW4@KTA  z4HzK_4KSA  !*H_4zA4P4Ke1?HzH_E4zA4 jK?!@4z H74z_U47044Ke14K>K?K? @O?Ke1k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>7C_m7$k?aHt4k?B4&44`4 4 4 4 !444p4r@4z"B HsBu "HK?_4z!HtB@!:_(k?a HQ@* ?H@R @ (K!" HzK_5 `KYA ?  ˀJG!A 4z!"K?a04 4K>7?a4zA`4 ‚K>HtuHs <4< K|1?@pK>YO?@AT4z?u@0K>Y@0#@ 7 pK>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>k?7KB4`@_ @4r`@`@ bhK>4 4! 8?@@04K>@7?4Š44_g44Ƌ :K_C0C4074@7??E@54#7 k?o7C47?@4 @K? #<p7< 0Hx8@4z H@HzK_KWHx8A  44K>@O?K|1?@4Ku4Ks4 k?k?ok? 7#k?4k?Ak?! (7K|1K>K? @O?K?K?4@HK?!HK?_ 4 |A4ˀ}K>k?ok? k?k?k?!k?)k?177D k?A4H! JHC4܋: *7hK?AAd4Z!4`4H444 rHCH @" @H h 7hCAK?A?HK|1"6 pK>K?1K?)K?!K?K?K? @O?K|1ˀK>k?ok? k?7D77%A74zA4!r@ZHC!b7hC9Ad4z!BHKv <4: k?!L QHdK?!74Q7 r C4\ 4 4Hw 2C4 #7 A4z4K>K?K? @O?K|1 \4\ K|1k?ok? k?KW67kVB6kBB47D7w#и"H64`xB24rb"HKA#7KSA a "4_40 `K>ق#@#"ӽc4 7?A \$A00N8E$IE IR\7Ӆ ] HB3Bց ?-֝ ӵ?@ Hg?HKA"6 K_At !4HKVKYHA4 6 !p4Hˀ a4 8 B"6].K|1=@K>HK\"6K]At  `44@\@0 `K>K?K? @O?K|1?@4K|1?@]HK|1?u@uHg? \E4\@ k?ok?k?7DAX44 87Ke14K?YK?K?@O?444_4yKa!@HK_"6KYA\ ? 0Ke1 HKW4xKTA  4HKS4K\A  (@AP4z4Ƞ4Ke14zA@?@e4Ke1?4z=Hk?ok? k?7CA044 x7Ke14K>K?K? @O?Ke1! A(4?4(4444z_=4K?@HzKW <48KTA 0Ke1?=@HzK]4K\A >+4HzK_4XKSA  A44_4z ȼM4A@4 k?!Ke1444z_7Kx @HzKVKDK?!A  4HzKC4KWAt  (@AK?!4Ƞ54Ke1K?!A@?@4Ke1?K?!=Hzk?oK_4C h7C4Ћ7 7hz_4z z4z_4 RXK?Y7h}_4z "4z_q404K?Y@O?"|6|k?ok> k>K_47CC"7hz4_4z%7HzKY#7K]A %r47>i_=4z%74K},7hsHz#KTKE A 7,44z_y@$x7@4z$X7_4zk>!A4#(7444z_e44_ 4z 7@@4z7"@Hz"|K_6xKSA  "4HzKYK]K>!A *Ƞ`K>!47*7hCҕ6?{4?#\7U Ke1"RA4"z4Ke1"b4zKe1"B4zKe1""4zKe1"4zKe1!4zKe1!x4zKe1!4zKe1!h4zKe1!b4zKe1!BX4zKe1!"4zKe1!@4zAK>!Ke1Ke1=oHzK>!A@Kt=@HzKV4@KUA =+4HzKU4KTA A444K=K>K> @O>Ke1?4u7>i7hbHz <KUK_ A48 <@44z@@?%747hdHz \KVKW 4X@A0@<_+44z@@>7u4Hz7hw#KBK] A7`;+44z@x@=747hxHz"KDKS d A6;o+44z@@=U7E4Hz7he K\KX  Ah4:+44z@H@<747hHz KAKY ! A4:}@44z@@<%74Hz7h| KAKX  A84:@44z_@;74_4z;e7HzKT40K_A 9+44z_i@:747hvHz K\KW A4@9+44z_@:]74_i4z:57HzKS40KEAp 8+44z_9@9747haHz KBKY " A4`8'+44z_@9-7_4z9 7HzK]40KDAH 7+44z_@874Ke1844zKe1#=7"|%6e k?ok?K_47CC!7hvB?4bcz4fCh@HzK\KAHx8A H< #@4H7hyKxCЗ"6?HzKW#7K]AP "4HzK]7a'KT $ A "4HzKU4KVA "ˀ44#7huBӟ4`b4dBrHzKU4KBU A`@"H4HzKVK\Hx8A X "04Hd4hxKw@_ 7?HzK_"6PKYA ` ? !4HzKY7b'KS D A  y !4HzKT4KUA !44K?YK?@O? 4K|1?@HK|1?@HzK|1?e@%HzK|1?=@-4 \4\K|1>@HzK|1>@HdK|1>@HzK|1>@5HzK|1>]@M4 |54| k?ok? k?k?k?!KW47Ck?1B7%"44?!4_#:4%4! @@4z 87HyK34K=  44K>K?!K?K?K? @O?Kg1?4HKg1?4 HKg1?g44z4z@H4?%7?44Kg1#@HH4X   A84?@46h|4z_e4>]7HzHA X4T>o+4H4 4K?1_4z=746ha4z_4=7HzHA 4L=+4H45 6hv^4z= 7@4z<7^4zHzC_4 (7K?14z_44 "4z@x4@@84z h7^4z H@HzK_4@KUA  Kg1HaH4H?  <@#HzHAP7`<_+4HzHA4 H@HH4X   @t44Kg1HvJ#7 J  HzK]KWAP :+44z@ 4:-7H4_ k?ok> k>k>^7Ck>!Hx4z4C_ k>k>)4``з4r@4 4"j7>@4z"(74@$407^4z"k>14z@ P4HzK_4KU@ $H9^4z@44HzKY4@KBY A8@$44?^-4z_4z#7K>1^4zK>K>!^4z#P7(4zHzKT"6K_A( $4H|7h_4z"7??K>4z4‚@J4`:4䀶 *@4z"P7Ȁ(4z6?4? 4` +Kf1#\7Fp4@4z>74@04z!7Hb@Z4U>@K>K>!^e4z!(7@4z>M74He@@0@` 4r@ 4!7>@4z x7Ha@94 *@4z=}70444z^-K>)44K=K>K>K> @O>Kf1?4HvKf1?4X4zKf1H9^4z@4??4HzKf1?454?@ 4z>7H|4;@Ȁ4zK>!7>_4z>}7ȀU4zKf1>_4UH|HzKS#7KF@, >7+4Hv6hf_4z=7@He4hw_ Y4z=u7HzK]4@KE@ =+44z_E@=77#<7&k?oKW7CB4X x4‚@ 4@ \4\K?Y@O?K|1 @K?Y@O?6h|_ 4z04K?Y@O?7}$  " <K?Y4<p@O?HzK_KY@ ? ?+4HsK?Y6tˀhtk?ok? k?k?k?!k?)k?1KT7C7$B4 4@4H4 44@4!Hs6aha@?! b HaH6? !4@@<4!hK|1Ha"H7? !4@@4 K|1@4K>K?1K?)K?!K?K?K? @O?H^4H7? >_44@@4>?4EK|15K|1440@4>HsK|144P@4=HsK|1k?o7Ck?^4!HtB4: rK} H@HzK_#7`KW@  p4Hs6uhuK?@p4z J4z^404 K?YK|1?HsK?Y@O?k?ok? k?k?k?!k?)k?1k?9k?Ak?I7DKZ(4?KAKF7% @4P!z4 HC"4" 4'4!<4 @!^ e4 4 _4!@^ 4Ka7I7? U!4@@l50Kk175|K>K?IK?AK?9K?1K?)K?!K?K?K? @O?Kk1`?5|mH|m5|IH 5@   H!"7hHC 4c>@HKB4RKH  @ @!J4 !b!\u5K4 8@HH@5>@Kk1@ 5`?H5|`:HK_58K]@  :4 4_ @>}7}5|Kk1`?4U5|Kk1`>@-5|` !<`05+5|k?7^@04K?Y@7?k?ok?k?k?7%7D^E44!4HC]Ӻ4 pӿ4`A4ra @ L4!7444_4y7! !j!"`# 044K?YK?K?K?@O?Kf1?@@Kf1?u@(H^4 @@4 p@^474^]4ܞ@ܞ4Kf1ܞ4ܞ4_ U4>}7 P@HK_"6KS@   Kf1HH=H? 6?= HKY4KE@ =+4`>@HKW4xKBW @ |@=+4HK\4KS@ |  @`K? @O?HzK_KY@d ?  4ˀK>K|1?@}K>k?ok? k?k?k?!k?)k?1^7C4 7K|1K>K?1K?)K?!K?K?K? @O? @HzKW4KT@ "ˀ4zH|8k?A@4 h|8%K|14^4z>@4x^Y4z>@4& 444z^U@>@@H4z>m@^4zHzK_77K]@  44^}59HuB>%@4|^94z=@Hb4AhaK?A@\Hz8he84z^}4ˀ]K>K|1>4z5K>K|1?4 K>k?ok? k?Kt7CK_ C4€@b4`RKe26?? 4!z4ăD!4҃"4؂"HzKU4PK]@| #44z_-@"7HzKT4RKY@ 4 #Z44@@#Xk?)Ke1Ke1 4Ke1 h4Ke1@K?!!:Ƞ84 47hb@_4` p@HzKS#<780KW@ ?+4Hu6Ƞxhv4b? RHzK]#7@K_@$ >+ȠHu |4eP4K>K?K? @O?7h|@4k?!444z^m7 H7HzK_KVK?!@  ȠKe14 d8 HzKWИKU@ =o+@HK?!m4Ke1>4M4zKe1>w44444z^7 x7HzKAKBK?)A @H@ (@@XK?)4Ƞ4Ke1@(K?)?@4k?oK_4C!7C4 Z7hC4 j7h}^4z b(K?Y_4z04K?Y@O?_E4z?@4z^ 4?@47hs@H4z?e@4z^4?=@-4k?ok? K_47CC 4"@4z!744^4z"7?94^4z"h@^4zk?K?9BP@HzK_4PKV@ 0Kd1"@_4z7!@HzK]4RKY@H = !4HzKYKWK?@@ #@@PK?h44>_4@4z2D44K>K? @O?Kd1?404zKd1?4xK?9Kd1?44z4=4?C4Ȝ%4Ȝ4Kd1>]@@K?>4HzKT4PKU@@ >+44z_@>e7HzKS4RKT@ >w+4K?9&>4HzKU 4K]@0 >7+44z_=@=7HzK_4RKC@  ȀE4EKd1Kd1='4 4k?o7C^4拀 4^4z @_4z p@HzK_#7 `KW@  @44z^@04K?Y@O?K|1?@4zk?oK_4C 7C_ 4z BHK?Y_4z "4z^q404K?Y@O?47 Z7hsBz4?m@^4z?@]4z"e6 k?ok>k>7$7C^4!He@4 Z4?k?K?4Y4z^4'(7#<7<4`` 4r@4b"4B47?4H^4z?5@K>YK>K>@O>K|1?@4K|1?@4K|1?u@ 4`K|1?M@04 K|1?%@4 K|1>@4K|1>@04K|1>@@4`K|1>@4K|1>]@40K|1>5@Hd7??4?#\7_ `4HzKU#7KA@`5 ?U@ˀHHdHzKT 4KU@ =o+44 4HzKS 4KT@ ='+44 `4 HzK KVKW 8 @4@<+44`*@4p<+44 HzKx KAKY @ ! @h4YHzK\KW@ p  844z^404 K>YK|1?4zK>Yk?o7C^!4!@^A4z!b4^4z!@@HzKY"6 `K]@ !4HC4V HzK_"6KS@ x   44H|7ha@4z JPK>7?^4z "4z@x404K>@O?K|1?@HK|1?@4k?oK_4C!7C7haKt BHzKW#7 KV@ "4HuB4`?@4r_`47?i4^4z!K} "K?iHy]6!ZK|!@@HzK]4KC@ (}  jˀ4Ks`?@HzK_4bKU@  ˀE+`K|1 K>و jKv ZHzKS#7 KBS @ @ ˀ K|104K>@O?K|1?@HuK|1?@=+`k?ok?7CJ k?A2@4!@w4!^4z 7Kd1^I4z 7^a4z4^ 4z X7^i4zk?K?@@7 hKd1@K?^4z@4K?@4y Kd1@44K?YK?@O?k?7"k?6 O4 P4K?Y@7?H? @@K?ˀK?Y@04k?K?_m7?+@K?]K?YKa?#4:@J7 0KI@K?Yk?ok?7$ 047C]4 d74  `K?YK?@O?k?7k?]4k?K?_%7K?YK?@7?k?o7CKKZK4zK?Y@O?k?7K_k?K@K?YK?@7?k?oK_777C`7 Y7@  y]Hz |K?Y4|@O?K_@@k?ok?7CY H7$H_4z B4K?YK?@O?KY@HHzJHHς k?ok?7C7:Jek?74z_-7 "4K?YK?@O?HzJ=K?ς dk?ok?k?7C7X @7%HH  _m4z *ˀK?YK@HHwA`@ "_P4_?HvH 7   _6?` H|H w <  6?7?HtH    U7?77?HzH  z X HsH S y  4HwH JHHHt 4hsK?YK?K?@O?k?ok? k?7C7%k?!J7Hu7 _4z0ˀHwA2 }P7?Hb W   B  9_6?` Hsw   VHt6?   !7?H}   Hs6? D z   \=7W?HvK?! J4H| ha4K>K?K? @O?k?ok?k?KU7$7C7_60ˀzHwA2 }P7?Hb W 6 B  9_6?` Hsw 6 VHt6?7  !7?H} 6 Hs6?7Tz   \=7W?Hv  4Ha4"hbK?YK?K?@O?k?ok?7C7:Jk?Hx7  _4z "4K?YK?@O?HHw J K?Hy $ ςhzk?ok?KT7$7C_60ˀbHwHy 4Hs6Hz _ H}7huK?YK?@O?k?ok?k?k?77C7&` H x` Ju@4z_40ˀ4?AZY?P7??HHz  W  Y \_6?` HH}  t 6? HHv 7?  " E 7X?HHa:   } 7?HH|  Hs d 4 dK?YK?K?K?@O?k?7@@K?Y@7?@ @K?@ @k?7@@K?Y@7?k?7@0@K?Y@7?k?ok? k?k?k?!7D@"7%@"Kc @4&HyJ4 bHc`?Hy" ZHyJ4#j( 4$p4J4 āHz]4"@7J47]4 |"74N=4( 4'p4J4 gJA47]4!`744N4Hz @J5@ fJ47]i4 | 74N4K (@KJ4@@K 0kcˀ0K>`u@ ( 4<pH|ˀK>ˀK>ˀK>ˀK>KeH jKJ4`H@HH (@KJa4_@H x H|K>K?!K?K?K? @O? _ : W ]  SV@ \CT x4@ӿ< 77Z<  @?@@Ku4Ks4 k?k?o7hd>he>hf>hg>hh>hi>hj>hk>hl>hm>hn>Ka?H&7$7H7 %4%0Kh2Kj %IYJ5 eIJ@?IY@%zIG@4^"!@J1475s4 K?K?g~4` k?k?77h_5 @H4 D 4`5@ K?K?~  k?k?77h_]5 H?w5@$4Ja4!| 5y@ 07IY@ 7@ 5:75:@ 77JA5z7J)5 5 K?K?~4`  k?k?5y7@ @7!| 5y@ 77@ 55y@ 7JQ5:7K?K?~4`  k?k?A774 tp4 `55775)76 7,?5yJ5!5yJ5!45@ H5X 75@4!I  @5 @x4!X@ ?5!2A7 ("5)A7 ?5)>E@  ˀ84~4 ! M5ph44~Hb>YHn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>˄}hmhk?ok? k?k?k?!k?)KG7C k?1@84zHc`#Hh( H0"jHf$4HsHw d Hg$XH: GJK?1DRĄX@H}7G? ܋ #D!HHt( Hu0 刀 6# @#*Hx7G? Ջ#D?Ht(Hh  Hh#Jz HJiK?1?-HHa Hy' Hc "Hx C HwH Hh!J HJ K?1>HHb H}G Hc!H C J K?1K?1_7Hs(76y)Ht76y?Hb07 E 7@=Hyˀ8K>Hx Hc!H CK>K?)K?!K?K?K? @O?ˀK>_M@\E@_-@\@_ @\ H _@\E@_@\Hˀ K>_@\H_}@\ H _]@\@_=@\ G @4ś7 Ş'H| ˀMK>_@\% C L҇L HzH ZD:D  " @6# @70#< @7<P#\ @7\p# @7"| @6|# @7" @6k?o | k?\4z C @\4z C `@\}K? C 0@\M4z C04|K?Y@O?C8X7? (7W6 ?7@6?k?ok? k?k?@ 7E@ 8Kc2( 4$4J4 @( 4$`kd2JY47] k?! 7K?!4N4kf2 JU4zK|2K>K?K?K? @O?k?ok>k>k>7#7Jqk>k?K>4k?7z7k>k?k?k?yk?qk?ik?ak?Y@k?Q!7@4z X7J47]i4"`74z4N4k?Y7?7? k?7?7?!k?7?7>k?7>7>k?y4z@k?K>J7K>k?47k?QK>4k?K?k?K? k?K>k?yK?k?qK?k?iK?!k?aK>@K>! 7Ƞ4H @@H4H H 4 `4 KX @@ J 4c ? ``4@44K>YK>K>K>@O>H @@84H jH  X4 K_ @@ K:@  ?4?4J4z4 _ : W ]  SV@ \Ku5AKs5I k?k?ok> k>k>k>!7D4@KZ@" K4"p77>_=4 K>48bb@]K>7" K>4g44KE4!@ _ Km4H B4% # 7 *!]48 !H7 H(4 !hHz"H!hHz H!hHzH C   !`Hz H C h !XHz(h(H!XHz0 Ch0Kg2!40kw2!K4K=K4K=K>!K>K>K> @O>J4zK=_%@\}@_@\ _@\H_@\H_@\h(_@\ C J4zJ4 Ku3Ks3 k?k?ok? k?k?k?!Kd04%7C4&4tk?qKx29!:4K2AC 4 "7k2AC?7 8077k2AC ?7_ @( _?'k?qK2AC?=@>k?q4K>K?!K?K?K? @O?k?Ky 7?q_4>K2AKKu3Ks3 k?Ku5QKs5Y k?k?o 7hd6he6hf6hg6hh6hi6hj6hk6hl6hm6hn6ho6757$K?K?~`4`  ~k?k?7Y77Ny4#  7NQ4 < 49pI 4#P7DvF04Ka?4&4'4(4 4 F44z7q_4%H@u7q4k7q"Һ ߀ H@H5kA}"Ӻ |ߋ?5kA _85l5kAbZ zH"B ߈ RH5kA|Ӛ@ *"@ \߃?5kAa ` 5kHAx! Ѽ߀ BH5kAv! <ߋ?5kA|#25m5kAw rH!b <߈ JH5kAw@ "!: Ҽ߃?5kA!* `5k0 iȀ04_@-@_@UH_@@_@H_@%@_u@EH_U@@_5@H ` 5kKy29Ks21y @h@I57\}5!755M%5Kx29Kt 5IM7\5!0755M5Kb29K 4Ko295kw295zIM4 R44z7q_]40`i7q4I4z7q?4Dz4I4 "Kz Ky29Kw0J 444~Hb6YHo6Hn6Hm6Hl6Hk6Hj6Hi6Hh6Hg6Hf6He6Hd6@O6k?ok?K21 A04#\ ڃ `7K29Ky  M4Kw21 +`J Kz kd kc21K?YK?@O?@P@K?@ @Ku4Ks4 k?k?7KZ_K9K?Y@7?k?ok?k?7#7D 84I 47  `?44K?YK?K?@O?k?ok?k?7#7D h74 44I @7 `? ?4K?YK?K?@O?k?o X7\ x4I 77x7K?Y 04K?Y@O?"}6vT"6*  " < 6"6&g?  Y p _ 4  @k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=64 k>4K=ak>K=iI =k>K>K=q K=yK=K=CCK=4xk>cC 4yk>ǃC 4 `_#ªI}57J (@I 5!e6 J?@R4K=Y I56O \ 7#7K>K>5M54^K>K>4t_%566? 6@ 4CC*cCZǃCq> #ǣCr@$"K>7@ 5J>M@$jK=Q`$ZK>_K>7_4z@7>p֟t&a&i8G&qFq \ 4:(#7P64ǣ@ 4@ `4 @47`4 4eK=YIM5zM7I-5ZU7I 5:]7I4%7I457I45746K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>47@(5ycܥ@4\7@5Yǃq>4\7@59Eq>z?@ V47@h5ǣr4V7@04r4X77@4`47@4eK=QI56K>_K> 4 @K> @K> (K>J I K>K>_]4 0o4oAj6 o!:4  40 ! Ǐ@K>K>_=4 7k?I6Zk?K>76Yk?5k?k?yk?qk?ik?ak?Y_k?Q - K>6X_uK>5?575?~@6 M Ku3Ks3 k?Ku6Ks6 k?Ku4AKs4I k?k?ok? k?k?k?!k?)k?17$7C4 4Ka?H?4'4h " <߀ : 4! \ 4"?5 4 \5!7!4 Ka?4'H `Ӻ! \ 0@ `_Ӛ `@H `!2 < `  4?%4c 4K>K?1K?)K?!K?K?K? @O?_@H_@H!< 59@H4ܞ=@_@m@MU@C8X7? (7W6 ?7@6?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK>76K>7I4K>4 K> K>y ` @ :C_ 4 4 r4V_ b4X R5)A? 8 (@ ( _8 ?5)K:: I94K?IK?AK?9K?1K?)K?!K?K?K? @O?? crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)? crt0: errno: tsd{}h{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{|{{|{}{{}$|{{|}{{}`{}P{{{{{{{{{{{}{{}{{{{{{{}8}@{{|{{}X{}H{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{}@XHPh0XPDH`L~,,,,(0HtP,discard-alldiscard-localsformathelpinput-formatinput-targetkeep-symboloutput-formatoutput-targetpreserve-datesremove-sectionstrip-allstrip-debugstrip-unneededstrip-symboltargetverboseversionadd-sectionadjust-startadjust-vmaadjust-section-vmaadjust-warningsbytechange-addresseschange-leading-charchange-section-addresschange-section-lmachange-section-vmachange-startchange-warningsdebuggingonly-sectiongap-fillinterleaveno-adjust-warningsno-change-warningspad-tolocalize-symbolkeep-global-symbolremove-leading-charset-section-flagsset-startweakenweaken-symbolredefine-symsrec-lensrec-forceS3keep-symbolsstrip-symbolskeep-global-symbolslocalize-symbolsweaken-symbolsUsage: %s in-file [out-file] The switches are: -I --input-target Assume input file is in format -O --output-target Create an output file in format -F --target Set both input and output format to --debugging Convert debugging information, if possible -p --preserve-dates Copy modified/access timestamps to the output -j --only-section Only copy section into the output -R --remove-section Remove section from the output -S --strip-all Remove all symbol and relocation information -g --strip-debug Remove all debugging symbols --strip-unneeded Remove all symbols not needed by relocations -N --strip-symbol Do not copy symbol -K --keep-symbol Only copy symbol -L --localize-symbol Force symbol to be marked as a local -G --keep-global-symbol Localize all symbols except -W --weaken-symbol Force symbol to be marked as a weak --weaken Force all global symbols to be marked as weak -x --discard-all Remove all non-global symbols -X --discard-locals Remove any compiler-generated symbols -i --interleave Only copy one out of every bytes -b --byte Select byte in every interleaved block --gap-fill Fill gaps between sections with --pad-to Pad the last section up to address --set-start Set the start address to {--change-start|--adjust-start} Add to the start address {--change-addresses|--adjust-vma} Add to LMA, VMA and start addresses {--change-section-address|--adjust-section-vma} {=|+|-} Change LMA and VMA of section by --change-section-lma {=|+|-} Change the LMA of section by --change-section-vma {=|+|-} Change the VMA of section by {--[no-]change-warnings|--[no-]adjust-warnings} Warn if a named section does not exist --set-section-flags = Set section 's properties to --add-section = Add section found in to output --change-leading-char Force output format's leading character style --remove-leading-char Remove leading character from global symbols --redefine-sym = Redefine symbol name to --srec-len Restrict the length of generated Srecords --srec-forceS3 Restrict the type of generated Srecords to S3 --strip-symbols -N for all symbols listed in --keep-symbols -K for all symbols listed in --localize-symbols -L for all symbols listed in --keep-global-symbols -G for all symbols listed in --weaken-symbols -W for all symbols listed in -v --verbose List all object files modified -V --version Display this program's version number -h --help Display this output Report bugs to %s Usage: %s in-file(s) -I --input-target Assume input file is in format -O --output-target Create an output file in format -F --target Set both input and output format to -p --preserve-dates Copy modified/access timestamps to the output -R --remove-section Remove section from the output -s --strip-all Remove all symbol and relocation information -g -S --strip-debug Remove all debugging symbols --strip-unneeded Remove all symbols not needed by relocations -N --strip-symbol Do not copy symbol -K --keep-symbol Only copy symbol -x --discard-all Remove all non-global symbols -X --discard-locals Remove any compiler-generated symbols -v --verbose List all object files modified -V --version Display this program's version number -h --help Display this output -o Place stripped output into allocloadnoloadreadonlydebugcodedataromsharecontentsunrecognized section flag `%s'supported flags: %scannot stat: %s: %srcannot open: %s: %s%s: fread failedIgnoring rubbish found on line %d of %s%s: Multiple redefinition of symbol "%s"%s: Symbol "%s" is target of more than one redefinitionUnable to change endianness of input file(s)copy from %s(%s) to %s(%s) Warning: Output file cannot represent architecture %scan't create section `%s': %sCan't fill gap after %s: %sCan't add padding to %s: %s%s: error copying private BFD data: %scannot mkdir %s for archive copying (error: %s)internal stat error on %smakingsizevmaalignmentflagsprivate data%s: section `%s': error in %s: %s.stab.stabstr%s: can't create debugging section: %s%s: can't set debugging section contents: %s%s: don't know how to write debugging information for %sb:i:I:j:K:N:s:O:d:F:L:G:R:SpgxXVvW:strip%s: cannot stat: %sb:i:I:j:K:N:s:O:d:F:L:R:SpgxXVvW:byte number must be non-negativeinterleave must be positive%s both copied and removedbad format for %s--change-start--change-addresses--gap-fill%08lxWarning: truncating gap-fill from 0x%s to 0x%x--pad-to--set-start--srec-lenobjcopybyte number must be less than interleaveCannot stat: %s: %s%s %s%c0x%s never usedbinutils/opt/binutils/share/locale%s: cannot set time: %s%s: rename: %s%s: simple_copy: %s?UUUUU\%s: no recognized debugging information.stab.stabstr%s: %s: %s %s: %s: stab entry %d is corrupt, strx = 0x%x, type = %d .debugLast stabs entries before error: n_type n_desc n_value string %-6sHdrSym%-6d %-6d %08lx %s 4h$@\\(p,¸, p$<XѼH 8PP%s debug_add_to_current_namespace: no current filedebug_start_source: no debug_set_filename calldebug_record_function: no debug_set_filename calldebug_record_parameter: no current functiondebug_end_function: no current functiondebug_end_function: some blocks were not closeddebug_start_block: no current blockdebug_end_block: no current blockdebug_end_block: attempt to close top level blockdebug_record_line: no current unitdebug_start_common_block: not implementeddebug_end_common_block: not implementeddebug_record_label not implementeddebug_record_variable: no current filedebug_record_variable: no current blockdebug_make_undefined_type: unsupported kinddebug_name_type: no current filedebug_tag_type: no current filedebug_tag_type: extra tag attemptedWarning: changing type size from %d to %d debug_find_named_type: no current compilation unitdebug_get_real_type: circular debug information for %s debug_write_type: illegal type encountered((((((((((((((((((((((@(((((((((((((((((((((ސ(((((((߈(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((D(((((((((((((((((((((((((((((p(h(((((((((((((((((((((((((((((ܘ(߬(4Xp4$L$$TLp$ppHpppppppppppppppppppppppppppp@pppppppppppppppptppppppppppppp       8Xx4Dd| (DPl4Tt/0L//0L//////0L/0L0D0T0D0L0\0L0L///////////0t0|0/0//0l//0l///0D/00l//0d0l0l:5:9<::9::::::7:78 :8:8|:::::::::::::::::::::::::::8 @t8?@t?P@t@t=\@t@t= @t@t@t@t@t>=?@t<><numeric overflowBad stab: %s Warning: %s: %s N_LBRAC not within function Too many N_RBRACs gcc2_compiled.gcc_compiled.unknown C++ encoded nameunrecognized cross reference type01000000000000000000000;0777777777777777777777;01777777777777777777777;long long intlong long unsigned intmissing index typeunknown virtual character for baseclassunknown visibility character for baseclass_vptr$unnamed $vb typeFOO_vb$unrecognized C++ abbreviationINVALID_CPLUSPLUS_ABBREVunknown visibility character for fieldconst/volatile indicator missingmember function type missing__ct__dt__%s%s__%s%s%dNo mangling for "%s" intUndefined N_EXCLType file number %d out of range Type index number %d out of range Unrecognized XCOFF type %d charshortlongunsigned charsigned charunsigned shortunsigned intunsignedunsigned longvoidfloatdoublelong doubleintegerbooleanshort realrealstringptrcharacterlogical*1logical*2logical*4logicalcomplexdouble complexinteger*1integer*2integer*4wcharlong longunsigned long longlogical*8integer*8bad mangled name `%s' no argument types in mangled string ___typeNoSuchStrinG__::NoSuchStrinGbool__wchar_tI4HI`ItIIIIJJ J<JXJpJJJK K(KDHtK`K|KKKKL gdgggggggggggggggggggggggggggggggbggg^gdgggggghddgb4e eTe ixg^gcggggggbgetetgic0ggggggcggggdLggggamn nooomopXppqqmmmrmmsDmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmkkk݈ݐݬ`ޤ\ ߈ߤ݈݈ޤݬޤ`%s: 0x%lx: %s (0x%x) %s: %s unexpected end of debugging informationinvalid numberinvalid string lengthexpression stack overflowunsupported IEEE expression operatorunknown sectionexpression stack underflowexpression stack mismatchunknown builtin typevoidsigned charunsigned charsigned short intunsigned short intsigned longunsigned longsigned long longunsigned long longfloatdoublelong doublelong long doubleQUOTED STRINGinstruction addressintunsignedunsigned intcharlongshortunsigned shortshort intsigned shortBCD float type not supportedunexpected numberunexpected record typeblocks left on stack at end*global*__XRYCPPunknown BB typestack overflowstack underflowillegal variable indexillegal type indexunknown TY codeundefined variable in TYPascal file name not supportedunsupported qualiferundefined variable in ATNunknown ATN typeunsupported ATN11unsupported ATN12unexpected string in C++ miscbad misc recordunrecognized C++ misc recordundefined C++ objectunrecognized C++ object specunsupported C++ object typeC++ base class not definedC++ object has no fieldsC++ base class not found in containerC++ data member not found in containerunknown C++ visibilitybad C++ field bit pos or sizebad type for C++ method functionno type information for C++ method functionC++ static virtual methodunrecognized C++ object overhead specundefined C++ vtableC++ default values not in a functionunrecognized C++ default typereference parameter is not a pointerunrecognized C++ reference typeC++ reference in class with no fieldsC++ reference not foundC++ reference is not pointermissing required ASNmissing required ATN65bad ATN65 recordIEEE numeric overflow: 0x%08lx IEEE string length overflow: %u .debugbfd_make_sectionbfd_set_section_flagsbfd_set_section_sizebfd_set_section_contents%s: %s: %s GNU objcopyIEEE unsupported integer type size %u IEEE unsupported float type size %u IEEE unsupported complex type size %u __anon%u_vb$%s_b$%sshort unsigned intlong intlong unsigned intlong long intlong long unsigned int,DDt$\parse_coff_type: Bad type code 0x%xvoidcharshortintlongfloatdoublelong doubleunsigned charunsigned shortunsigned intunsigned longbfd_coff_get_syment failed: %sbfd_coff_get_auxent failed: %s*globals*.bf%ld: .bf without preceding function.ef%ld: unexpected .ef .bb.ebstring_hash_lookup failed: %s%ldbfd_hash_table_init_failed: %s%ld=%ldstab_int_type: bad size %u%ld=r%ld;0;%ld;-1;01777777777777777777777;%ld;%ld;01000000000000000000000;0777777777777777777777;%ld=r%s;%u;0;%ld=r%ld;%u;0;xe%s:e%s:T%ld=e%s:%ld,;%c%s%ld=%c%s:t%sr%s;%ld;%ld;%ld=@S;ar%s;%ld;%ld;%sS%s@%s,%s#%s,%s,%ld=%c%u/0/1%s: warning: unknown size for field `%s' in struct%s%s:%s%s,%ld,%ld;%s%s;~%%%ld~%%%s%s%s:%s%s:%s;%ld,%s;%s::%s:%s;%c%c%c%ld;%s;!%u,%s:t%s%s:t%ld=%s%s:T%s%s:c=i%ld%s:c=f%g%s:c=e%s,%ldGSV%ld=%sr%s:%s%s%s:%c%s%s: %s: %s %s: %s %s: hppa2.0n-hp-hpux11.00can't set BFD default target to `%s': %s%s: Matching formats: %sSupported targets:%s: supported targets: %.12s %.4s%s %ld/%ld %6ld %s %s /%s: bad number: %s2.11.2GNU %s %s Copyright 1997, 98, 99, 2000, 2001 Free Software Foundation, Inc. This program is free software; you may redistribute it under the terms of the GNU General Public License. This program has absolutely no warranty. ? VSSSSSSSSSSVVVVVVVVT$SLVVTlVVTVVSSxVVVVRVS4VVSLVVVVVVVVUVVVVVVVVVVVVVVVVVVVVTSLxl88dxx,HLx<nw newdl deletenewdeletevn new []vd delete []as=ne!=eq==ge>=gt>le<=lt<plus+plapl+=minus-miami-=mult*mlamu*=amlconvertnegatetrunc_mod%mdamd%=trunc_div/dvadv/=truth_andif&&aatruth_orif||ootruth_not!ntpostincrement++pppostdecrement--mmbit_ior|oraor|=bit_xor^eraer^=bit_and&adaad&=bit_not~cocall()clalshift<<lsals<<=arshift>>rsars>>=component->ptrfindirectmethod_call->()addrarray[]vccompound, cmcond?:cnmax>?mxmin*szsizeof autoAutomatic selection based on executablegnuGNU (g++) style demanglinglucidLucid (lcc) style demanglingarmARM style demanglinghpHP (aCC) style demanglingedgEDG style demanglinggnu-v3GNU (g++) V3 ABI-style demanglingjavaJava style demanglinggnatGNAT style demanglingconstvolatile__restrictconst volatileconst __restrictvolatile __restrictconst volatile __restrictoperator operatorassign_type_ada____<%s>global constructors keyed to global destructors keyed to import stub for statictemplate <class> class()%d.e'falsetrue0JArray1Z__pt____tm____ps____S,_GLOBAL_{anonymous}___imp____imp___std____sti___ virtual table0123456789Qt__thunk_virtual function thunk (delta:%d) for __t__vtbl__::[]unsignedsigned__complexvoidlong longlongintshortboolcharwchar_tlong doubledoublefloat%xint%u_t-2147483648U...__ct__dtT%d--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument %s%sCannot allocate %lu bytes after allocating %lu bytes undocumented error #%d???UUUUU\ЬDԐӨ\X(l޸`8߈h8Allocation failed.Expected ?std::Unexpected end of name in .::Unexpected character in .Unexpected character in .Zero length in .Internal error.Unexpected end of name in ._GLOBAL_(anonymous namespace)aN&=aS=aa&&ad&ancl()cm,co~dV/=da delete[]de*dl deletedv/eO^=eo^eq==ge>=gt>ix[]lS<<=le<=ls<<lt<mI-=mL*=mi-mlmm--na new[]ne!=ngnt!nw newoR|=oo||or|pL+=pl+pm->*pp++pspt->qu?rM%=rS>>=rm%rs>>sz sizeofoperator operatorUnknown code in . [nv: [v:Unrecognized .guard variable for vtable for VTT for typeinfo for typeinfo fn for typeinfo name for java Class for non-virtual thunk to virtual thunkcovariant return thunkconstruction vtable for -in-Unrecognized .Error.in-chargenot-in-chargeallocatingin-charge deletingUnrecognized constructor.[Unrecognized destructor. [::*Non-pointer or -reference function type.complex imaginary Unexpected character in .signed charboolchardoublelong doublefloat__float128unsigned charintunsignedlongunsigned long__int128unsigned __int128shortunsigned shortvoidwchar_tlong longunsigned long long...Unrecognized code.Non-alphabetic code.restrictvolatileconst [extern "C"] , Missing function return type.Missing function parameter. () Template parameter outside of template.Template parameter number out of bounds.ibi iii ll ii i Unimplemented.falsetrueUnrecognized bool constant.:(stdstd::allocatorallocatorstd::basic_stringbasic_stringstd::stringstringstd::basic_string, std::allocator >std::istreamistreamstd::basic_istream >basic_istreamstd::ostreamostreamstd::basic_ostream >basic_ostreamstd::iostreamiostreamstd::basic_iostream >basic_iostreamUnrecognized .Substitution number out of range.string literal [# [#0]_ZMemory allocation failed. /opt/binutils/share/localemessages/.moCPOSIXLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_ALLLC_XXXLANGUAGELANG/locale.alias/opt/binutils/share/locale:.riso8:X:;@;;P<<X<< <$<8<<T>X>x>|>>??4??????@ @<@d@h@@ADAHBB$BBC,C0CdChCCDDDDEPETExE|EEF F$FFFFFFGGG@GDGGGGHHHHIXI\IIJJLHLLMMNNNNPtPxQ Q$QDQHQQW WW WYPYTYhYlZx Z|[< [@\$\(\\^<^@aaddftfxgghh l lllmmmmodohoot0t4t@ttv vzx z|{,{0||} }t x    048< $ (<@ptTX8<x|X\@Dd` Hd,TX8(,dbhb  $TXhl<@x| 04LPTXdh@D`d48HLPT`d@DǼ(,`dTXdhTXptdh̸̼ϘϜ (,D H  ڐڔlpp t (,@Ddh<@ X \|48X\HL04DH,0@D ,048PT`d  dh\`DHpt l  p |     ` d                X\48 ` d 0\ ` pt(,   !"h"l""""&x ? ? N Pd R S X4 \ ^$ ri 0l n` nx q q u u v\ }  t      L    "T   4       4 t    $  4       0 L Ť ż $ 4 | 4 P ӌ  , x  ٠ l      (@ x  `  | L @    d   |      \     ` X P " "\ # $ & ' ) *p + /| / 0 0 2 3T 3 5 5 6d  67 7 9 : ; < = = ? @$ @ B B C G tD    h d |   L              @4$Revision: 92453-07 linker linker crt0.o B.11.06 981204 $/usr/lib/dld.slERROR: mmap failed for dldERROR: mmap failed for TSDbug-binutils@gnu.orgbug-binutils@gnu.orgalloc, load, noload, readonly, debug, code, data, rom, share, contents--redefine-sym--redefine-sym/--add-section--change-section-address--change-section-lma--change-section-vma--redefine-sym--set-section-flags--change-section-vma--change-section-lma@4@4@4@4@4----..b..0.H.`.x...,x,X.j,F.,h,I-I.i-K./- O-0O/ -@p/(L/8G/P-PR/h/-`S-pg--N-F-v-V//W//////00(,x,X,F,h,I-I-K- O-0O-@p-PR-`s-pS--N-F-v-Vinfo->units == NULLdebug.cname->kind == DEBUG_OBJECT_TAGdebug.ctype->u.kclass->id > info->base_iddebug.ctype->u.kclass->id > info->base_iddebug.ctype->kind == DEBUG_KIND_STRUCT || type->kind == DEBUG_KIND_UNION || type->kind == DEBUG_KIND_CLASS || type->kind == DEBUG_KIND_UNION_CLASSdebug.cthiseh_throwCVlong long unsigned intlong long intlong unsigned intlong intunsigned intintshort unsigned intshort intunsigned charsigned charcharindx < BUILTIN_TYPE_COUNTieee.cindx < BUILTIN_TYPE_COUNTieee.cts != NULLieee.cinfo->pending_ranges != NULLieee.c! ieee_buffer_emptyp (&info->vars)ieee.clocalp == nt->type.localpieee.cinfo->type_stack != NULL && info->type_stack->next != NULL && ! ieee_buffer_emptyp (&info->type_stack->next->type.strdef)ieee.cinfo->type_stack != NULL && ! ieee_buffer_emptyp (&info->type_stack->type.strdef)ieee.cvclass != NULLieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULLieee.cinfo->type_stack != NULL && info->type_stack->type.name != NULL && info->type_stack->next != NULL && info->type_stack->next->type.classdef != NULL && ! ieee_buffer_emptyp (&info->type_stack->next->type.strdef)ieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULL && info->type_stack->type.classdef->method == NULLieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULL && info->type_stack->type.classdef->method != NULLieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULL && info->type_stack->type.classdef->method != NULLieee.cinfo->type_stack != NULL && info->type_stack->type.classdef != NULLieee.ch != NULLieee.c! ieee_buffer_emptyp (&info->vars)ieee.c! ieee_buffer_emptyp (&info->vars)ieee.cinfo->block_depth == 1ieee.cinfo->block_depth == 1ieee.cinfo->filename != NULLieee.c@4@4@4@4@5@5 @5@5@5"@5*@52@5:@5B@5J@5R@5Z@5b@5j@5r@5z@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@6@6 @6@6@6"@6*@62@6:@6B@6J@6Rs != NULLwrstabs.cinfo.pending_lbrac == (bfd_vma) -1wrstabs.ctag != NULLwrstabs.cinfo->type_stack != NULLwrstabs.cinfo->type_stack->fields != NULLwrstabs.cinfo->type_stack != NULL && info->type_stack->fields != NULLwrstabs.cinfo->type_stack->index > 0wrstabs.cinfo->type_stack->fields != NULLwrstabs.cinfo->type_stack != NULL && info->type_stack->fields != NULLwrstabs.cinfo->type_stack != NULL && info->type_stack->fields != NULLwrstabs.cinfo->type_stack != NULL && info->type_stack->methods != NULLwrstabs.cinfo->type_stack != NULL && info->type_stack->methods != NULLwrstabs.cinfo->type_stack != NULL && info->type_stack->fields != NULLwrstabs.ch != NULL && h->index > 0wrstabs.cinfo->nesting == 0 && info->fun_offset == -1wrstabs.cinfo->nesting > 0wrstabs.cinfo->lineno_filename != NULLwrstabs.c@6Z@6b@6j@6r@6z@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@7@7 @7@7@7"@7*@72@7:@7B@7J@7R@7Z@7b@7j@7r@7z@7@7@7@7@7@7@7@7stXXXXXX{P{X{{{{{{{{| | |8@|@|h|p||.::.::.::.::.:: type_info node type_info function.::.::.::.::vwwwwww ww(w0w8w@wPwXw`whwpwxwwwwwwwwwwwwwwwwwwxxxxx xx(x0x8x0x@wxHwxPx`xhx`xpxxxxxxxxxxxxxxxxxyyyyy y(y y0y@yHy@yPyXy`yXyhypyxyyyyyyyyyyyyyyyyyyyyzzzzzz z(z0z(z8z@zHzXz`zXzhzXzpxzzzyzzzzzzzzzzzzzz{z{{{{{ {({0{8{@{HPOSIXLY_CORRECT:  (8@HPX`hpx (08@@HPX`hp0x (08@HPX`hpxH((8(8@HP`hx0  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000@7@7IIr$.$?PhXSGti|S~X4RPd?P|L TNNi i 4 P_ \?LP?^<B @tD} _D"lSt\(_T"T^Xd_t^$L^rż_,_^l^XLB4lq_iPi8i4d^q^q^ihi _nx@$^T_\?n`uuv\q4t$ 40LŤ$4|4Pӌ,x٠l@x`|L@ d|\`XP""\#$&')*p+/|/0023T35 56d7 79:;<==@:@:@:@:OS$S$S$S8S8>binutils/binutils-RUN/opt/binutils/doc/COPYING010075500000000000003000000431270732753176100200170ustar000300000000000000 GNU GENERAL PUBLIC LICENSE Version 2, June 1991 Copyright (C) 1989, 1991 Free Software Foundation, Inc. 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This General Public License applies to most of the Free Software Foundation's software and to any other program whose authors commit to using it. (Some other Free Software Foundation software is covered by the GNU Library General Public License instead.) You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs; and that you know you can do these things. To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the software, or if you modify it. For example, if you distribute copies of such a program, whether gratis or for a fee, you must give the recipients all the rights that you have. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. We protect your rights with two steps: (1) copyright the software, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software. Also, for each author's protection and ours, we want to make certain that everyone understands that there is no warranty for this free software. If the software is modified by someone else and passed on, we want its recipients to know that what they have is not the original, so that any problems introduced by others will not reflect on the original authors' reputations. Finally, any free program is threatened constantly by software patents. We wish to avoid the danger that redistributors of a free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we have made it clear that any patent must be licensed for everyone's free use or not licensed at all. The precise terms and conditions for copying, distribution and modification follow. GNU GENERAL PUBLIC LICENSE TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION 0. This License applies to any program or other work which contains a notice placed by the copyright holder saying it may be distributed under the terms of this General Public License. The "Program", below, refers to any such program or work, and a "work based on the Program" means either the Program or any derivative work under copyright law: that is to say, a work containing the Program or a portion of it, either verbatim or with modifications and/or translated into another language. (Hereinafter, translation is included without limitation in the term "modification".) Each licensee is addressed as "you". Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running the Program is not restricted, and the output from the Program is covered only if its contents constitute a work based on the Program (independent of having been made by running the Program). Whether that is true depends on what the Program does. 1. You may copy and distribute verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and give any other recipients of the Program a copy of this License along with the Program. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee. 2. You may modify your copy or copies of the Program or any portion of it, thus forming a work based on the Program, and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a) You must cause the modified files to carry prominent notices stating that you changed the files and the date of any change. b) You must cause any work that you distribute or publish, that in whole or in part contains or is derived from the Program or any part thereof, to be licensed as a whole at no charge to all third parties under the terms of this License. c) If the modified program normally reads commands interactively when run, you must cause it, when started running for such interactive use in the most ordinary way, to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty) and that users may redistribute the program under these conditions, and telling the user how to view a copy of this License. (Exception: if the Program itself is interactive but does not normally print such an announcement, your work based on the Program is not required to print an announcement.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Program, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Program, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Program. In addition, mere aggregation of another work not based on the Program with the Program (or with a work based on the Program) on a volume of a storage or distribution medium does not bring the other work under the scope of this License. 3. You may copy and distribute the Program (or a work based on it, under Section 2) in object code or executable form under the terms of Sections 1 and 2 above provided that you also do one of the following: a) Accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, b) Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than your cost of physically performing source distribution, a complete machine-readable copy of the corresponding source code, to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, c) Accompany it with the information you received as to the offer to distribute corresponding source code. (This alternative is allowed only for noncommercial distribution and only if you received the program in object code or executable form with such an offer, in accord with Subsection b above.) The source code for a work means the preferred form of the work for making modifications to it. For an executable work, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the executable. However, as a special exception, the source code distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. If distribution of executable or object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place counts as distribution of the source code, even though third parties are not compelled to copy the source along with the object code. 4. You may not copy, modify, sublicense, or distribute the Program except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 5. You are not required to accept this License, since you have not signed it. However, nothing else grants you permission to modify or distribute the Program or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Program (or any work based on the Program), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Program or works based on it. 6. Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a license from the original licensor to copy, distribute or modify the Program subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties to this License. 7. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Program at all. For example, if a patent license would not permit royalty-free redistribution of the Program by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Program. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system, which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License. 8. If the distribution and/or use of the Program is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Program under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License. 9. The Free Software Foundation may publish revised and/or new versions of the General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of this License, you may choose any version ever published by the Free Software Foundation. 10. If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. NO WARRANTY 11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Programs If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. Copyright (C) 19yy This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Also add information on how to contact you by electronic and paper mail. If the program is interactive, make it output a short notice like this when it starts in an interactive mode: Gnomovision version 69, Copyright (C) 19yy name of author Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, the commands you use may be called something other than `show w' and `show c'; they could even be mouse-clicks or menu items--whatever suits your program. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the program, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the program `Gnomovision' (which makes passes at compilers) written by James Hacker. , 1 April 1989 Ty Coon, President of Vice This General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Library General Public License instead of this License. binutils/binutils-RUN/opt/binutils/doc/HPUX.Install010075500000000000003000000075210732753176100210760ustar000300000000000000Package name: binutils Version number: 2.11.2 Original author: Free Software Foundation Original URL: ftp://ftp.mirror.ac.uk/sites/ftp.gnu.org/pub/gnu/binutils/ HP-UX URL: http://hpux.connect.org.uk/hppd/cgi-bin/search?package=&term=binutils- Install tree: /opt/binutils Report bugs to: hpux@connect.org.uk Tested on: HP 9000/780/C160 running HP-UX 11.00 C compiler used: Version A.11.01.21505.GP Purpose: GNU binary utilities. This package contains various utilities for creation and manipulation of object files, libraries, executables and core files and includes the GNU assembler required by gcc. Date archived: Wed 25 Jul 2001 ------------------------------------------------------------------------------- NOTE: If you don't have HP's lex and yacc commands, you must install GNU flex and GNU bison beforehand, making sure that the "flex" and "bison" commands are in your PATH. Files changed: * Makefile.in: - INSTALL_PROGRAM now has an additional -s flag to strip installed binaries. - "make clean" now deletes config.cache. * bfd/Makefile.in: - bfd/po/POTFILES.in was neither shipped nor had a rule that could create it and yet bfd/configure (line 4313) used the file ! This Makefile template had its po/POTFILES.in rule changed to do this (plus an additional POTFILES definition was added to roughly match the binutils 2.11 list of files). * bfd/po/POTFILES.in: - Created via "cd bfd; make po/POTFILES.in". * bfd/syms.c: - Moved cmpindexentry() routine below the qsort() routine that called it and added a K&R forward declaration to it. All of this avoided an ANSI C compiler warning. * binutils/readelf.c and binutils/unwind-ia64.c: - Incorrect mix of ANSI C prototypes and K&R definitions caused 10.20's HP ANSI C to baulk. I've fixed the definitions to check for ANSI mode or not. * config/mh-hpux, config/mh-papic and config/mt-papic: - Very bad idea by Cygnus to put compiler-specific flags here without testing which of either gcc or HP's cc is being used. Changed them to be more "neutral" (e.g. set RANLIB to /bin/true). * configure: - Added HP-UX override section including HP ANSI C flags (if the compiler is present), prefix setting and setting RANLIB to /bin/true. * gas/config/tc-hppa.c: - Cast RHS of expression to (unsigned char *) to avoid HP ANSI C compiler warning. * gas/dwarf2dbg.c: - Cast RHS of expression to (char *) to avoid HP ANSI C compiler warning. * gas/read.c and gprof/basic_blocks.c: - Second param of a function call should have been (unsigned int *), so duly cast it. * gas/stabs.c: - Uninitialised buf variable set to (char *)NULL to avoid HP ANSI C compiler warning. * mkinstalldirs: - Create install directories with a+rx permissions. To compile and install: [If you don't have HP's "lex" and "yacc" commands, install GNU flex and GNU bison and make sure that the "flex" and "bison" commands are in your PATH] [Edit the HP-UX override section in configure, particularly the prefix value] ksh configure make install Notes: * This binutils package has been built and successfully tested on both HP-UX 10.20 and 11.00 using HP's ANSI C compiler with the latest ANSI C patch on both platforms. It has also been built and tested OK on an 11.00 machine without gcc or HP's ANSI C compiler installed (using flex and bison). It hasn't been tested with gcc (chicken and egg situation - gcc requires binutils in order to work !). * GNU ld is *not* built on HP-UX. This is perfectly fine because HP-UX gcc uses HP's ld (make sure you get the latest ld(1) patch for HP-UX before you build gcc/g++ !). * For some utterly bizarre reason, libiberty isn't built as a shared library, even if you switch on enable_shared like I have done by default in the configure script. Surely this is wrong ? binutils/binutils-RUN/opt/binutils/doc/README010075500000000000003000000032670732753176100176450ustar000300000000000000 README for GNU development tools This directory contains various GNU compilers, assemblers, linkers, debuggers, etc., plus their support routines, definitions, and documentation. If you are receiving this as part of a GDB release, see the file gdb/README. If with a binutils release, see binutils/README; if with a libg++ release, see libg++/README, etc. That'll give you info about this package -- supported targets, how to use it, how to report bugs, etc. It is now possible to automatically configure and build a variety of tools with one command. To build all of the tools contained herein, run the ``configure'' script here, e.g.: ./configure make To install them (by default in /usr/local/bin, /usr/local/lib, etc), then do: make install (If the configure script can't determine your type of computer, give it the name as an argument, for instance ``./configure sun4''. You can use the script ``config.sub'' to test whether a name is recognized; if it is, config.sub translates it to a triplet specifying CPU, vendor, and OS.) If you have more than one compiler on your system, it is often best to explicitly set CC in the environment before running configure, and to also set CC when running make. For example (assuming sh/bash/ksh): CC=gcc ./configure make A similar example using csh: setenv CC gcc ./configure make Much of the code and documentation enclosed is copyright by the Free Software Foundation, Inc. See the file COPYING or COPYING.LIB in the various directories, for a description of the GNU General Public License terms under which you can copy the files. REPORTING BUGS: Again, see gdb/README, binutils/README, etc., for info on where and how to report problems. binutils/binutils-RUN/opt/binutils/include/ansidecl.h010064400000000000003000000160440732753176600215750ustar000300000000000000/* ANSI and traditional C compatability macros Copyright 1991, 1992, 1993, 1994, 1995, 1996, 1998, 1999, 2000 Free Software Foundation, Inc. This file is part of the GNU C Library. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. */ /* ANSI and traditional C compatibility macros ANSI C is assumed if __STDC__ is #defined. Macro ANSI C definition Traditional C definition ----- ---- - ---------- ----------- - ---------- PTR `void *' `char *' LONG_DOUBLE `long double' `double' VOLATILE `volatile' `' SIGNED `signed' `' PTRCONST `void *const' `char *' ANSI_PROTOTYPES 1 not defined CONST is also defined, but is obsolete. Just use const. obsolete -- DEFUN (name, arglist, args) Defines function NAME. ARGLIST lists the arguments, separated by commas and enclosed in parentheses. ARGLIST becomes the argument list in traditional C. ARGS list the arguments with their types. It becomes a prototype in ANSI C, and the type declarations in traditional C. Arguments should be separated with `AND'. For functions with a variable number of arguments, the last thing listed should be `DOTS'. obsolete -- DEFUN_VOID (name) Defines a function NAME, which takes no arguments. obsolete -- EXFUN (name, (prototype)) -- obsolete. Replaced by PARAMS. Do not use; will disappear someday soon. Was used in external function declarations. In ANSI C it is `NAME PROTOTYPE' (so PROTOTYPE should be enclosed in parentheses). In traditional C it is `NAME()'. For a function that takes no arguments, PROTOTYPE should be `(void)'. obsolete -- PROTO (type, name, (prototype) -- obsolete. This one has also been replaced by PARAMS. Do not use. PARAMS ((args)) We could use the EXFUN macro to handle prototype declarations, but the name is misleading and the result is ugly. So we just define a simple macro to handle the parameter lists, as in: static int foo PARAMS ((int, char)); This produces: `static int foo();' or `static int foo (int, char);' EXFUN would have done it like this: static int EXFUN (foo, (int, char)); but the function is not external...and it's hard to visually parse the function name out of the mess. EXFUN should be considered obsolete; new code should be written to use PARAMS. DOTS is also obsolete. Examples: extern int printf PARAMS ((const char *format, ...)); */ #ifndef _ANSIDECL_H #define _ANSIDECL_H 1 /* Every source file includes this file, so they will all get the switch for lint. */ /* LINTLIBRARY */ #if defined (__STDC__) || defined (_AIX) || (defined (__mips) && defined (_SYSTYPE_SVR4)) || defined(_WIN32) /* All known AIX compilers implement these things (but don't always define __STDC__). The RISC/OS MIPS compiler defines these things in SVR4 mode, but does not define __STDC__. */ #define PTR void * #define PTRCONST void *CONST #define LONG_DOUBLE long double #ifndef IN_GCC #define AND , #define NOARGS void #define VOLATILE volatile #define SIGNED signed #endif /* ! IN_GCC */ #define PARAMS(paramlist) paramlist #define ANSI_PROTOTYPES 1 #define VPARAMS(ARGS) ARGS #define VA_START(va_list,var) va_start(va_list,var) /* These are obsolete. Do not use. */ #ifndef IN_GCC #define CONST const #define DOTS , ... #define PROTO(type, name, arglist) type name arglist #define EXFUN(name, proto) name proto #define DEFUN(name, arglist, args) name(args) #define DEFUN_VOID(name) name(void) #endif /* ! IN_GCC */ #else /* Not ANSI C. */ #define PTR char * #define PTRCONST PTR #define LONG_DOUBLE double #ifndef IN_GCC #define AND ; #define NOARGS #define VOLATILE #define SIGNED #endif /* !IN_GCC */ #ifndef const /* some systems define it in header files for non-ansi mode */ #define const #endif #define PARAMS(paramlist) () #define VPARAMS(ARGS) (va_alist) va_dcl #define VA_START(va_list,var) va_start(va_list) /* These are obsolete. Do not use. */ #ifndef IN_GCC #define CONST #define DOTS #define PROTO(type, name, arglist) type name () #define EXFUN(name, proto) name() #define DEFUN(name, arglist, args) name arglist args; #define DEFUN_VOID(name) name() #endif /* ! IN_GCC */ #endif /* ANSI C. */ /* Using MACRO(x,y) in cpp #if conditionals does not work with some older preprocessors. Thus we can't define something like this: #define HAVE_GCC_VERSION(MAJOR, MINOR) \ (__GNUC__ > (MAJOR) || (__GNUC__ == (MAJOR) && __GNUC_MINOR__ >= (MINOR))) and then test "#if HAVE_GCC_VERSION(2,7)". So instead we use the macro below and test it against specific values. */ /* This macro simplifies testing whether we are using gcc, and if it is of a particular minimum version. (Both major & minor numbers are significant.) This macro will evaluate to 0 if we are not using gcc at all. */ #ifndef GCC_VERSION #define GCC_VERSION (__GNUC__ * 1000 + __GNUC_MINOR__) #endif /* GCC_VERSION */ /* Define macros for some gcc attributes. This permits us to use the macros freely, and know that they will come into play for the version of gcc in which they are supported. */ #if (GCC_VERSION < 2007) # define __attribute__(x) #endif /* Attribute __malloc__ on functions was valid as of gcc 2.96. */ #ifndef ATTRIBUTE_MALLOC # if (GCC_VERSION >= 2096) # define ATTRIBUTE_MALLOC __attribute__ ((__malloc__)) # else # define ATTRIBUTE_MALLOC # endif /* GNUC >= 2.96 */ #endif /* ATTRIBUTE_MALLOC */ /* Attributes on labels were valid as of gcc 2.93. */ #ifndef ATTRIBUTE_UNUSED_LABEL # if (GCC_VERSION >= 2093) # define ATTRIBUTE_UNUSED_LABEL ATTRIBUTE_UNUSED # else # define ATTRIBUTE_UNUSED_LABEL # endif /* GNUC >= 2.93 */ #endif /* ATTRIBUTE_UNUSED_LABEL */ #ifndef ATTRIBUTE_UNUSED #define ATTRIBUTE_UNUSED __attribute__ ((__unused__)) #endif /* ATTRIBUTE_UNUSED */ #ifndef ATTRIBUTE_NORETURN #define ATTRIBUTE_NORETURN __attribute__ ((__noreturn__)) #endif /* ATTRIBUTE_NORETURN */ #ifndef ATTRIBUTE_PRINTF #define ATTRIBUTE_PRINTF(m, n) __attribute__ ((__format__ (__printf__, m, n))) #define ATTRIBUTE_PRINTF_1 ATTRIBUTE_PRINTF(1, 2) #define ATTRIBUTE_PRINTF_2 ATTRIBUTE_PRINTF(2, 3) #define ATTRIBUTE_PRINTF_3 ATTRIBUTE_PRINTF(3, 4) #define ATTRIBUTE_PRINTF_4 ATTRIBUTE_PRINTF(4, 5) #define ATTRIBUTE_PRINTF_5 ATTRIBUTE_PRINTF(5, 6) #endif /* ATTRIBUTE_PRINTF */ /* We use __extension__ in some places to suppress -pedantic warnings about GCC extensions. This feature didn't work properly before gcc 2.8. */ #if GCC_VERSION < 2008 #define __extension__ #endif #endif /* ansidecl.h */ binutils/binutils-RUN/opt/binutils/include/bfd.h010064400000000000003000003565260732753176600205620ustar000300000000000000/* Main header file for the bfd library -- portable access to object files. Copyright 1990, 1991, 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001 Free Software Foundation, Inc. Contributed by Cygnus Support. ** NOTE: bfd.h and bfd-in2.h are GENERATED files. Don't change them; ** instead, change bfd-in.h or the other BFD source files processed to ** generate these files. This file is part of BFD, the Binary File Descriptor library. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. */ /* bfd.h -- The only header file required by users of the bfd library The bfd.h file is generated from bfd-in.h and various .c files; if you change it, your changes will probably be lost. All the prototypes and definitions following the comment "THE FOLLOWING IS EXTRACTED FROM THE SOURCE" are extracted from the source files for BFD. If you change it, someone oneday will extract it from the source again, and your changes will be lost. To save yourself from this bind, change the definitions in the source in the bfd directory. Type "make docs" and then "make headers" in that directory, and magically this file will change to reflect your changes. If you don't have the tools to perform the extraction, then you are safe from someone on your system trampling over your header files. You should still maintain the equivalence between the source and this file though; every change you make to the .c file should be reflected here. */ #ifndef __BFD_H_SEEN__ #define __BFD_H_SEEN__ #ifdef __cplusplus extern "C" { #endif #include "ansidecl.h" /* These two lines get substitutions done by commands in Makefile.in. */ #define BFD_VERSION "2.11.2" #define BFD_ARCH_SIZE 32 #define BFD_HOST_64BIT_LONG 0 #if 0 #define BFD_HOST_64_BIT #define BFD_HOST_U_64_BIT #endif #if BFD_ARCH_SIZE >= 64 #define BFD64 #endif #ifndef INLINE #if __GNUC__ >= 2 #define INLINE __inline__ #else #define INLINE #endif #endif /* forward declaration */ typedef struct _bfd bfd; /* To squelch erroneous compiler warnings ("illegal pointer combination") from the SVR3 compiler, we would like to typedef boolean to int (it doesn't like functions which return boolean. Making sure they are never implicitly declared to return int doesn't seem to help). But this file is not configured based on the host. */ /* General rules: functions which are boolean return true on success and false on failure (unless they're a predicate). -- bfd.doc */ /* I'm sure this is going to break something and someone is going to force me to change it. */ /* typedef enum boolean {false, true} boolean; */ /* Yup, SVR4 has a "typedef enum boolean" in -fnf */ /* It gets worse if the host also defines a true/false enum... -sts */ /* And even worse if your compiler has built-in boolean types... -law */ #if defined (__GNUG__) && (__GNUC__ > 2 || (__GNUC__ == 2 && __GNUC_MINOR__ >= 6)) #define TRUE_FALSE_ALREADY_DEFINED #endif #ifdef MPW /* Pre-emptive strike - get the file with the enum. */ #include #define TRUE_FALSE_ALREADY_DEFINED #endif /* MPW */ #ifndef TRUE_FALSE_ALREADY_DEFINED typedef enum bfd_boolean {false, true} boolean; #define BFD_TRUE_FALSE #else /* Use enum names that will appear nowhere else. */ typedef enum bfd_boolean {bfd_fffalse, bfd_tttrue} boolean; #endif /* A pointer to a position in a file. */ /* FIXME: This should be using off_t from . For now, try to avoid breaking stuff by not including here. This will break on systems with 64-bit file offsets (e.g. 4.4BSD). Probably the best long-term answer is to avoid using file_ptr AND off_t in this header file, and to handle this in the BFD implementation rather than in its interface. */ /* typedef off_t file_ptr; */ typedef long int file_ptr; /* Support for different sizes of target format ints and addresses. If the type `long' is at least 64 bits, BFD_HOST_64BIT_LONG will be set to 1 above. Otherwise, if gcc is being used, this code will use gcc's "long long" type. Otherwise, BFD_HOST_64_BIT must be defined above. */ #ifndef BFD_HOST_64_BIT # if BFD_HOST_64BIT_LONG # define BFD_HOST_64_BIT long # define BFD_HOST_U_64_BIT unsigned long # else # ifdef __GNUC__ # if __GNUC__ >= 2 # define BFD_HOST_64_BIT long long # define BFD_HOST_U_64_BIT unsigned long long # endif /* __GNUC__ >= 2 */ # endif /* ! defined (__GNUC__) */ # endif /* ! BFD_HOST_64BIT_LONG */ #endif /* ! defined (BFD_HOST_64_BIT) */ #ifdef BFD64 #ifndef BFD_HOST_64_BIT #error No 64 bit integer type available #endif /* ! defined (BFD_HOST_64_BIT) */ typedef BFD_HOST_U_64_BIT bfd_vma; typedef BFD_HOST_64_BIT bfd_signed_vma; typedef BFD_HOST_U_64_BIT bfd_size_type; typedef BFD_HOST_U_64_BIT symvalue; #ifndef fprintf_vma #if BFD_HOST_64BIT_LONG #define sprintf_vma(s,x) sprintf (s, "%016lx", x) #define fprintf_vma(f,x) fprintf (f, "%016lx", x) #else #define _bfd_int64_low(x) ((unsigned long) (((x) & 0xffffffff))) #define _bfd_int64_high(x) ((unsigned long) (((x) >> 32) & 0xffffffff)) #define fprintf_vma(s,x) \ fprintf ((s), "%08lx%08lx", _bfd_int64_high (x), _bfd_int64_low (x)) #define sprintf_vma(s,x) \ sprintf ((s), "%08lx%08lx", _bfd_int64_high (x), _bfd_int64_low (x)) #endif #endif #else /* not BFD64 */ /* Represent a target address. Also used as a generic unsigned type which is guaranteed to be big enough to hold any arithmetic types we need to deal with. */ typedef unsigned long bfd_vma; /* A generic signed type which is guaranteed to be big enough to hold any arithmetic types we need to deal with. Can be assumed to be compatible with bfd_vma in the same way that signed and unsigned ints are compatible (as parameters, in assignment, etc). */ typedef long bfd_signed_vma; typedef unsigned long symvalue; typedef unsigned long bfd_size_type; /* Print a bfd_vma x on stream s. */ #define fprintf_vma(s,x) fprintf (s, "%08lx", x) #define sprintf_vma(s,x) sprintf (s, "%08lx", x) #endif /* not BFD64 */ #define printf_vma(x) fprintf_vma(stdout,x) typedef unsigned int flagword; /* 32 bits of flags */ typedef unsigned char bfd_byte; /** File formats */ typedef enum bfd_format { bfd_unknown = 0, /* file format is unknown */ bfd_object, /* linker/assember/compiler output */ bfd_archive, /* object archive file */ bfd_core, /* core dump */ bfd_type_end} /* marks the end; don't use it! */ bfd_format; /* Values that may appear in the flags field of a BFD. These also appear in the object_flags field of the bfd_target structure, where they indicate the set of flags used by that backend (not all flags are meaningful for all object file formats) (FIXME: at the moment, the object_flags values have mostly just been copied from backend to another, and are not necessarily correct). */ /* No flags. */ #define BFD_NO_FLAGS 0x00 /* BFD contains relocation entries. */ #define HAS_RELOC 0x01 /* BFD is directly executable. */ #define EXEC_P 0x02 /* BFD has line number information (basically used for F_LNNO in a COFF header). */ #define HAS_LINENO 0x04 /* BFD has debugging information. */ #define HAS_DEBUG 0x08 /* BFD has symbols. */ #define HAS_SYMS 0x10 /* BFD has local symbols (basically used for F_LSYMS in a COFF header). */ #define HAS_LOCALS 0x20 /* BFD is a dynamic object. */ #define DYNAMIC 0x40 /* Text section is write protected (if D_PAGED is not set, this is like an a.out NMAGIC file) (the linker sets this by default, but clears it for -r or -N). */ #define WP_TEXT 0x80 /* BFD is dynamically paged (this is like an a.out ZMAGIC file) (the linker sets this by default, but clears it for -r or -n or -N). */ #define D_PAGED 0x100 /* BFD is relaxable (this means that bfd_relax_section may be able to do something) (sometimes bfd_relax_section can do something even if this is not set). */ #define BFD_IS_RELAXABLE 0x200 /* This may be set before writing out a BFD to request using a traditional format. For example, this is used to request that when writing out an a.out object the symbols not be hashed to eliminate duplicates. */ #define BFD_TRADITIONAL_FORMAT 0x400 /* This flag indicates that the BFD contents are actually cached in memory. If this is set, iostream points to a bfd_in_memory struct. */ #define BFD_IN_MEMORY 0x800 /* symbols and relocation */ /* A count of carsyms (canonical archive symbols). */ typedef unsigned long symindex; /* How to perform a relocation. */ typedef const struct reloc_howto_struct reloc_howto_type; #define BFD_NO_MORE_SYMBOLS ((symindex) ~0) /* General purpose part of a symbol X; target specific parts are in libcoff.h, libaout.h, etc. */ #define bfd_get_section(x) ((x)->section) #define bfd_get_output_section(x) ((x)->section->output_section) #define bfd_set_section(x,y) ((x)->section) = (y) #define bfd_asymbol_base(x) ((x)->section->vma) #define bfd_asymbol_value(x) (bfd_asymbol_base(x) + (x)->value) #define bfd_asymbol_name(x) ((x)->name) /*Perhaps future: #define bfd_asymbol_bfd(x) ((x)->section->owner)*/ #define bfd_asymbol_bfd(x) ((x)->the_bfd) #define bfd_asymbol_flavour(x) (bfd_asymbol_bfd(x)->xvec->flavour) /* A canonical archive symbol. */ /* This is a type pun with struct ranlib on purpose! */ typedef struct carsym { char *name; file_ptr file_offset; /* look here to find the file */ } carsym; /* to make these you call a carsymogen */ /* Used in generating armaps (archive tables of contents). Perhaps just a forward definition would do? */ struct orl { /* output ranlib */ char **name; /* symbol name */ file_ptr pos; /* bfd* or file position */ int namidx; /* index into string table */ }; /* Linenumber stuff */ typedef struct lineno_cache_entry { unsigned int line_number; /* Linenumber from start of function*/ union { struct symbol_cache_entry *sym; /* Function name */ unsigned long offset; /* Offset into section */ } u; } alent; /* object and core file sections */ #define align_power(addr, align) \ ( ((addr) + ((1<<(align))-1)) & (-1 << (align))) typedef struct sec *sec_ptr; #define bfd_get_section_name(bfd, ptr) ((ptr)->name + 0) #define bfd_get_section_vma(bfd, ptr) ((ptr)->vma + 0) #define bfd_get_section_alignment(bfd, ptr) ((ptr)->alignment_power + 0) #define bfd_section_name(bfd, ptr) ((ptr)->name) #define bfd_section_size(bfd, ptr) (bfd_get_section_size_before_reloc(ptr)) #define bfd_section_vma(bfd, ptr) ((ptr)->vma) #define bfd_section_lma(bfd, ptr) ((ptr)->lma) #define bfd_section_alignment(bfd, ptr) ((ptr)->alignment_power) #define bfd_get_section_flags(bfd, ptr) ((ptr)->flags + 0) #define bfd_get_section_userdata(bfd, ptr) ((ptr)->userdata) #define bfd_is_com_section(ptr) (((ptr)->flags & SEC_IS_COMMON) != 0) #define bfd_set_section_vma(bfd, ptr, val) (((ptr)->vma = (ptr)->lma= (val)), ((ptr)->user_set_vma = (boolean)true), true) #define bfd_set_section_alignment(bfd, ptr, val) (((ptr)->alignment_power = (val)),true) #define bfd_set_section_userdata(bfd, ptr, val) (((ptr)->userdata = (val)),true) typedef struct stat stat_type; typedef enum bfd_print_symbol { bfd_print_symbol_name, bfd_print_symbol_more, bfd_print_symbol_all } bfd_print_symbol_type; /* Information about a symbol that nm needs. */ typedef struct _symbol_info { symvalue value; char type; CONST char *name; /* Symbol name. */ unsigned char stab_type; /* Stab type. */ char stab_other; /* Stab other. */ short stab_desc; /* Stab desc. */ CONST char *stab_name; /* String for stab type. */ } symbol_info; /* Get the name of a stabs type code. */ extern const char *bfd_get_stab_name PARAMS ((int)); /* Hash table routines. There is no way to free up a hash table. */ /* An element in the hash table. Most uses will actually use a larger structure, and an instance of this will be the first field. */ struct bfd_hash_entry { /* Next entry for this hash code. */ struct bfd_hash_entry *next; /* String being hashed. */ const char *string; /* Hash code. This is the full hash code, not the index into the table. */ unsigned long hash; }; /* A hash table. */ struct bfd_hash_table { /* The hash array. */ struct bfd_hash_entry **table; /* The number of slots in the hash table. */ unsigned int size; /* A function used to create new elements in the hash table. The first entry is itself a pointer to an element. When this function is first invoked, this pointer will be NULL. However, having the pointer permits a hierarchy of method functions to be built each of which calls the function in the superclass. Thus each function should be written to allocate a new block of memory only if the argument is NULL. */ struct bfd_hash_entry *(*newfunc) PARAMS ((struct bfd_hash_entry *, struct bfd_hash_table *, const char *)); /* An objalloc for this hash table. This is a struct objalloc *, but we use PTR to avoid requiring the inclusion of objalloc.h. */ PTR memory; }; /* Initialize a hash table. */ extern boolean bfd_hash_table_init PARAMS ((struct bfd_hash_table *, struct bfd_hash_entry *(*) (struct bfd_hash_entry *, struct bfd_hash_table *, const char *))); /* Initialize a hash table specifying a size. */ extern boolean bfd_hash_table_init_n PARAMS ((struct bfd_hash_table *, struct bfd_hash_entry *(*) (struct bfd_hash_entry *, struct bfd_hash_table *, const char *), unsigned int size)); /* Free up a hash table. */ extern void bfd_hash_table_free PARAMS ((struct bfd_hash_table *)); /* Look up a string in a hash table. If CREATE is true, a new entry will be created for this string if one does not already exist. The COPY argument must be true if this routine should copy the string into newly allocated memory when adding an entry. */ extern struct bfd_hash_entry *bfd_hash_lookup PARAMS ((struct bfd_hash_table *, const char *, boolean create, boolean copy)); /* Replace an entry in a hash table. */ extern void bfd_hash_replace PARAMS ((struct bfd_hash_table *, struct bfd_hash_entry *old, struct bfd_hash_entry *nw)); /* Base method for creating a hash table entry. */ extern struct bfd_hash_entry *bfd_hash_newfunc PARAMS ((struct bfd_hash_entry *, struct bfd_hash_table *, const char *)); /* Grab some space for a hash table entry. */ extern PTR bfd_hash_allocate PARAMS ((struct bfd_hash_table *, unsigned int)); /* Traverse a hash table in a random order, calling a function on each element. If the function returns false, the traversal stops. The INFO argument is passed to the function. */ extern void bfd_hash_traverse PARAMS ((struct bfd_hash_table *, boolean (*) (struct bfd_hash_entry *, PTR), PTR info)); /* Semi-portable string concatenation in cpp. The CAT4 hack is to avoid a problem with some strict ANSI C preprocessors. The problem is, "32_" is not a valid preprocessing token, and we don't want extra underscores (e.g., "nlm_32_"). The XCAT2 macro will cause the inner CAT macros to be evaluated first, producing still-valid pp-tokens. Then the final concatenation can be done. (Sigh.) */ #ifndef CAT #ifdef SABER #define CAT(a,b) a##b #define CAT3(a,b,c) a##b##c #define CAT4(a,b,c,d) a##b##c##d #else #if defined(__STDC__) || defined(ALMOST_STDC) #define CAT(a,b) a##b #define CAT3(a,b,c) a##b##c #define XCAT2(a,b) CAT(a,b) #define CAT4(a,b,c,d) XCAT2(CAT(a,b),CAT(c,d)) #else #define CAT(a,b) a/**/b #define CAT3(a,b,c) a/**/b/**/c #define CAT4(a,b,c,d) a/**/b/**/c/**/d #endif #endif #endif #define COFF_SWAP_TABLE (PTR) &bfd_coff_std_swap_table /* User program access to BFD facilities */ /* Direct I/O routines, for programs which know more about the object file than BFD does. Use higher level routines if possible. */ extern bfd_size_type bfd_read PARAMS ((PTR, bfd_size_type size, bfd_size_type nitems, bfd *abfd)); extern bfd_size_type bfd_write PARAMS ((const PTR, bfd_size_type size, bfd_size_type nitems, bfd *abfd)); extern int bfd_seek PARAMS ((bfd *abfd, file_ptr fp, int direction)); extern long bfd_tell PARAMS ((bfd *abfd)); extern int bfd_flush PARAMS ((bfd *abfd)); extern int bfd_stat PARAMS ((bfd *abfd, struct stat *)); /* Cast from const char * to char * so that caller can assign to a char * without a warning. */ #define bfd_get_filename(abfd) ((char *) (abfd)->filename) #define bfd_get_cacheable(abfd) ((abfd)->cacheable) #define bfd_get_format(abfd) ((abfd)->format) #define bfd_get_target(abfd) ((abfd)->xvec->name) #define bfd_get_flavour(abfd) ((abfd)->xvec->flavour) #define bfd_family_coff(abfd) \ (bfd_get_flavour (abfd) == bfd_target_coff_flavour || \ bfd_get_flavour (abfd) == bfd_target_xcoff_flavour) #define bfd_big_endian(abfd) ((abfd)->xvec->byteorder == BFD_ENDIAN_BIG) #define bfd_little_endian(abfd) ((abfd)->xvec->byteorder == BFD_ENDIAN_LITTLE) #define bfd_header_big_endian(abfd) \ ((abfd)->xvec->header_byteorder == BFD_ENDIAN_BIG) #define bfd_header_little_endian(abfd) \ ((abfd)->xvec->header_byteorder == BFD_ENDIAN_LITTLE) #define bfd_get_file_flags(abfd) ((abfd)->flags) #define bfd_applicable_file_flags(abfd) ((abfd)->xvec->object_flags) #define bfd_applicable_section_flags(abfd) ((abfd)->xvec->section_flags) #define bfd_my_archive(abfd) ((abfd)->my_archive) #define bfd_has_map(abfd) ((abfd)->has_armap) #define bfd_valid_reloc_types(abfd) ((abfd)->xvec->valid_reloc_types) #define bfd_usrdata(abfd) ((abfd)->usrdata) #define bfd_get_start_address(abfd) ((abfd)->start_address) #define bfd_get_symcount(abfd) ((abfd)->symcount) #define bfd_get_outsymbols(abfd) ((abfd)->outsymbols) #define bfd_count_sections(abfd) ((abfd)->section_count) #define bfd_get_symbol_leading_char(abfd) ((abfd)->xvec->symbol_leading_char) #define bfd_set_cacheable(abfd,bool) (((abfd)->cacheable = (boolean) (bool)), true) extern boolean bfd_record_phdr PARAMS ((bfd *, unsigned long, boolean, flagword, boolean, bfd_vma, boolean, boolean, unsigned int, struct sec **)); /* Byte swapping routines. */ bfd_vma bfd_getb64 PARAMS ((const unsigned char *)); bfd_vma bfd_getl64 PARAMS ((const unsigned char *)); bfd_signed_vma bfd_getb_signed_64 PARAMS ((const unsigned char *)); bfd_signed_vma bfd_getl_signed_64 PARAMS ((const unsigned char *)); bfd_vma bfd_getb32 PARAMS ((const unsigned char *)); bfd_vma bfd_getl32 PARAMS ((const unsigned char *)); bfd_signed_vma bfd_getb_signed_32 PARAMS ((const unsigned char *)); bfd_signed_vma bfd_getl_signed_32 PARAMS ((const unsigned char *)); bfd_vma bfd_getb16 PARAMS ((const unsigned char *)); bfd_vma bfd_getl16 PARAMS ((const unsigned char *)); bfd_signed_vma bfd_getb_signed_16 PARAMS ((const unsigned char *)); bfd_signed_vma bfd_getl_signed_16 PARAMS ((const unsigned char *)); void bfd_putb64 PARAMS ((bfd_vma, unsigned char *)); void bfd_putl64 PARAMS ((bfd_vma, unsigned char *)); void bfd_putb32 PARAMS ((bfd_vma, unsigned char *)); void bfd_putl32 PARAMS ((bfd_vma, unsigned char *)); void bfd_putb16 PARAMS ((bfd_vma, unsigned char *)); void bfd_putl16 PARAMS ((bfd_vma, unsigned char *)); /* Byte swapping routines which take size and endiannes as arguments. */ bfd_vma bfd_get_bits PARAMS ((bfd_byte *, int, boolean)); void bfd_put_bits PARAMS ((bfd_vma, bfd_byte *, int, boolean)); /* Externally visible ECOFF routines. */ #if defined(__STDC__) || defined(ALMOST_STDC) struct ecoff_debug_info; struct ecoff_debug_swap; struct ecoff_extr; struct symbol_cache_entry; struct bfd_link_info; struct bfd_link_hash_entry; struct bfd_elf_version_tree; #endif extern bfd_vma bfd_ecoff_get_gp_value PARAMS ((bfd * abfd)); extern boolean bfd_ecoff_set_gp_value PARAMS ((bfd *abfd, bfd_vma gp_value)); extern boolean bfd_ecoff_set_regmasks PARAMS ((bfd *abfd, unsigned long gprmask, unsigned long fprmask, unsigned long *cprmask)); extern PTR bfd_ecoff_debug_init PARAMS ((bfd *output_bfd, struct ecoff_debug_info *output_debug, const struct ecoff_debug_swap *output_swap, struct bfd_link_info *)); extern void bfd_ecoff_debug_free PARAMS ((PTR handle, bfd *output_bfd, struct ecoff_debug_info *output_debug, const struct ecoff_debug_swap *output_swap, struct bfd_link_info *)); extern boolean bfd_ecoff_debug_accumulate PARAMS ((PTR handle, bfd *output_bfd, struct ecoff_debug_info *output_debug, const struct ecoff_debug_swap *output_swap, bfd *input_bfd, struct ecoff_debug_info *input_debug, const struct ecoff_debug_swap *input_swap, struct bfd_link_info *)); extern boolean bfd_ecoff_debug_accumulate_other PARAMS ((PTR handle, bfd *output_bfd, struct ecoff_debug_info *output_debug, const struct ecoff_debug_swap *output_swap, bfd *input_bfd, struct bfd_link_info *)); extern boolean bfd_ecoff_debug_externals PARAMS ((bfd *abfd, struct ecoff_debug_info *debug, const struct ecoff_debug_swap *swap, boolean relocateable, boolean (*get_extr) (struct symbol_cache_entry *, struct ecoff_extr *), void (*set_index) (struct symbol_cache_entry *, bfd_size_type))); extern boolean bfd_ecoff_debug_one_external PARAMS ((bfd *abfd, struct ecoff_debug_info *debug, const struct ecoff_debug_swap *swap, const char *name, struct ecoff_extr *esym)); extern bfd_size_type bfd_ecoff_debug_size PARAMS ((bfd *abfd, struct ecoff_debug_info *debug, const struct ecoff_debug_swap *swap)); extern boolean bfd_ecoff_write_debug PARAMS ((bfd *abfd, struct ecoff_debug_info *debug, const struct ecoff_debug_swap *swap, file_ptr where)); extern boolean bfd_ecoff_write_accumulated_debug PARAMS ((PTR handle, bfd *abfd, struct ecoff_debug_info *debug, const struct ecoff_debug_swap *swap, struct bfd_link_info *info, file_ptr where)); extern boolean bfd_mips_ecoff_create_embedded_relocs PARAMS ((bfd *, struct bfd_link_info *, struct sec *, struct sec *, char **)); /* Externally visible ELF routines. */ struct bfd_link_needed_list { struct bfd_link_needed_list *next; bfd *by; const char *name; }; extern boolean bfd_elf32_record_link_assignment PARAMS ((bfd *, struct bfd_link_info *, const char *, boolean)); extern boolean bfd_elf64_record_link_assignment PARAMS ((bfd *, struct bfd_link_info *, const char *, boolean)); extern struct bfd_link_needed_list *bfd_elf_get_needed_list PARAMS ((bfd *, struct bfd_link_info *)); extern boolean bfd_elf_get_bfd_needed_list PARAMS ((bfd *, struct bfd_link_needed_list **)); extern boolean bfd_elf32_size_dynamic_sections PARAMS ((bfd *, const char *, const char *, boolean, const char *, const char * const *, struct bfd_link_info *, struct sec **, struct bfd_elf_version_tree *)); extern boolean bfd_elf64_size_dynamic_sections PARAMS ((bfd *, const char *, const char *, boolean, const char *, const char * const *, struct bfd_link_info *, struct sec **, struct bfd_elf_version_tree *)); extern void bfd_elf_set_dt_needed_name PARAMS ((bfd *, const char *)); extern void bfd_elf_set_dt_needed_soname PARAMS ((bfd *, const char *)); extern const char *bfd_elf_get_dt_soname PARAMS ((bfd *)); extern struct bfd_link_needed_list *bfd_elf_get_runpath_list PARAMS ((bfd *, struct bfd_link_info *)); /* Return an upper bound on the number of bytes required to store a copy of ABFD's program header table entries. Return -1 if an error occurs; bfd_get_error will return an appropriate code. */ extern long bfd_get_elf_phdr_upper_bound PARAMS ((bfd *abfd)); /* Copy ABFD's program header table entries to *PHDRS. The entries will be stored as an array of Elf_Internal_Phdr structures, as defined in include/elf/internal.h. To find out how large the buffer needs to be, call bfd_get_elf_phdr_upper_bound. Return the number of program header table entries read, or -1 if an error occurs; bfd_get_error will return an appropriate code. */ extern int bfd_get_elf_phdrs PARAMS ((bfd *abfd, void *phdrs)); /* Return the arch_size field of an elf bfd, or -1 if not elf. */ extern int bfd_get_arch_size PARAMS ((bfd *)); /* Return true if address "naturally" sign extends, or -1 if not elf. */ extern int bfd_get_sign_extend_vma PARAMS ((bfd *)); extern boolean bfd_m68k_elf32_create_embedded_relocs PARAMS ((bfd *, struct bfd_link_info *, struct sec *, struct sec *, char **)); /* SunOS shared library support routines for the linker. */ extern struct bfd_link_needed_list *bfd_sunos_get_needed_list PARAMS ((bfd *, struct bfd_link_info *)); extern boolean bfd_sunos_record_link_assignment PARAMS ((bfd *, struct bfd_link_info *, const char *)); extern boolean bfd_sunos_size_dynamic_sections PARAMS ((bfd *, struct bfd_link_info *, struct sec **, struct sec **, struct sec **)); /* Linux shared library support routines for the linker. */ extern boolean bfd_i386linux_size_dynamic_sections PARAMS ((bfd *, struct bfd_link_info *)); extern boolean bfd_m68klinux_size_dynamic_sections PARAMS ((bfd *, struct bfd_link_info *)); extern boolean bfd_sparclinux_size_dynamic_sections PARAMS ((bfd *, struct bfd_link_info *)); /* mmap hacks */ struct _bfd_window_internal; typedef struct _bfd_window_internal bfd_window_internal; typedef struct _bfd_window { /* What the user asked for. */ PTR data; bfd_size_type size; /* The actual window used by BFD. Small user-requested read-only regions sharing a page may share a single window into the object file. Read-write versions shouldn't until I've fixed things to keep track of which portions have been claimed by the application; don't want to give the same region back when the application wants two writable copies! */ struct _bfd_window_internal *i; } bfd_window; extern void bfd_init_window PARAMS ((bfd_window *)); extern void bfd_free_window PARAMS ((bfd_window *)); extern boolean bfd_get_file_window PARAMS ((bfd *, file_ptr, bfd_size_type, bfd_window *, boolean)); /* XCOFF support routines for the linker. */ extern boolean bfd_xcoff_link_record_set PARAMS ((bfd *, struct bfd_link_info *, struct bfd_link_hash_entry *, bfd_size_type)); extern boolean bfd_xcoff_import_symbol PARAMS ((bfd *, struct bfd_link_info *, struct bfd_link_hash_entry *, bfd_vma, const char *, const char *, const char *)); extern boolean bfd_xcoff_export_symbol PARAMS ((bfd *, struct bfd_link_info *, struct bfd_link_hash_entry *, boolean)); extern boolean bfd_xcoff_link_count_reloc PARAMS ((bfd *, struct bfd_link_info *, const char *)); extern boolean bfd_xcoff_record_link_assignment PARAMS ((bfd *, struct bfd_link_info *, const char *)); extern boolean bfd_xcoff_size_dynamic_sections PARAMS ((bfd *, struct bfd_link_info *, const char *, const char *, unsigned long, unsigned long, unsigned long, boolean, int, boolean, boolean, struct sec **)); /* Externally visible COFF routines. */ #if defined(__STDC__) || defined(ALMOST_STDC) struct internal_syment; union internal_auxent; #endif extern boolean bfd_coff_get_syment PARAMS ((bfd *, struct symbol_cache_entry *, struct internal_syment *)); extern boolean bfd_coff_get_auxent PARAMS ((bfd *, struct symbol_cache_entry *, int, union internal_auxent *)); extern boolean bfd_coff_set_symbol_class PARAMS ((bfd *, struct symbol_cache_entry *, unsigned int)); extern boolean bfd_m68k_coff_create_embedded_relocs PARAMS ((bfd *, struct bfd_link_info *, struct sec *, struct sec *, char **)); /* ARM Interworking support. Called from linker. */ extern boolean bfd_arm_allocate_interworking_sections PARAMS ((struct bfd_link_info *)); extern boolean bfd_arm_process_before_allocation PARAMS ((bfd *, struct bfd_link_info *, int)); extern boolean bfd_arm_get_bfd_for_interworking PARAMS ((bfd *, struct bfd_link_info *)); /* PE ARM Interworking support. Called from linker. */ extern boolean bfd_arm_pe_allocate_interworking_sections PARAMS ((struct bfd_link_info *)); extern boolean bfd_arm_pe_process_before_allocation PARAMS ((bfd *, struct bfd_link_info *, int)); extern boolean bfd_arm_pe_get_bfd_for_interworking PARAMS ((bfd *, struct bfd_link_info *)); /* ELF ARM Interworking support. Called from linker. */ extern boolean bfd_elf32_arm_allocate_interworking_sections PARAMS ((struct bfd_link_info *)); extern boolean bfd_elf32_arm_process_before_allocation PARAMS ((bfd *, struct bfd_link_info *, int)); extern boolean bfd_elf32_arm_get_bfd_for_interworking PARAMS ((bfd *, struct bfd_link_info *)); /* TI COFF load page support. */ extern void bfd_ticoff_set_section_load_page PARAMS ((struct sec *, int)); extern int bfd_ticoff_get_section_load_page PARAMS ((struct sec *)); /* And more from the source. */ void bfd_init PARAMS ((void)); bfd * bfd_openr PARAMS ((CONST char *filename, CONST char *target)); bfd * bfd_fdopenr PARAMS ((CONST char *filename, CONST char *target, int fd)); bfd * bfd_openstreamr PARAMS ((const char *, const char *, PTR)); bfd * bfd_openw PARAMS ((CONST char *filename, CONST char *target)); boolean bfd_close PARAMS ((bfd *abfd)); boolean bfd_close_all_done PARAMS ((bfd *)); bfd * bfd_create PARAMS ((CONST char *filename, bfd *templ)); boolean bfd_make_writable PARAMS ((bfd *abfd)); boolean bfd_make_readable PARAMS ((bfd *abfd)); /* Byte swapping macros for user section data. */ #define bfd_put_8(abfd, val, ptr) \ ((void) (*((unsigned char *) (ptr)) = (unsigned char) (val))) #define bfd_put_signed_8 \ bfd_put_8 #define bfd_get_8(abfd, ptr) \ (*(unsigned char *) (ptr)) #define bfd_get_signed_8(abfd, ptr) \ ((*(unsigned char *) (ptr) ^ 0x80) - 0x80) #define bfd_put_16(abfd, val, ptr) \ BFD_SEND(abfd, bfd_putx16, ((val),(ptr))) #define bfd_put_signed_16 \ bfd_put_16 #define bfd_get_16(abfd, ptr) \ BFD_SEND(abfd, bfd_getx16, (ptr)) #define bfd_get_signed_16(abfd, ptr) \ BFD_SEND (abfd, bfd_getx_signed_16, (ptr)) #define bfd_put_32(abfd, val, ptr) \ BFD_SEND(abfd, bfd_putx32, ((val),(ptr))) #define bfd_put_signed_32 \ bfd_put_32 #define bfd_get_32(abfd, ptr) \ BFD_SEND(abfd, bfd_getx32, (ptr)) #define bfd_get_signed_32(abfd, ptr) \ BFD_SEND(abfd, bfd_getx_signed_32, (ptr)) #define bfd_put_64(abfd, val, ptr) \ BFD_SEND(abfd, bfd_putx64, ((val), (ptr))) #define bfd_put_signed_64 \ bfd_put_64 #define bfd_get_64(abfd, ptr) \ BFD_SEND(abfd, bfd_getx64, (ptr)) #define bfd_get_signed_64(abfd, ptr) \ BFD_SEND(abfd, bfd_getx_signed_64, (ptr)) #define bfd_get(bits, abfd, ptr) \ ((bits) == 8 ? bfd_get_8 (abfd, ptr) \ : (bits) == 16 ? bfd_get_16 (abfd, ptr) \ : (bits) == 32 ? bfd_get_32 (abfd, ptr) \ : (bits) == 64 ? bfd_get_64 (abfd, ptr) \ : (abort (), (bfd_vma) - 1)) #define bfd_put(bits, abfd, val, ptr) \ ((bits) == 8 ? bfd_put_8 (abfd, val, ptr) \ : (bits) == 16 ? bfd_put_16 (abfd, val, ptr) \ : (bits) == 32 ? bfd_put_32 (abfd, val, ptr) \ : (bits) == 64 ? bfd_put_64 (abfd, val, ptr) \ : (abort (), (void) 0)) /* Byte swapping macros for file header data. */ #define bfd_h_put_8(abfd, val, ptr) \ bfd_put_8 (abfd, val, ptr) #define bfd_h_put_signed_8(abfd, val, ptr) \ bfd_put_8 (abfd, val, ptr) #define bfd_h_get_8(abfd, ptr) \ bfd_get_8 (abfd, ptr) #define bfd_h_get_signed_8(abfd, ptr) \ bfd_get_signed_8 (abfd, ptr) #define bfd_h_put_16(abfd, val, ptr) \ BFD_SEND(abfd, bfd_h_putx16,(val,ptr)) #define bfd_h_put_signed_16 \ bfd_h_put_16 #define bfd_h_get_16(abfd, ptr) \ BFD_SEND(abfd, bfd_h_getx16,(ptr)) #define bfd_h_get_signed_16(abfd, ptr) \ BFD_SEND(abfd, bfd_h_getx_signed_16, (ptr)) #define bfd_h_put_32(abfd, val, ptr) \ BFD_SEND(abfd, bfd_h_putx32,(val,ptr)) #define bfd_h_put_signed_32 \ bfd_h_put_32 #define bfd_h_get_32(abfd, ptr) \ BFD_SEND(abfd, bfd_h_getx32,(ptr)) #define bfd_h_get_signed_32(abfd, ptr) \ BFD_SEND(abfd, bfd_h_getx_signed_32, (ptr)) #define bfd_h_put_64(abfd, val, ptr) \ BFD_SEND(abfd, bfd_h_putx64,(val, ptr)) #define bfd_h_put_signed_64 \ bfd_h_put_64 #define bfd_h_get_64(abfd, ptr) \ BFD_SEND(abfd, bfd_h_getx64,(ptr)) #define bfd_h_get_signed_64(abfd, ptr) \ BFD_SEND(abfd, bfd_h_getx_signed_64, (ptr)) /* This structure is used for a comdat section, as in PE. A comdat section is associated with a particular symbol. When the linker sees a comdat section, it keeps only one of the sections with a given name and associated with a given symbol. */ struct bfd_comdat_info { /* The name of the symbol associated with a comdat section. */ const char *name; /* The local symbol table index of the symbol associated with a comdat section. This is only meaningful to the object file format specific code; it is not an index into the list returned by bfd_canonicalize_symtab. */ long symbol; }; typedef struct sec { /* The name of the section; the name isn't a copy, the pointer is the same as that passed to bfd_make_section. */ const char *name; /* A unique sequence number. */ int id; /* Which section is it; 0..nth. */ int index; /* The next section in the list belonging to the BFD, or NULL. */ struct sec *next; /* The field flags contains attributes of the section. Some flags are read in from the object file, and some are synthesized from other information. */ flagword flags; #define SEC_NO_FLAGS 0x000 /* Tells the OS to allocate space for this section when loading. This is clear for a section containing debug information only. */ #define SEC_ALLOC 0x001 /* Tells the OS to load the section from the file when loading. This is clear for a .bss section. */ #define SEC_LOAD 0x002 /* The section contains data still to be relocated, so there is some relocation information too. */ #define SEC_RELOC 0x004 #if 0 /* Obsolete ? */ #define SEC_BALIGN 0x008 #endif /* A signal to the OS that the section contains read only data. */ #define SEC_READONLY 0x010 /* The section contains code only. */ #define SEC_CODE 0x020 /* The section contains data only. */ #define SEC_DATA 0x040 /* The section will reside in ROM. */ #define SEC_ROM 0x080 /* The section contains constructor information. This section type is used by the linker to create lists of constructors and destructors used by <>. When a back end sees a symbol which should be used in a constructor list, it creates a new section for the type of name (e.g., <<__CTOR_LIST__>>), attaches the symbol to it, and builds a relocation. To build the lists of constructors, all the linker has to do is catenate all the sections called <<__CTOR_LIST__>> and relocate the data contained within - exactly the operations it would peform on standard data. */ #define SEC_CONSTRUCTOR 0x100 /* The section is a constructor, and should be placed at the end of the text, data, or bss section(?). */ #define SEC_CONSTRUCTOR_TEXT 0x1100 #define SEC_CONSTRUCTOR_DATA 0x2100 #define SEC_CONSTRUCTOR_BSS 0x3100 /* The section has contents - a data section could be <> | <>; a debug section could be <> */ #define SEC_HAS_CONTENTS 0x200 /* An instruction to the linker to not output the section even if it has information which would normally be written. */ #define SEC_NEVER_LOAD 0x400 /* The section is a COFF shared library section. This flag is only for the linker. If this type of section appears in the input file, the linker must copy it to the output file without changing the vma or size. FIXME: Although this was originally intended to be general, it really is COFF specific (and the flag was renamed to indicate this). It might be cleaner to have some more general mechanism to allow the back end to control what the linker does with sections. */ #define SEC_COFF_SHARED_LIBRARY 0x800 /* The section has GOT references. This flag is only for the linker, and is currently only used by the elf32-hppa back end. It will be set if global offset table references were detected in this section, which indicate to the linker that the section contains PIC code, and must be handled specially when doing a static link. */ #define SEC_HAS_GOT_REF 0x4000 /* The section contains common symbols (symbols may be defined multiple times, the value of a symbol is the amount of space it requires, and the largest symbol value is the one used). Most targets have exactly one of these (which we translate to bfd_com_section_ptr), but ECOFF has two. */ #define SEC_IS_COMMON 0x8000 /* The section contains only debugging information. For example, this is set for ELF .debug and .stab sections. strip tests this flag to see if a section can be discarded. */ #define SEC_DEBUGGING 0x10000 /* The contents of this section are held in memory pointed to by the contents field. This is checked by bfd_get_section_contents, and the data is retrieved from memory if appropriate. */ #define SEC_IN_MEMORY 0x20000 /* The contents of this section are to be excluded by the linker for executable and shared objects unless those objects are to be further relocated. */ #define SEC_EXCLUDE 0x40000 /* The contents of this section are to be sorted by the based on the address specified in the associated symbol table. */ #define SEC_SORT_ENTRIES 0x80000 /* When linking, duplicate sections of the same name should be discarded, rather than being combined into a single section as is usually done. This is similar to how common symbols are handled. See SEC_LINK_DUPLICATES below. */ #define SEC_LINK_ONCE 0x100000 /* If SEC_LINK_ONCE is set, this bitfield describes how the linker should handle duplicate sections. */ #define SEC_LINK_DUPLICATES 0x600000 /* This value for SEC_LINK_DUPLICATES means that duplicate sections with the same name should simply be discarded. */ #define SEC_LINK_DUPLICATES_DISCARD 0x0 /* This value for SEC_LINK_DUPLICATES means that the linker should warn if there are any duplicate sections, although it should still only link one copy. */ #define SEC_LINK_DUPLICATES_ONE_ONLY 0x200000 /* This value for SEC_LINK_DUPLICATES means that the linker should warn if any duplicate sections are a different size. */ #define SEC_LINK_DUPLICATES_SAME_SIZE 0x400000 /* This value for SEC_LINK_DUPLICATES means that the linker should warn if any duplicate sections contain different contents. */ #define SEC_LINK_DUPLICATES_SAME_CONTENTS 0x600000 /* This section was created by the linker as part of dynamic relocation or other arcane processing. It is skipped when going through the first-pass output, trusting that someone else up the line will take care of it later. */ #define SEC_LINKER_CREATED 0x800000 /* This section should not be subject to garbage collection. */ #define SEC_KEEP 0x1000000 /* This section contains "short" data, and should be placed "near" the GP. */ #define SEC_SMALL_DATA 0x2000000 /* This section contains data which may be shared with other executables or shared objects. */ #define SEC_SHARED 0x4000000 /* When a section with this flag is being linked, then if the size of the input section is less than a page, it should not cross a page boundary. If the size of the input section is one page or more, it should be aligned on a page boundary. */ #define SEC_BLOCK 0x8000000 /* Conditionally link this section; do not link if there are no references found to any symbol in the section. */ #define SEC_CLINK 0x10000000 /* End of section flags. */ /* Some internal packed boolean fields. */ /* See the vma field. */ unsigned int user_set_vma : 1; /* Whether relocations have been processed. */ unsigned int reloc_done : 1; /* A mark flag used by some of the linker backends. */ unsigned int linker_mark : 1; /* Another mark flag used by some of the linker backends. Set for output sections that have a input section. */ unsigned int linker_has_input : 1; /* A mark flag used by some linker backends for garbage collection. */ unsigned int gc_mark : 1; /* Used by the ELF code to mark sections which have been allocated to segments. */ unsigned int segment_mark : 1; /* End of internal packed boolean fields. */ /* The virtual memory address of the section - where it will be at run time. The symbols are relocated against this. The user_set_vma flag is maintained by bfd; if it's not set, the backend can assign addresses (for example, in <>, where the default address for <<.data>> is dependent on the specific target and various flags). */ bfd_vma vma; /* The load address of the section - where it would be in a rom image; really only used for writing section header information. */ bfd_vma lma; /* The size of the section in octets, as it will be output. Contains a value even if the section has no contents (e.g., the size of <<.bss>>). This will be filled in after relocation. */ bfd_size_type _cooked_size; /* The original size on disk of the section, in octets. Normally this value is the same as the size, but if some relaxing has been done, then this value will be bigger. */ bfd_size_type _raw_size; /* If this section is going to be output, then this value is the offset in *bytes* into the output section of the first byte in the input section (byte ==> smallest addressable unit on the target). In most cases, if this was going to start at the 100th octet (8-bit quantity) in the output section, this value would be 100. However, if the target byte size is 16 bits (bfd_octets_per_byte is "2"), this value would be 50. */ bfd_vma output_offset; /* The output section through which to map on output. */ struct sec *output_section; /* The alignment requirement of the section, as an exponent of 2 - e.g., 3 aligns to 2^3 (or 8). */ unsigned int alignment_power; /* If an input section, a pointer to a vector of relocation records for the data in this section. */ struct reloc_cache_entry *relocation; /* If an output section, a pointer to a vector of pointers to relocation records for the data in this section. */ struct reloc_cache_entry **orelocation; /* The number of relocation records in one of the above */ unsigned reloc_count; /* Information below is back end specific - and not always used or updated. */ /* File position of section data. */ file_ptr filepos; /* File position of relocation info. */ file_ptr rel_filepos; /* File position of line data. */ file_ptr line_filepos; /* Pointer to data for applications. */ PTR userdata; /* If the SEC_IN_MEMORY flag is set, this points to the actual contents. */ unsigned char *contents; /* Attached line number information. */ alent *lineno; /* Number of line number records. */ unsigned int lineno_count; /* Optional information about a COMDAT entry; NULL if not COMDAT. */ struct bfd_comdat_info *comdat; /* Points to the kept section if this section is a link-once section, and is discarded. */ struct sec *kept_section; /* When a section is being output, this value changes as more linenumbers are written out. */ file_ptr moving_line_filepos; /* What the section number is in the target world. */ int target_index; PTR used_by_bfd; /* If this is a constructor section then here is a list of the relocations created to relocate items within it. */ struct relent_chain *constructor_chain; /* The BFD which owns the section. */ bfd *owner; /* A symbol which points at this section only */ struct symbol_cache_entry *symbol; struct symbol_cache_entry **symbol_ptr_ptr; struct bfd_link_order *link_order_head; struct bfd_link_order *link_order_tail; } asection ; /* These sections are global, and are managed by BFD. The application and target back end are not permitted to change the values in these sections. New code should use the section_ptr macros rather than referring directly to the const sections. The const sections may eventually vanish. */ #define BFD_ABS_SECTION_NAME "*ABS*" #define BFD_UND_SECTION_NAME "*UND*" #define BFD_COM_SECTION_NAME "*COM*" #define BFD_IND_SECTION_NAME "*IND*" /* the absolute section */ extern const asection bfd_abs_section; #define bfd_abs_section_ptr ((asection *) &bfd_abs_section) #define bfd_is_abs_section(sec) ((sec) == bfd_abs_section_ptr) /* Pointer to the undefined section */ extern const asection bfd_und_section; #define bfd_und_section_ptr ((asection *) &bfd_und_section) #define bfd_is_und_section(sec) ((sec) == bfd_und_section_ptr) /* Pointer to the common section */ extern const asection bfd_com_section; #define bfd_com_section_ptr ((asection *) &bfd_com_section) /* Pointer to the indirect section */ extern const asection bfd_ind_section; #define bfd_ind_section_ptr ((asection *) &bfd_ind_section) #define bfd_is_ind_section(sec) ((sec) == bfd_ind_section_ptr) extern const struct symbol_cache_entry * const bfd_abs_symbol; extern const struct symbol_cache_entry * const bfd_com_symbol; extern const struct symbol_cache_entry * const bfd_und_symbol; extern const struct symbol_cache_entry * const bfd_ind_symbol; #define bfd_get_section_size_before_reloc(section) \ ((section)->reloc_done ? (abort (), (bfd_size_type) 1) \ : (section)->_raw_size) #define bfd_get_section_size_after_reloc(section) \ ((section)->reloc_done ? (section)->_cooked_size \ : (abort (), (bfd_size_type) 1)) asection * bfd_get_section_by_name PARAMS ((bfd *abfd, const char *name)); char * bfd_get_unique_section_name PARAMS ((bfd *abfd, const char *templat, int *count)); asection * bfd_make_section_old_way PARAMS ((bfd *abfd, const char *name)); asection * bfd_make_section_anyway PARAMS ((bfd *abfd, const char *name)); asection * bfd_make_section PARAMS ((bfd *, const char *name)); boolean bfd_set_section_flags PARAMS ((bfd *abfd, asection *sec, flagword flags)); void bfd_map_over_sections PARAMS ((bfd *abfd, void (*func) (bfd *abfd, asection *sect, PTR obj), PTR obj)); boolean bfd_set_section_size PARAMS ((bfd *abfd, asection *sec, bfd_size_type val)); boolean bfd_set_section_contents PARAMS ((bfd *abfd, asection *section, PTR data, file_ptr offset, bfd_size_type count)); boolean bfd_get_section_contents PARAMS ((bfd *abfd, asection *section, PTR location, file_ptr offset, bfd_size_type count)); boolean bfd_copy_private_section_data PARAMS ((bfd *ibfd, asection *isec, bfd *obfd, asection *osec)); #define bfd_copy_private_section_data(ibfd, isection, obfd, osection) \ BFD_SEND (obfd, _bfd_copy_private_section_data, \ (ibfd, isection, obfd, osection)) void _bfd_strip_section_from_output PARAMS ((struct bfd_link_info *info, asection *section)); enum bfd_architecture { bfd_arch_unknown, /* File arch not known */ bfd_arch_obscure, /* Arch known, not one of these */ bfd_arch_m68k, /* Motorola 68xxx */ #define bfd_mach_m68000 1 #define bfd_mach_m68008 2 #define bfd_mach_m68010 3 #define bfd_mach_m68020 4 #define bfd_mach_m68030 5 #define bfd_mach_m68040 6 #define bfd_mach_m68060 7 #define bfd_mach_cpu32 8 #define bfd_mach_mcf5200 9 #define bfd_mach_mcf5206e 10 #define bfd_mach_mcf5307 11 #define bfd_mach_mcf5407 12 bfd_arch_vax, /* DEC Vax */ bfd_arch_i960, /* Intel 960 */ /* The order of the following is important. lower number indicates a machine type that only accepts a subset of the instructions available to machines with higher numbers. The exception is the "ca", which is incompatible with all other machines except "core". */ #define bfd_mach_i960_core 1 #define bfd_mach_i960_ka_sa 2 #define bfd_mach_i960_kb_sb 3 #define bfd_mach_i960_mc 4 #define bfd_mach_i960_xa 5 #define bfd_mach_i960_ca 6 #define bfd_mach_i960_jx 7 #define bfd_mach_i960_hx 8 bfd_arch_a29k, /* AMD 29000 */ bfd_arch_sparc, /* SPARC */ #define bfd_mach_sparc 1 /* The difference between v8plus and v9 is that v9 is a true 64 bit env. */ #define bfd_mach_sparc_sparclet 2 #define bfd_mach_sparc_sparclite 3 #define bfd_mach_sparc_v8plus 4 #define bfd_mach_sparc_v8plusa 5 /* with ultrasparc add'ns */ #define bfd_mach_sparc_sparclite_le 6 #define bfd_mach_sparc_v9 7 #define bfd_mach_sparc_v9a 8 /* with ultrasparc add'ns */ #define bfd_mach_sparc_v8plusb 9 /* with cheetah add'ns */ #define bfd_mach_sparc_v9b 10 /* with cheetah add'ns */ /* Nonzero if MACH has the v9 instruction set. */ #define bfd_mach_sparc_v9_p(mach) \ ((mach) >= bfd_mach_sparc_v8plus && (mach) <= bfd_mach_sparc_v9b \ && (mach) != bfd_mach_sparc_sparclite_le) bfd_arch_mips, /* MIPS Rxxxx */ #define bfd_mach_mips3000 3000 #define bfd_mach_mips3900 3900 #define bfd_mach_mips4000 4000 #define bfd_mach_mips4010 4010 #define bfd_mach_mips4100 4100 #define bfd_mach_mips4111 4111 #define bfd_mach_mips4300 4300 #define bfd_mach_mips4400 4400 #define bfd_mach_mips4600 4600 #define bfd_mach_mips4650 4650 #define bfd_mach_mips5000 5000 #define bfd_mach_mips6000 6000 #define bfd_mach_mips8000 8000 #define bfd_mach_mips10000 10000 #define bfd_mach_mips12000 12000 #define bfd_mach_mips16 16 #define bfd_mach_mips32 32 #define bfd_mach_mips32_4k 3204113 /* 32, 04, octal 'K' */ #define bfd_mach_mips5 5 #define bfd_mach_mips64 64 #define bfd_mach_mips_sb1 12310201 /* octal 'SB', 01 */ bfd_arch_i386, /* Intel 386 */ #define bfd_mach_i386_i386 0 #define bfd_mach_i386_i8086 1 #define bfd_mach_i386_i386_intel_syntax 2 #define bfd_mach_x86_64 3 #define bfd_mach_x86_64_intel_syntax 4 bfd_arch_we32k, /* AT&T WE32xxx */ bfd_arch_tahoe, /* CCI/Harris Tahoe */ bfd_arch_i860, /* Intel 860 */ bfd_arch_i370, /* IBM 360/370 Mainframes */ bfd_arch_romp, /* IBM ROMP PC/RT */ bfd_arch_alliant, /* Alliant */ bfd_arch_convex, /* Convex */ bfd_arch_m88k, /* Motorola 88xxx */ bfd_arch_pyramid, /* Pyramid Technology */ bfd_arch_h8300, /* Hitachi H8/300 */ #define bfd_mach_h8300 1 #define bfd_mach_h8300h 2 #define bfd_mach_h8300s 3 bfd_arch_powerpc, /* PowerPC */ #define bfd_mach_ppc 0 #define bfd_mach_ppc_403 403 #define bfd_mach_ppc_403gc 4030 #define bfd_mach_ppc_505 505 #define bfd_mach_ppc_601 601 #define bfd_mach_ppc_602 602 #define bfd_mach_ppc_603 603 #define bfd_mach_ppc_ec603e 6031 #define bfd_mach_ppc_604 604 #define bfd_mach_ppc_620 620 #define bfd_mach_ppc_630 630 #define bfd_mach_ppc_750 750 #define bfd_mach_ppc_860 860 #define bfd_mach_ppc_a35 35 #define bfd_mach_ppc_rs64ii 642 #define bfd_mach_ppc_rs64iii 643 #define bfd_mach_ppc_7400 7400 bfd_arch_rs6000, /* IBM RS/6000 */ #define bfd_mach_rs6k 0 #define bfd_mach_rs6k_rs1 6001 #define bfd_mach_rs6k_rsc 6003 #define bfd_mach_rs6k_rs2 6002 bfd_arch_hppa, /* HP PA RISC */ bfd_arch_d10v, /* Mitsubishi D10V */ #define bfd_mach_d10v 0 #define bfd_mach_d10v_ts2 2 #define bfd_mach_d10v_ts3 3 bfd_arch_d30v, /* Mitsubishi D30V */ bfd_arch_m68hc11, /* Motorola 68HC11 */ bfd_arch_m68hc12, /* Motorola 68HC12 */ bfd_arch_z8k, /* Zilog Z8000 */ #define bfd_mach_z8001 1 #define bfd_mach_z8002 2 bfd_arch_h8500, /* Hitachi H8/500 */ bfd_arch_sh, /* Hitachi SH */ #define bfd_mach_sh 0 #define bfd_mach_sh2 0x20 #define bfd_mach_sh_dsp 0x2d #define bfd_mach_sh3 0x30 #define bfd_mach_sh3_dsp 0x3d #define bfd_mach_sh3e 0x3e #define bfd_mach_sh4 0x40 bfd_arch_alpha, /* Dec Alpha */ #define bfd_mach_alpha_ev4 0x10 #define bfd_mach_alpha_ev5 0x20 #define bfd_mach_alpha_ev6 0x30 bfd_arch_arm, /* Advanced Risc Machines ARM */ #define bfd_mach_arm_2 1 #define bfd_mach_arm_2a 2 #define bfd_mach_arm_3 3 #define bfd_mach_arm_3M 4 #define bfd_mach_arm_4 5 #define bfd_mach_arm_4T 6 #define bfd_mach_arm_5 7 #define bfd_mach_arm_5T 8 #define bfd_mach_arm_5TE 9 #define bfd_mach_arm_XScale 10 bfd_arch_ns32k, /* National Semiconductors ns32000 */ bfd_arch_w65, /* WDC 65816 */ bfd_arch_tic30, /* Texas Instruments TMS320C30 */ bfd_arch_tic54x, /* Texas Instruments TMS320C54X */ bfd_arch_tic80, /* TI TMS320c80 (MVP) */ bfd_arch_v850, /* NEC V850 */ #define bfd_mach_v850 0 #define bfd_mach_v850e 'E' #define bfd_mach_v850ea 'A' bfd_arch_arc, /* ARC Cores */ #define bfd_mach_arc_5 0 #define bfd_mach_arc_6 1 #define bfd_mach_arc_7 2 #define bfd_mach_arc_8 3 bfd_arch_m32r, /* Mitsubishi M32R/D */ #define bfd_mach_m32r 0 /* backwards compatibility */ #define bfd_mach_m32rx 'x' bfd_arch_mn10200, /* Matsushita MN10200 */ bfd_arch_mn10300, /* Matsushita MN10300 */ #define bfd_mach_mn10300 300 #define bfd_mach_am33 330 bfd_arch_fr30, #define bfd_mach_fr30 0x46523330 bfd_arch_mcore, bfd_arch_ia64, /* HP/Intel ia64 */ #define bfd_mach_ia64_elf64 0 #define bfd_mach_ia64_elf32 1 bfd_arch_pj, bfd_arch_avr, /* Atmel AVR microcontrollers */ #define bfd_mach_avr1 1 #define bfd_mach_avr2 2 #define bfd_mach_avr3 3 #define bfd_mach_avr4 4 #define bfd_mach_avr5 5 bfd_arch_cris, /* Axis CRIS */ bfd_arch_last }; typedef struct bfd_arch_info { int bits_per_word; int bits_per_address; int bits_per_byte; enum bfd_architecture arch; unsigned long mach; const char *arch_name; const char *printable_name; unsigned int section_align_power; /* True if this is the default machine for the architecture. */ boolean the_default; const struct bfd_arch_info * (*compatible) PARAMS ((const struct bfd_arch_info *a, const struct bfd_arch_info *b)); boolean (*scan) PARAMS ((const struct bfd_arch_info *, const char *)); const struct bfd_arch_info *next; } bfd_arch_info_type; const char * bfd_printable_name PARAMS ((bfd *abfd)); const bfd_arch_info_type * bfd_scan_arch PARAMS ((const char *string)); const char ** bfd_arch_list PARAMS ((void)); const bfd_arch_info_type * bfd_arch_get_compatible PARAMS (( const bfd *abfd, const bfd *bbfd)); void bfd_set_arch_info PARAMS ((bfd *abfd, const bfd_arch_info_type *arg)); enum bfd_architecture bfd_get_arch PARAMS ((bfd *abfd)); unsigned long bfd_get_mach PARAMS ((bfd *abfd)); unsigned int bfd_arch_bits_per_byte PARAMS ((bfd *abfd)); unsigned int bfd_arch_bits_per_address PARAMS ((bfd *abfd)); const bfd_arch_info_type * bfd_get_arch_info PARAMS ((bfd *abfd)); const bfd_arch_info_type * bfd_lookup_arch PARAMS ((enum bfd_architecture arch, unsigned long machine)); const char * bfd_printable_arch_mach PARAMS ((enum bfd_architecture arch, unsigned long machine)); unsigned int bfd_octets_per_byte PARAMS ((bfd *abfd)); unsigned int bfd_arch_mach_octets_per_byte PARAMS ((enum bfd_architecture arch, unsigned long machine)); typedef enum bfd_reloc_status { /* No errors detected */ bfd_reloc_ok, /* The relocation was performed, but there was an overflow. */ bfd_reloc_overflow, /* The address to relocate was not within the section supplied. */ bfd_reloc_outofrange, /* Used by special functions */ bfd_reloc_continue, /* Unsupported relocation size requested. */ bfd_reloc_notsupported, /* Unused */ bfd_reloc_other, /* The symbol to relocate against was undefined. */ bfd_reloc_undefined, /* The relocation was performed, but may not be ok - presently generated only when linking i960 coff files with i960 b.out symbols. If this type is returned, the error_message argument to bfd_perform_relocation will be set. */ bfd_reloc_dangerous } bfd_reloc_status_type; typedef struct reloc_cache_entry { /* A pointer into the canonical table of pointers */ struct symbol_cache_entry **sym_ptr_ptr; /* offset in section */ bfd_size_type address; /* addend for relocation value */ bfd_vma addend; /* Pointer to how to perform the required relocation */ reloc_howto_type *howto; } arelent; enum complain_overflow { /* Do not complain on overflow. */ complain_overflow_dont, /* Complain if the bitfield overflows, whether it is considered as signed or unsigned. */ complain_overflow_bitfield, /* Complain if the value overflows when considered as signed number. */ complain_overflow_signed, /* Complain if the value overflows when considered as an unsigned number. */ complain_overflow_unsigned }; struct reloc_howto_struct { /* The type field has mainly a documentary use - the back end can do what it wants with it, though normally the back end's external idea of what a reloc number is stored in this field. For example, a PC relative word relocation in a coff environment has the type 023 - because that's what the outside world calls a R_PCRWORD reloc. */ unsigned int type; /* The value the final relocation is shifted right by. This drops unwanted data from the relocation. */ unsigned int rightshift; /* The size of the item to be relocated. This is *not* a power-of-two measure. To get the number of bytes operated on by a type of relocation, use bfd_get_reloc_size. */ int size; /* The number of bits in the item to be relocated. This is used when doing overflow checking. */ unsigned int bitsize; /* Notes that the relocation is relative to the location in the data section of the addend. The relocation function will subtract from the relocation value the address of the location being relocated. */ boolean pc_relative; /* The bit position of the reloc value in the destination. The relocated value is left shifted by this amount. */ unsigned int bitpos; /* What type of overflow error should be checked for when relocating. */ enum complain_overflow complain_on_overflow; /* If this field is non null, then the supplied function is called rather than the normal function. This allows really strange relocation methods to be accomodated (e.g., i960 callj instructions). */ bfd_reloc_status_type (*special_function) PARAMS ((bfd *abfd, arelent *reloc_entry, struct symbol_cache_entry *symbol, PTR data, asection *input_section, bfd *output_bfd, char **error_message)); /* The textual name of the relocation type. */ char *name; /* Some formats record a relocation addend in the section contents rather than with the relocation. For ELF formats this is the distinction between USE_REL and USE_RELA (though the code checks for USE_REL == 1/0). The value of this field is TRUE if the addend is recorded with the section contents; when performing a partial link (ld -r) the section contents (the data) will be modified. The value of this field is FALSE if addends are recorded with the relocation (in arelent.addend); when performing a partial link the relocation will be modified. All relocations for all ELF USE_RELA targets should set this field to FALSE (values of TRUE should be looked on with suspicion). However, the converse is not true: not all relocations of all ELF USE_REL targets set this field to TRUE. Why this is so is peculiar to each particular target. For relocs that aren't used in partial links (e.g. GOT stuff) it doesn't matter what this is set to. */ boolean partial_inplace; /* The src_mask selects which parts of the read in data are to be used in the relocation sum. E.g., if this was an 8 bit byte of data which we read and relocated, this would be 0x000000ff. When we have relocs which have an addend, such as sun4 extended relocs, the value in the offset part of a relocating field is garbage so we never use it. In this case the mask would be 0x00000000. */ bfd_vma src_mask; /* The dst_mask selects which parts of the instruction are replaced into the instruction. In most cases src_mask == dst_mask, except in the above special case, where dst_mask would be 0x000000ff, and src_mask would be 0x00000000. */ bfd_vma dst_mask; /* When some formats create PC relative instructions, they leave the value of the pc of the place being relocated in the offset slot of the instruction, so that a PC relative relocation can be made just by adding in an ordinary offset (e.g., sun3 a.out). Some formats leave the displacement part of an instruction empty (e.g., m88k bcs); this flag signals the fact.*/ boolean pcrel_offset; }; #define HOWTO(C, R,S,B, P, BI, O, SF, NAME, INPLACE, MASKSRC, MASKDST, PC) \ {(unsigned)C,R,S,B, P, BI, O,SF,NAME,INPLACE,MASKSRC,MASKDST,PC} #define NEWHOWTO( FUNCTION, NAME,SIZE,REL,IN) HOWTO(0,0,SIZE,0,REL,0,complain_overflow_dont,FUNCTION, NAME,false,0,0,IN) #define EMPTY_HOWTO(C) \ HOWTO((C),0,0,0,false,0,complain_overflow_dont,NULL,NULL,false,0,0,false) #define HOWTO_PREPARE(relocation, symbol) \ { \ if (symbol != (asymbol *)NULL) { \ if (bfd_is_com_section (symbol->section)) { \ relocation = 0; \ } \ else { \ relocation = symbol->value; \ } \ } \ } unsigned int bfd_get_reloc_size PARAMS ((reloc_howto_type *)); typedef struct relent_chain { arelent relent; struct relent_chain *next; } arelent_chain; bfd_reloc_status_type bfd_check_overflow PARAMS ((enum complain_overflow how, unsigned int bitsize, unsigned int rightshift, unsigned int addrsize, bfd_vma relocation)); bfd_reloc_status_type bfd_perform_relocation PARAMS ((bfd *abfd, arelent *reloc_entry, PTR data, asection *input_section, bfd *output_bfd, char **error_message)); bfd_reloc_status_type bfd_install_relocation PARAMS ((bfd *abfd, arelent *reloc_entry, PTR data, bfd_vma data_start, asection *input_section, char **error_message)); enum bfd_reloc_code_real { _dummy_first_bfd_reloc_code_real, /* Basic absolute relocations of N bits. */ BFD_RELOC_64, BFD_RELOC_32, BFD_RELOC_26, BFD_RELOC_24, BFD_RELOC_16, BFD_RELOC_14, BFD_RELOC_8, /* PC-relative relocations. Sometimes these are relative to the address of the relocation itself; sometimes they are relative to the start of the section containing the relocation. It depends on the specific target. The 24-bit relocation is used in some Intel 960 configurations. */ BFD_RELOC_64_PCREL, BFD_RELOC_32_PCREL, BFD_RELOC_24_PCREL, BFD_RELOC_16_PCREL, BFD_RELOC_12_PCREL, BFD_RELOC_8_PCREL, /* For ELF. */ BFD_RELOC_32_GOT_PCREL, BFD_RELOC_16_GOT_PCREL, BFD_RELOC_8_GOT_PCREL, BFD_RELOC_32_GOTOFF, BFD_RELOC_16_GOTOFF, BFD_RELOC_LO16_GOTOFF, BFD_RELOC_HI16_GOTOFF, BFD_RELOC_HI16_S_GOTOFF, BFD_RELOC_8_GOTOFF, BFD_RELOC_32_PLT_PCREL, BFD_RELOC_24_PLT_PCREL, BFD_RELOC_16_PLT_PCREL, BFD_RELOC_8_PLT_PCREL, BFD_RELOC_32_PLTOFF, BFD_RELOC_16_PLTOFF, BFD_RELOC_LO16_PLTOFF, BFD_RELOC_HI16_PLTOFF, BFD_RELOC_HI16_S_PLTOFF, BFD_RELOC_8_PLTOFF, /* Relocations used by 68K ELF. */ BFD_RELOC_68K_GLOB_DAT, BFD_RELOC_68K_JMP_SLOT, BFD_RELOC_68K_RELATIVE, /* Linkage-table relative. */ BFD_RELOC_32_BASEREL, BFD_RELOC_16_BASEREL, BFD_RELOC_LO16_BASEREL, BFD_RELOC_HI16_BASEREL, BFD_RELOC_HI16_S_BASEREL, BFD_RELOC_8_BASEREL, BFD_RELOC_RVA, /* Absolute 8-bit relocation, but used to form an address like 0xFFnn. */ BFD_RELOC_8_FFnn, /* These PC-relative relocations are stored as word displacements -- i.e., byte displacements shifted right two bits. The 30-bit word displacement (<<32_PCREL_S2>> -- 32 bits, shifted 2) is used on the SPARC. (SPARC tools generally refer to this as <>.) The signed 16-bit displacement is used on the MIPS, and the 23-bit displacement is used on the Alpha. */ BFD_RELOC_32_PCREL_S2, BFD_RELOC_16_PCREL_S2, BFD_RELOC_23_PCREL_S2, /* High 22 bits and low 10 bits of 32-bit value, placed into lower bits of the target word. These are used on the SPARC. */ BFD_RELOC_HI22, BFD_RELOC_LO10, /* For systems that allocate a Global Pointer register, these are displacements off that register. These relocation types are handled specially, because the value the register will have is decided relatively late. */ BFD_RELOC_GPREL16, BFD_RELOC_GPREL32, /* Reloc types used for i960/b.out. */ BFD_RELOC_I960_CALLJ, /* SPARC ELF relocations. There is probably some overlap with other relocation types already defined. */ BFD_RELOC_NONE, BFD_RELOC_SPARC_WDISP22, BFD_RELOC_SPARC22, BFD_RELOC_SPARC13, BFD_RELOC_SPARC_GOT10, BFD_RELOC_SPARC_GOT13, BFD_RELOC_SPARC_GOT22, BFD_RELOC_SPARC_PC10, BFD_RELOC_SPARC_PC22, BFD_RELOC_SPARC_WPLT30, BFD_RELOC_SPARC_COPY, BFD_RELOC_SPARC_GLOB_DAT, BFD_RELOC_SPARC_JMP_SLOT, BFD_RELOC_SPARC_RELATIVE, BFD_RELOC_SPARC_UA16, BFD_RELOC_SPARC_UA32, BFD_RELOC_SPARC_UA64, /* I think these are specific to SPARC a.out (e.g., Sun 4). */ BFD_RELOC_SPARC_BASE13, BFD_RELOC_SPARC_BASE22, /* SPARC64 relocations */ #define BFD_RELOC_SPARC_64 BFD_RELOC_64 BFD_RELOC_SPARC_10, BFD_RELOC_SPARC_11, BFD_RELOC_SPARC_OLO10, BFD_RELOC_SPARC_HH22, BFD_RELOC_SPARC_HM10, BFD_RELOC_SPARC_LM22, BFD_RELOC_SPARC_PC_HH22, BFD_RELOC_SPARC_PC_HM10, BFD_RELOC_SPARC_PC_LM22, BFD_RELOC_SPARC_WDISP16, BFD_RELOC_SPARC_WDISP19, BFD_RELOC_SPARC_7, BFD_RELOC_SPARC_6, BFD_RELOC_SPARC_5, #define BFD_RELOC_SPARC_DISP64 BFD_RELOC_64_PCREL BFD_RELOC_SPARC_PLT64, BFD_RELOC_SPARC_HIX22, BFD_RELOC_SPARC_LOX10, BFD_RELOC_SPARC_H44, BFD_RELOC_SPARC_M44, BFD_RELOC_SPARC_L44, BFD_RELOC_SPARC_REGISTER, /* SPARC little endian relocation */ BFD_RELOC_SPARC_REV32, /* Alpha ECOFF and ELF relocations. Some of these treat the symbol or "addend" in some special way. For GPDISP_HI16 ("gpdisp") relocations, the symbol is ignored when writing; when reading, it will be the absolute section symbol. The addend is the displacement in bytes of the "lda" instruction from the "ldah" instruction (which is at the address of this reloc). */ BFD_RELOC_ALPHA_GPDISP_HI16, /* For GPDISP_LO16 ("ignore") relocations, the symbol is handled as with GPDISP_HI16 relocs. The addend is ignored when writing the relocations out, and is filled in with the file's GP value on reading, for convenience. */ BFD_RELOC_ALPHA_GPDISP_LO16, /* The ELF GPDISP relocation is exactly the same as the GPDISP_HI16 relocation except that there is no accompanying GPDISP_LO16 relocation. */ BFD_RELOC_ALPHA_GPDISP, /* The Alpha LITERAL/LITUSE relocs are produced by a symbol reference; the assembler turns it into a LDQ instruction to load the address of the symbol, and then fills in a register in the real instruction. The LITERAL reloc, at the LDQ instruction, refers to the .lita section symbol. The addend is ignored when writing, but is filled in with the file's GP value on reading, for convenience, as with the GPDISP_LO16 reloc. The ELF_LITERAL reloc is somewhere between 16_GOTOFF and GPDISP_LO16. It should refer to the symbol to be referenced, as with 16_GOTOFF, but it generates output not based on the position within the .got section, but relative to the GP value chosen for the file during the final link stage. The LITUSE reloc, on the instruction using the loaded address, gives information to the linker that it might be able to use to optimize away some literal section references. The symbol is ignored (read as the absolute section symbol), and the "addend" indicates the type of instruction using the register: 1 - "memory" fmt insn 2 - byte-manipulation (byte offset reg) 3 - jsr (target of branch) The GNU linker currently doesn't do any of this optimizing. */ BFD_RELOC_ALPHA_LITERAL, BFD_RELOC_ALPHA_ELF_LITERAL, BFD_RELOC_ALPHA_LITUSE, /* The BFD_RELOC_ALPHA_USER_* relocations are used by the assembler to process the explicit !!sequence relocations, and are mapped into the normal relocations at the end of processing. */ BFD_RELOC_ALPHA_USER_LITERAL, BFD_RELOC_ALPHA_USER_LITUSE_BASE, BFD_RELOC_ALPHA_USER_LITUSE_BYTOFF, BFD_RELOC_ALPHA_USER_LITUSE_JSR, BFD_RELOC_ALPHA_USER_GPDISP, BFD_RELOC_ALPHA_USER_GPRELHIGH, BFD_RELOC_ALPHA_USER_GPRELLOW, /* The HINT relocation indicates a value that should be filled into the "hint" field of a jmp/jsr/ret instruction, for possible branch- prediction logic which may be provided on some processors. */ BFD_RELOC_ALPHA_HINT, /* The LINKAGE relocation outputs a linkage pair in the object file, which is filled by the linker. */ BFD_RELOC_ALPHA_LINKAGE, /* The CODEADDR relocation outputs a STO_CA in the object file, which is filled by the linker. */ BFD_RELOC_ALPHA_CODEADDR, /* Bits 27..2 of the relocation address shifted right 2 bits; simple reloc otherwise. */ BFD_RELOC_MIPS_JMP, /* The MIPS16 jump instruction. */ BFD_RELOC_MIPS16_JMP, /* MIPS16 GP relative reloc. */ BFD_RELOC_MIPS16_GPREL, /* High 16 bits of 32-bit value; simple reloc. */ BFD_RELOC_HI16, /* High 16 bits of 32-bit value but the low 16 bits will be sign extended and added to form the final result. If the low 16 bits form a negative number, we need to add one to the high value to compensate for the borrow when the low bits are added. */ BFD_RELOC_HI16_S, /* Low 16 bits. */ BFD_RELOC_LO16, /* Like BFD_RELOC_HI16_S, but PC relative. */ BFD_RELOC_PCREL_HI16_S, /* Like BFD_RELOC_LO16, but PC relative. */ BFD_RELOC_PCREL_LO16, /* Relocation relative to the global pointer. */ #define BFD_RELOC_MIPS_GPREL BFD_RELOC_GPREL16 /* Relocation against a MIPS literal section. */ BFD_RELOC_MIPS_LITERAL, /* MIPS ELF relocations. */ BFD_RELOC_MIPS_GOT16, BFD_RELOC_MIPS_CALL16, #define BFD_RELOC_MIPS_GPREL32 BFD_RELOC_GPREL32 BFD_RELOC_MIPS_GOT_HI16, BFD_RELOC_MIPS_GOT_LO16, BFD_RELOC_MIPS_CALL_HI16, BFD_RELOC_MIPS_CALL_LO16, BFD_RELOC_MIPS_SUB, BFD_RELOC_MIPS_GOT_PAGE, BFD_RELOC_MIPS_GOT_OFST, BFD_RELOC_MIPS_GOT_DISP, BFD_RELOC_MIPS_SHIFT5, BFD_RELOC_MIPS_SHIFT6, BFD_RELOC_MIPS_INSERT_A, BFD_RELOC_MIPS_INSERT_B, BFD_RELOC_MIPS_DELETE, BFD_RELOC_MIPS_HIGHEST, BFD_RELOC_MIPS_HIGHER, BFD_RELOC_MIPS_SCN_DISP, BFD_RELOC_MIPS_REL16, BFD_RELOC_MIPS_RELGOT, BFD_RELOC_MIPS_JALR, /* i386/elf relocations */ BFD_RELOC_386_GOT32, BFD_RELOC_386_PLT32, BFD_RELOC_386_COPY, BFD_RELOC_386_GLOB_DAT, BFD_RELOC_386_JUMP_SLOT, BFD_RELOC_386_RELATIVE, BFD_RELOC_386_GOTOFF, BFD_RELOC_386_GOTPC, /* x86-64/elf relocations */ BFD_RELOC_X86_64_GOT32, BFD_RELOC_X86_64_PLT32, BFD_RELOC_X86_64_COPY, BFD_RELOC_X86_64_GLOB_DAT, BFD_RELOC_X86_64_JUMP_SLOT, BFD_RELOC_X86_64_RELATIVE, BFD_RELOC_X86_64_GOTPCREL, BFD_RELOC_X86_64_32S, /* ns32k relocations */ BFD_RELOC_NS32K_IMM_8, BFD_RELOC_NS32K_IMM_16, BFD_RELOC_NS32K_IMM_32, BFD_RELOC_NS32K_IMM_8_PCREL, BFD_RELOC_NS32K_IMM_16_PCREL, BFD_RELOC_NS32K_IMM_32_PCREL, BFD_RELOC_NS32K_DISP_8, BFD_RELOC_NS32K_DISP_16, BFD_RELOC_NS32K_DISP_32, BFD_RELOC_NS32K_DISP_8_PCREL, BFD_RELOC_NS32K_DISP_16_PCREL, BFD_RELOC_NS32K_DISP_32_PCREL, /* Picojava relocs. Not all of these appear in object files. */ BFD_RELOC_PJ_CODE_HI16, BFD_RELOC_PJ_CODE_LO16, BFD_RELOC_PJ_CODE_DIR16, BFD_RELOC_PJ_CODE_DIR32, BFD_RELOC_PJ_CODE_REL16, BFD_RELOC_PJ_CODE_REL32, /* Power(rs6000) and PowerPC relocations. */ BFD_RELOC_PPC_B26, BFD_RELOC_PPC_BA26, BFD_RELOC_PPC_TOC16, BFD_RELOC_PPC_B16, BFD_RELOC_PPC_B16_BRTAKEN, BFD_RELOC_PPC_B16_BRNTAKEN, BFD_RELOC_PPC_BA16, BFD_RELOC_PPC_BA16_BRTAKEN, BFD_RELOC_PPC_BA16_BRNTAKEN, BFD_RELOC_PPC_COPY, BFD_RELOC_PPC_GLOB_DAT, BFD_RELOC_PPC_JMP_SLOT, BFD_RELOC_PPC_RELATIVE, BFD_RELOC_PPC_LOCAL24PC, BFD_RELOC_PPC_EMB_NADDR32, BFD_RELOC_PPC_EMB_NADDR16, BFD_RELOC_PPC_EMB_NADDR16_LO, BFD_RELOC_PPC_EMB_NADDR16_HI, BFD_RELOC_PPC_EMB_NADDR16_HA, BFD_RELOC_PPC_EMB_SDAI16, BFD_RELOC_PPC_EMB_SDA2I16, BFD_RELOC_PPC_EMB_SDA2REL, BFD_RELOC_PPC_EMB_SDA21, BFD_RELOC_PPC_EMB_MRKREF, BFD_RELOC_PPC_EMB_RELSEC16, BFD_RELOC_PPC_EMB_RELST_LO, BFD_RELOC_PPC_EMB_RELST_HI, BFD_RELOC_PPC_EMB_RELST_HA, BFD_RELOC_PPC_EMB_BIT_FLD, BFD_RELOC_PPC_EMB_RELSDA, /* IBM 370/390 relocations */ BFD_RELOC_I370_D12, /* The type of reloc used to build a contructor table - at the moment probably a 32 bit wide absolute relocation, but the target can choose. It generally does map to one of the other relocation types. */ BFD_RELOC_CTOR, /* ARM 26 bit pc-relative branch. The lowest two bits must be zero and are not stored in the instruction. */ BFD_RELOC_ARM_PCREL_BRANCH, /* ARM 26 bit pc-relative branch. The lowest bit must be zero and is not stored in the instruction. The 2nd lowest bit comes from a 1 bit field in the instruction. */ BFD_RELOC_ARM_PCREL_BLX, /* Thumb 22 bit pc-relative branch. The lowest bit must be zero and is not stored in the instruction. The 2nd lowest bit comes from a 1 bit field in the instruction. */ BFD_RELOC_THUMB_PCREL_BLX, /* These relocs are only used within the ARM assembler. They are not (at present) written to any object files. */ BFD_RELOC_ARM_IMMEDIATE, BFD_RELOC_ARM_ADRL_IMMEDIATE, BFD_RELOC_ARM_OFFSET_IMM, BFD_RELOC_ARM_SHIFT_IMM, BFD_RELOC_ARM_SWI, BFD_RELOC_ARM_MULTI, BFD_RELOC_ARM_CP_OFF_IMM, BFD_RELOC_ARM_ADR_IMM, BFD_RELOC_ARM_LDR_IMM, BFD_RELOC_ARM_LITERAL, BFD_RELOC_ARM_IN_POOL, BFD_RELOC_ARM_OFFSET_IMM8, BFD_RELOC_ARM_HWLITERAL, BFD_RELOC_ARM_THUMB_ADD, BFD_RELOC_ARM_THUMB_IMM, BFD_RELOC_ARM_THUMB_SHIFT, BFD_RELOC_ARM_THUMB_OFFSET, BFD_RELOC_ARM_GOT12, BFD_RELOC_ARM_GOT32, BFD_RELOC_ARM_JUMP_SLOT, BFD_RELOC_ARM_COPY, BFD_RELOC_ARM_GLOB_DAT, BFD_RELOC_ARM_PLT32, BFD_RELOC_ARM_RELATIVE, BFD_RELOC_ARM_GOTOFF, BFD_RELOC_ARM_GOTPC, /* Hitachi SH relocs. Not all of these appear in object files. */ BFD_RELOC_SH_PCDISP8BY2, BFD_RELOC_SH_PCDISP12BY2, BFD_RELOC_SH_IMM4, BFD_RELOC_SH_IMM4BY2, BFD_RELOC_SH_IMM4BY4, BFD_RELOC_SH_IMM8, BFD_RELOC_SH_IMM8BY2, BFD_RELOC_SH_IMM8BY4, BFD_RELOC_SH_PCRELIMM8BY2, BFD_RELOC_SH_PCRELIMM8BY4, BFD_RELOC_SH_SWITCH16, BFD_RELOC_SH_SWITCH32, BFD_RELOC_SH_USES, BFD_RELOC_SH_COUNT, BFD_RELOC_SH_ALIGN, BFD_RELOC_SH_CODE, BFD_RELOC_SH_DATA, BFD_RELOC_SH_LABEL, BFD_RELOC_SH_LOOP_START, BFD_RELOC_SH_LOOP_END, BFD_RELOC_SH_COPY, BFD_RELOC_SH_GLOB_DAT, BFD_RELOC_SH_JMP_SLOT, BFD_RELOC_SH_RELATIVE, BFD_RELOC_SH_GOTPC, /* Thumb 23-, 12- and 9-bit pc-relative branches. The lowest bit must be zero and is not stored in the instruction. */ BFD_RELOC_THUMB_PCREL_BRANCH9, BFD_RELOC_THUMB_PCREL_BRANCH12, BFD_RELOC_THUMB_PCREL_BRANCH23, /* ARC Cores relocs. ARC 22 bit pc-relative branch. The lowest two bits must be zero and are not stored in the instruction. The high 20 bits are installed in bits 26 through 7 of the instruction. */ BFD_RELOC_ARC_B22_PCREL, /* ARC 26 bit absolute branch. The lowest two bits must be zero and are not stored in the instruction. The high 24 bits are installed in bits 23 through 0. */ BFD_RELOC_ARC_B26, /* Mitsubishi D10V relocs. This is a 10-bit reloc with the right 2 bits assumed to be 0. */ BFD_RELOC_D10V_10_PCREL_R, /* Mitsubishi D10V relocs. This is a 10-bit reloc with the right 2 bits assumed to be 0. This is the same as the previous reloc except it is in the left container, i.e., shifted left 15 bits. */ BFD_RELOC_D10V_10_PCREL_L, /* This is an 18-bit reloc with the right 2 bits assumed to be 0. */ BFD_RELOC_D10V_18, /* This is an 18-bit reloc with the right 2 bits assumed to be 0. */ BFD_RELOC_D10V_18_PCREL, /* Mitsubishi D30V relocs. This is a 6-bit absolute reloc. */ BFD_RELOC_D30V_6, /* This is a 6-bit pc-relative reloc with the right 3 bits assumed to be 0. */ BFD_RELOC_D30V_9_PCREL, /* This is a 6-bit pc-relative reloc with the right 3 bits assumed to be 0. Same as the previous reloc but on the right side of the container. */ BFD_RELOC_D30V_9_PCREL_R, /* This is a 12-bit absolute reloc with the right 3 bitsassumed to be 0. */ BFD_RELOC_D30V_15, /* This is a 12-bit pc-relative reloc with the right 3 bits assumed to be 0. */ BFD_RELOC_D30V_15_PCREL, /* This is a 12-bit pc-relative reloc with the right 3 bits assumed to be 0. Same as the previous reloc but on the right side of the container. */ BFD_RELOC_D30V_15_PCREL_R, /* This is an 18-bit absolute reloc with the right 3 bits assumed to be 0. */ BFD_RELOC_D30V_21, /* This is an 18-bit pc-relative reloc with the right 3 bits assumed to be 0. */ BFD_RELOC_D30V_21_PCREL, /* This is an 18-bit pc-relative reloc with the right 3 bits assumed to be 0. Same as the previous reloc but on the right side of the container. */ BFD_RELOC_D30V_21_PCREL_R, /* This is a 32-bit absolute reloc. */ BFD_RELOC_D30V_32, /* This is a 32-bit pc-relative reloc. */ BFD_RELOC_D30V_32_PCREL, /* Mitsubishi M32R relocs. This is a 24 bit absolute address. */ BFD_RELOC_M32R_24, /* This is a 10-bit pc-relative reloc with the right 2 bits assumed to be 0. */ BFD_RELOC_M32R_10_PCREL, /* This is an 18-bit reloc with the right 2 bits assumed to be 0. */ BFD_RELOC_M32R_18_PCREL, /* This is a 26-bit reloc with the right 2 bits assumed to be 0. */ BFD_RELOC_M32R_26_PCREL, /* This is a 16-bit reloc containing the high 16 bits of an address used when the lower 16 bits are treated as unsigned. */ BFD_RELOC_M32R_HI16_ULO, /* This is a 16-bit reloc containing the high 16 bits of an address used when the lower 16 bits are treated as signed. */ BFD_RELOC_M32R_HI16_SLO, /* This is a 16-bit reloc containing the lower 16 bits of an address. */ BFD_RELOC_M32R_LO16, /* This is a 16-bit reloc containing the small data area offset for use in add3, load, and store instructions. */ BFD_RELOC_M32R_SDA16, /* This is a 9-bit reloc */ BFD_RELOC_V850_9_PCREL, /* This is a 22-bit reloc */ BFD_RELOC_V850_22_PCREL, /* This is a 16 bit offset from the short data area pointer. */ BFD_RELOC_V850_SDA_16_16_OFFSET, /* This is a 16 bit offset (of which only 15 bits are used) from the short data area pointer. */ BFD_RELOC_V850_SDA_15_16_OFFSET, /* This is a 16 bit offset from the zero data area pointer. */ BFD_RELOC_V850_ZDA_16_16_OFFSET, /* This is a 16 bit offset (of which only 15 bits are used) from the zero data area pointer. */ BFD_RELOC_V850_ZDA_15_16_OFFSET, /* This is an 8 bit offset (of which only 6 bits are used) from the tiny data area pointer. */ BFD_RELOC_V850_TDA_6_8_OFFSET, /* This is an 8bit offset (of which only 7 bits are used) from the tiny data area pointer. */ BFD_RELOC_V850_TDA_7_8_OFFSET, /* This is a 7 bit offset from the tiny data area pointer. */ BFD_RELOC_V850_TDA_7_7_OFFSET, /* This is a 16 bit offset from the tiny data area pointer. */ BFD_RELOC_V850_TDA_16_16_OFFSET, /* This is a 5 bit offset (of which only 4 bits are used) from the tiny data area pointer. */ BFD_RELOC_V850_TDA_4_5_OFFSET, /* This is a 4 bit offset from the tiny data area pointer. */ BFD_RELOC_V850_TDA_4_4_OFFSET, /* This is a 16 bit offset from the short data area pointer, with the bits placed non-contigously in the instruction. */ BFD_RELOC_V850_SDA_16_16_SPLIT_OFFSET, /* This is a 16 bit offset from the zero data area pointer, with the bits placed non-contigously in the instruction. */ BFD_RELOC_V850_ZDA_16_16_SPLIT_OFFSET, /* This is a 6 bit offset from the call table base pointer. */ BFD_RELOC_V850_CALLT_6_7_OFFSET, /* This is a 16 bit offset from the call table base pointer. */ BFD_RELOC_V850_CALLT_16_16_OFFSET, /* This is a 32bit pcrel reloc for the mn10300, offset by two bytes in the instruction. */ BFD_RELOC_MN10300_32_PCREL, /* This is a 16bit pcrel reloc for the mn10300, offset by two bytes in the instruction. */ BFD_RELOC_MN10300_16_PCREL, /* This is a 8bit DP reloc for the tms320c30, where the most significant 8 bits of a 24 bit word are placed into the least significant 8 bits of the opcode. */ BFD_RELOC_TIC30_LDP, /* This is a 7bit reloc for the tms320c54x, where the least significant 7 bits of a 16 bit word are placed into the least significant 7 bits of the opcode. */ BFD_RELOC_TIC54X_PARTLS7, /* This is a 9bit DP reloc for the tms320c54x, where the most significant 9 bits of a 16 bit word are placed into the least significant 9 bits of the opcode. */ BFD_RELOC_TIC54X_PARTMS9, /* This is an extended address 23-bit reloc for the tms320c54x. */ BFD_RELOC_TIC54X_23, /* This is a 16-bit reloc for the tms320c54x, where the least significant 16 bits of a 23-bit extended address are placed into the opcode. */ BFD_RELOC_TIC54X_16_OF_23, /* This is a reloc for the tms320c54x, where the most significant 7 bits of a 23-bit extended address are placed into the opcode. */ BFD_RELOC_TIC54X_MS7_OF_23, /* This is a 48 bit reloc for the FR30 that stores 32 bits. */ BFD_RELOC_FR30_48, /* This is a 32 bit reloc for the FR30 that stores 20 bits split up into two sections. */ BFD_RELOC_FR30_20, /* This is a 16 bit reloc for the FR30 that stores a 6 bit word offset in 4 bits. */ BFD_RELOC_FR30_6_IN_4, /* This is a 16 bit reloc for the FR30 that stores an 8 bit byte offset into 8 bits. */ BFD_RELOC_FR30_8_IN_8, /* This is a 16 bit reloc for the FR30 that stores a 9 bit short offset into 8 bits. */ BFD_RELOC_FR30_9_IN_8, /* This is a 16 bit reloc for the FR30 that stores a 10 bit word offset into 8 bits. */ BFD_RELOC_FR30_10_IN_8, /* This is a 16 bit reloc for the FR30 that stores a 9 bit pc relative short offset into 8 bits. */ BFD_RELOC_FR30_9_PCREL, /* This is a 16 bit reloc for the FR30 that stores a 12 bit pc relative short offset into 11 bits. */ BFD_RELOC_FR30_12_PCREL, /* Motorola Mcore relocations. */ BFD_RELOC_MCORE_PCREL_IMM8BY4, BFD_RELOC_MCORE_PCREL_IMM11BY2, BFD_RELOC_MCORE_PCREL_IMM4BY2, BFD_RELOC_MCORE_PCREL_32, BFD_RELOC_MCORE_PCREL_JSR_IMM11BY2, BFD_RELOC_MCORE_RVA, /* This is a 16 bit reloc for the AVR that stores 8 bit pc relative short offset into 7 bits. */ BFD_RELOC_AVR_7_PCREL, /* This is a 16 bit reloc for the AVR that stores 13 bit pc relative short offset into 12 bits. */ BFD_RELOC_AVR_13_PCREL, /* This is a 16 bit reloc for the AVR that stores 17 bit value (usually program memory address) into 16 bits. */ BFD_RELOC_AVR_16_PM, /* This is a 16 bit reloc for the AVR that stores 8 bit value (usually data memory address) into 8 bit immediate value of LDI insn. */ BFD_RELOC_AVR_LO8_LDI, /* This is a 16 bit reloc for the AVR that stores 8 bit value (high 8 bit of data memory address) into 8 bit immediate value of LDI insn. */ BFD_RELOC_AVR_HI8_LDI, /* This is a 16 bit reloc for the AVR that stores 8 bit value (most high 8 bit of program memory address) into 8 bit immediate value of LDI insn. */ BFD_RELOC_AVR_HH8_LDI, /* This is a 16 bit reloc for the AVR that stores negated 8 bit value (usually data memory address) into 8 bit immediate value of SUBI insn. */ BFD_RELOC_AVR_LO8_LDI_NEG, /* This is a 16 bit reloc for the AVR that stores negated 8 bit value (high 8 bit of data memory address) into 8 bit immediate value of SUBI insn. */ BFD_RELOC_AVR_HI8_LDI_NEG, /* This is a 16 bit reloc for the AVR that stores negated 8 bit value (most high 8 bit of program memory address) into 8 bit immediate value of LDI or SUBI insn. */ BFD_RELOC_AVR_HH8_LDI_NEG, /* This is a 16 bit reloc for the AVR that stores 8 bit value (usually command address) into 8 bit immediate value of LDI insn. */ BFD_RELOC_AVR_LO8_LDI_PM, /* This is a 16 bit reloc for the AVR that stores 8 bit value (high 8 bit of command address) into 8 bit immediate value of LDI insn. */ BFD_RELOC_AVR_HI8_LDI_PM, /* This is a 16 bit reloc for the AVR that stores 8 bit value (most high 8 bit of command address) into 8 bit immediate value of LDI insn. */ BFD_RELOC_AVR_HH8_LDI_PM, /* This is a 16 bit reloc for the AVR that stores negated 8 bit value (usually command address) into 8 bit immediate value of SUBI insn. */ BFD_RELOC_AVR_LO8_LDI_PM_NEG, /* This is a 16 bit reloc for the AVR that stores negated 8 bit value (high 8 bit of 16 bit command address) into 8 bit immediate value of SUBI insn. */ BFD_RELOC_AVR_HI8_LDI_PM_NEG, /* This is a 16 bit reloc for the AVR that stores negated 8 bit value (high 6 bit of 22 bit command address) into 8 bit immediate value of SUBI insn. */ BFD_RELOC_AVR_HH8_LDI_PM_NEG, /* This is a 32 bit reloc for the AVR that stores 23 bit value into 22 bits. */ BFD_RELOC_AVR_CALL, /* These two relocations are used by the linker to determine which of the entries in a C++ virtual function table are actually used. When the --gc-sections option is given, the linker will zero out the entries that are not used, so that the code for those functions need not be included in the output. VTABLE_INHERIT is a zero-space relocation used to describe to the linker the inheritence tree of a C++ virtual function table. The relocation's symbol should be the parent class' vtable, and the relocation should be located at the child vtable. VTABLE_ENTRY is a zero-space relocation that describes the use of a virtual function table entry. The reloc's symbol should refer to the table of the class mentioned in the code. Off of that base, an offset describes the entry that is being used. For Rela hosts, this offset is stored in the reloc's addend. For Rel hosts, we are forced to put this offset in the reloc's section offset. */ BFD_RELOC_VTABLE_INHERIT, BFD_RELOC_VTABLE_ENTRY, /* Intel IA64 Relocations. */ BFD_RELOC_IA64_IMM14, BFD_RELOC_IA64_IMM22, BFD_RELOC_IA64_IMM64, BFD_RELOC_IA64_DIR32MSB, BFD_RELOC_IA64_DIR32LSB, BFD_RELOC_IA64_DIR64MSB, BFD_RELOC_IA64_DIR64LSB, BFD_RELOC_IA64_GPREL22, BFD_RELOC_IA64_GPREL64I, BFD_RELOC_IA64_GPREL32MSB, BFD_RELOC_IA64_GPREL32LSB, BFD_RELOC_IA64_GPREL64MSB, BFD_RELOC_IA64_GPREL64LSB, BFD_RELOC_IA64_LTOFF22, BFD_RELOC_IA64_LTOFF64I, BFD_RELOC_IA64_PLTOFF22, BFD_RELOC_IA64_PLTOFF64I, BFD_RELOC_IA64_PLTOFF64MSB, BFD_RELOC_IA64_PLTOFF64LSB, BFD_RELOC_IA64_FPTR64I, BFD_RELOC_IA64_FPTR32MSB, BFD_RELOC_IA64_FPTR32LSB, BFD_RELOC_IA64_FPTR64MSB, BFD_RELOC_IA64_FPTR64LSB, BFD_RELOC_IA64_PCREL21B, BFD_RELOC_IA64_PCREL21BI, BFD_RELOC_IA64_PCREL21M, BFD_RELOC_IA64_PCREL21F, BFD_RELOC_IA64_PCREL22, BFD_RELOC_IA64_PCREL60B, BFD_RELOC_IA64_PCREL64I, BFD_RELOC_IA64_PCREL32MSB, BFD_RELOC_IA64_PCREL32LSB, BFD_RELOC_IA64_PCREL64MSB, BFD_RELOC_IA64_PCREL64LSB, BFD_RELOC_IA64_LTOFF_FPTR22, BFD_RELOC_IA64_LTOFF_FPTR64I, BFD_RELOC_IA64_LTOFF_FPTR64MSB, BFD_RELOC_IA64_LTOFF_FPTR64LSB, BFD_RELOC_IA64_SEGREL32MSB, BFD_RELOC_IA64_SEGREL32LSB, BFD_RELOC_IA64_SEGREL64MSB, BFD_RELOC_IA64_SEGREL64LSB, BFD_RELOC_IA64_SECREL32MSB, BFD_RELOC_IA64_SECREL32LSB, BFD_RELOC_IA64_SECREL64MSB, BFD_RELOC_IA64_SECREL64LSB, BFD_RELOC_IA64_REL32MSB, BFD_RELOC_IA64_REL32LSB, BFD_RELOC_IA64_REL64MSB, BFD_RELOC_IA64_REL64LSB, BFD_RELOC_IA64_LTV32MSB, BFD_RELOC_IA64_LTV32LSB, BFD_RELOC_IA64_LTV64MSB, BFD_RELOC_IA64_LTV64LSB, BFD_RELOC_IA64_IPLTMSB, BFD_RELOC_IA64_IPLTLSB, BFD_RELOC_IA64_COPY, BFD_RELOC_IA64_TPREL22, BFD_RELOC_IA64_TPREL64MSB, BFD_RELOC_IA64_TPREL64LSB, BFD_RELOC_IA64_LTOFF_TP22, BFD_RELOC_IA64_LTOFF22X, BFD_RELOC_IA64_LDXMOV, /* Motorola 68HC11 reloc. This is the 8 bits high part of an absolute address. */ BFD_RELOC_M68HC11_HI8, /* Motorola 68HC11 reloc. This is the 8 bits low part of an absolute address. */ BFD_RELOC_M68HC11_LO8, /* Motorola 68HC11 reloc. This is the 3 bits of a value. */ BFD_RELOC_M68HC11_3B, /* These relocs are only used within the CRIS assembler. They are not (at present) written to any object files. */ BFD_RELOC_CRIS_BDISP8, BFD_RELOC_CRIS_UNSIGNED_5, BFD_RELOC_CRIS_SIGNED_6, BFD_RELOC_CRIS_UNSIGNED_6, BFD_RELOC_CRIS_UNSIGNED_4, /* Intel i860 Relocations. */ BFD_RELOC_860_COPY, BFD_RELOC_860_GLOB_DAT, BFD_RELOC_860_JUMP_SLOT, BFD_RELOC_860_RELATIVE, BFD_RELOC_860_PC26, BFD_RELOC_860_PLT26, BFD_RELOC_860_PC16, BFD_RELOC_860_LOW0, BFD_RELOC_860_SPLIT0, BFD_RELOC_860_LOW1, BFD_RELOC_860_SPLIT1, BFD_RELOC_860_LOW2, BFD_RELOC_860_SPLIT2, BFD_RELOC_860_LOW3, BFD_RELOC_860_LOGOT0, BFD_RELOC_860_SPGOT0, BFD_RELOC_860_LOGOT1, BFD_RELOC_860_SPGOT1, BFD_RELOC_860_LOGOTOFF0, BFD_RELOC_860_SPGOTOFF0, BFD_RELOC_860_LOGOTOFF1, BFD_RELOC_860_SPGOTOFF1, BFD_RELOC_860_LOGOTOFF2, BFD_RELOC_860_LOGOTOFF3, BFD_RELOC_860_LOPC, BFD_RELOC_860_HIGHADJ, BFD_RELOC_860_HAGOT, BFD_RELOC_860_HAGOTOFF, BFD_RELOC_860_HAPC, BFD_RELOC_860_HIGH, BFD_RELOC_860_HIGOT, BFD_RELOC_860_HIGOTOFF, BFD_RELOC_UNUSED }; typedef enum bfd_reloc_code_real bfd_reloc_code_real_type; reloc_howto_type * bfd_reloc_type_lookup PARAMS ((bfd *abfd, bfd_reloc_code_real_type code)); const char * bfd_get_reloc_code_name PARAMS ((bfd_reloc_code_real_type code)); typedef struct symbol_cache_entry { /* A pointer to the BFD which owns the symbol. This information is necessary so that a back end can work out what additional information (invisible to the application writer) is carried with the symbol. This field is *almost* redundant, since you can use section->owner instead, except that some symbols point to the global sections bfd_{abs,com,und}_section. This could be fixed by making these globals be per-bfd (or per-target-flavor). FIXME. */ struct _bfd *the_bfd; /* Use bfd_asymbol_bfd(sym) to access this field. */ /* The text of the symbol. The name is left alone, and not copied; the application may not alter it. */ CONST char *name; /* The value of the symbol. This really should be a union of a numeric value with a pointer, since some flags indicate that a pointer to another symbol is stored here. */ symvalue value; /* Attributes of a symbol: */ #define BSF_NO_FLAGS 0x00 /* The symbol has local scope; <> in <>. The value is the offset into the section of the data. */ #define BSF_LOCAL 0x01 /* The symbol has global scope; initialized data in <>. The value is the offset into the section of the data. */ #define BSF_GLOBAL 0x02 /* The symbol has global scope and is exported. The value is the offset into the section of the data. */ #define BSF_EXPORT BSF_GLOBAL /* no real difference */ /* A normal C symbol would be one of: <>, <>, <> or <> */ /* The symbol is a debugging record. The value has an arbitary meaning, unless BSF_DEBUGGING_RELOC is also set. */ #define BSF_DEBUGGING 0x08 /* The symbol denotes a function entry point. Used in ELF, perhaps others someday. */ #define BSF_FUNCTION 0x10 /* Used by the linker. */ #define BSF_KEEP 0x20 #define BSF_KEEP_G 0x40 /* A weak global symbol, overridable without warnings by a regular global symbol of the same name. */ #define BSF_WEAK 0x80 /* This symbol was created to point to a section, e.g. ELF's STT_SECTION symbols. */ #define BSF_SECTION_SYM 0x100 /* The symbol used to be a common symbol, but now it is allocated. */ #define BSF_OLD_COMMON 0x200 /* The default value for common data. */ #define BFD_FORT_COMM_DEFAULT_VALUE 0 /* In some files the type of a symbol sometimes alters its location in an output file - ie in coff a <> symbol which is also <> symbol appears where it was declared and not at the end of a section. This bit is set by the target BFD part to convey this information. */ #define BSF_NOT_AT_END 0x400 /* Signal that the symbol is the label of constructor section. */ #define BSF_CONSTRUCTOR 0x800 /* Signal that the symbol is a warning symbol. The name is a warning. The name of the next symbol is the one to warn about; if a reference is made to a symbol with the same name as the next symbol, a warning is issued by the linker. */ #define BSF_WARNING 0x1000 /* Signal that the symbol is indirect. This symbol is an indirect pointer to the symbol with the same name as the next symbol. */ #define BSF_INDIRECT 0x2000 /* BSF_FILE marks symbols that contain a file name. This is used for ELF STT_FILE symbols. */ #define BSF_FILE 0x4000 /* Symbol is from dynamic linking information. */ #define BSF_DYNAMIC 0x8000 /* The symbol denotes a data object. Used in ELF, and perhaps others someday. */ #define BSF_OBJECT 0x10000 /* This symbol is a debugging symbol. The value is the offset into the section of the data. BSF_DEBUGGING should be set as well. */ #define BSF_DEBUGGING_RELOC 0x20000 flagword flags; /* A pointer to the section to which this symbol is relative. This will always be non NULL, there are special sections for undefined and absolute symbols. */ struct sec *section; /* Back end special data. */ union { PTR p; bfd_vma i; } udata; } asymbol; #define bfd_get_symtab_upper_bound(abfd) \ BFD_SEND (abfd, _bfd_get_symtab_upper_bound, (abfd)) boolean bfd_is_local_label PARAMS ((bfd *abfd, asymbol *sym)); boolean bfd_is_local_label_name PARAMS ((bfd *abfd, const char *name)); #define bfd_is_local_label_name(abfd, name) \ BFD_SEND (abfd, _bfd_is_local_label_name, (abfd, name)) #define bfd_canonicalize_symtab(abfd, location) \ BFD_SEND (abfd, _bfd_canonicalize_symtab,\ (abfd, location)) boolean bfd_set_symtab PARAMS ((bfd *abfd, asymbol **location, unsigned int count)); void bfd_print_symbol_vandf PARAMS ((PTR file, asymbol *symbol)); #define bfd_make_empty_symbol(abfd) \ BFD_SEND (abfd, _bfd_make_empty_symbol, (abfd)) #define bfd_make_debug_symbol(abfd,ptr,size) \ BFD_SEND (abfd, _bfd_make_debug_symbol, (abfd, ptr, size)) int bfd_decode_symclass PARAMS ((asymbol *symbol)); boolean bfd_is_undefined_symclass PARAMS ((int symclass)); void bfd_symbol_info PARAMS ((asymbol *symbol, symbol_info *ret)); boolean bfd_copy_private_symbol_data PARAMS ((bfd *ibfd, asymbol *isym, bfd *obfd, asymbol *osym)); #define bfd_copy_private_symbol_data(ibfd, isymbol, obfd, osymbol) \ BFD_SEND (obfd, _bfd_copy_private_symbol_data, \ (ibfd, isymbol, obfd, osymbol)) struct _bfd { /* The filename the application opened the BFD with. */ CONST char *filename; /* A pointer to the target jump table. */ const struct bfd_target *xvec; /* To avoid dragging too many header files into every file that includes `<>', IOSTREAM has been declared as a "char *", and MTIME as a "long". Their correct types, to which they are cast when used, are "FILE *" and "time_t". The iostream is the result of an fopen on the filename. However, if the BFD_IN_MEMORY flag is set, then iostream is actually a pointer to a bfd_in_memory struct. */ PTR iostream; /* Is the file descriptor being cached? That is, can it be closed as needed, and re-opened when accessed later? */ boolean cacheable; /* Marks whether there was a default target specified when the BFD was opened. This is used to select which matching algorithm to use to choose the back end. */ boolean target_defaulted; /* The caching routines use these to maintain a least-recently-used list of BFDs */ struct _bfd *lru_prev, *lru_next; /* When a file is closed by the caching routines, BFD retains state information on the file here: */ file_ptr where; /* and here: (``once'' means at least once) */ boolean opened_once; /* Set if we have a locally maintained mtime value, rather than getting it from the file each time: */ boolean mtime_set; /* File modified time, if mtime_set is true: */ long mtime; /* Reserved for an unimplemented file locking extension.*/ int ifd; /* The format which belongs to the BFD. (object, core, etc.) */ bfd_format format; /* The direction the BFD was opened with*/ enum bfd_direction {no_direction = 0, read_direction = 1, write_direction = 2, both_direction = 3} direction; /* Format_specific flags*/ flagword flags; /* Currently my_archive is tested before adding origin to anything. I believe that this can become always an add of origin, with origin set to 0 for non archive files. */ file_ptr origin; /* Remember when output has begun, to stop strange things from happening. */ boolean output_has_begun; /* Pointer to linked list of sections*/ struct sec *sections; /* The number of sections */ unsigned int section_count; /* Stuff only useful for object files: The start address. */ bfd_vma start_address; /* Used for input and output*/ unsigned int symcount; /* Symbol table for output BFD (with symcount entries) */ struct symbol_cache_entry **outsymbols; /* Pointer to structure which contains architecture information*/ const struct bfd_arch_info *arch_info; /* Stuff only useful for archives:*/ PTR arelt_data; struct _bfd *my_archive; /* The containing archive BFD. */ struct _bfd *next; /* The next BFD in the archive. */ struct _bfd *archive_head; /* The first BFD in the archive. */ boolean has_armap; /* A chain of BFD structures involved in a link. */ struct _bfd *link_next; /* A field used by _bfd_generic_link_add_archive_symbols. This will be used only for archive elements. */ int archive_pass; /* Used by the back end to hold private data. */ union { struct aout_data_struct *aout_data; struct artdata *aout_ar_data; struct _oasys_data *oasys_obj_data; struct _oasys_ar_data *oasys_ar_data; struct coff_tdata *coff_obj_data; struct pe_tdata *pe_obj_data; struct xcoff_tdata *xcoff_obj_data; struct ecoff_tdata *ecoff_obj_data; struct ieee_data_struct *ieee_data; struct ieee_ar_data_struct *ieee_ar_data; struct srec_data_struct *srec_data; struct ihex_data_struct *ihex_data; struct tekhex_data_struct *tekhex_data; struct elf_obj_tdata *elf_obj_data; struct nlm_obj_tdata *nlm_obj_data; struct bout_data_struct *bout_data; struct sun_core_struct *sun_core_data; struct sco5_core_struct *sco5_core_data; struct trad_core_struct *trad_core_data; struct som_data_struct *som_data; struct hpux_core_struct *hpux_core_data; struct hppabsd_core_struct *hppabsd_core_data; struct sgi_core_struct *sgi_core_data; struct lynx_core_struct *lynx_core_data; struct osf_core_struct *osf_core_data; struct cisco_core_struct *cisco_core_data; struct versados_data_struct *versados_data; struct netbsd_core_struct *netbsd_core_data; PTR any; } tdata; /* Used by the application to hold private data*/ PTR usrdata; /* Where all the allocated stuff under this BFD goes. This is a struct objalloc *, but we use PTR to avoid requiring the inclusion of objalloc.h. */ PTR memory; }; typedef enum bfd_error { bfd_error_no_error = 0, bfd_error_system_call, bfd_error_invalid_target, bfd_error_wrong_format, bfd_error_invalid_operation, bfd_error_no_memory, bfd_error_no_symbols, bfd_error_no_armap, bfd_error_no_more_archived_files, bfd_error_malformed_archive, bfd_error_file_not_recognized, bfd_error_file_ambiguously_recognized, bfd_error_no_contents, bfd_error_nonrepresentable_section, bfd_error_no_debug_section, bfd_error_bad_value, bfd_error_file_truncated, bfd_error_file_too_big, bfd_error_invalid_error_code } bfd_error_type; bfd_error_type bfd_get_error PARAMS ((void)); void bfd_set_error PARAMS ((bfd_error_type error_tag)); CONST char * bfd_errmsg PARAMS ((bfd_error_type error_tag)); void bfd_perror PARAMS ((CONST char *message)); typedef void (*bfd_error_handler_type) PARAMS ((const char *, ...)); bfd_error_handler_type bfd_set_error_handler PARAMS ((bfd_error_handler_type)); void bfd_set_error_program_name PARAMS ((const char *)); bfd_error_handler_type bfd_get_error_handler PARAMS ((void)); long bfd_get_reloc_upper_bound PARAMS ((bfd *abfd, asection *sect)); long bfd_canonicalize_reloc PARAMS ((bfd *abfd, asection *sec, arelent **loc, asymbol **syms)); void bfd_set_reloc PARAMS ((bfd *abfd, asection *sec, arelent **rel, unsigned int count) ); boolean bfd_set_file_flags PARAMS ((bfd *abfd, flagword flags)); int bfd_get_arch_size PARAMS ((bfd *abfd)); int bfd_get_sign_extend_vma PARAMS ((bfd *abfd)); boolean bfd_set_start_address PARAMS ((bfd *abfd, bfd_vma vma)); long bfd_get_mtime PARAMS ((bfd *abfd)); long bfd_get_size PARAMS ((bfd *abfd)); int bfd_get_gp_size PARAMS ((bfd *abfd)); void bfd_set_gp_size PARAMS ((bfd *abfd, int i)); bfd_vma bfd_scan_vma PARAMS ((CONST char *string, CONST char **end, int base)); boolean bfd_copy_private_bfd_data PARAMS ((bfd *ibfd, bfd *obfd)); #define bfd_copy_private_bfd_data(ibfd, obfd) \ BFD_SEND (obfd, _bfd_copy_private_bfd_data, \ (ibfd, obfd)) boolean bfd_merge_private_bfd_data PARAMS ((bfd *ibfd, bfd *obfd)); #define bfd_merge_private_bfd_data(ibfd, obfd) \ BFD_SEND (obfd, _bfd_merge_private_bfd_data, \ (ibfd, obfd)) boolean bfd_set_private_flags PARAMS ((bfd *abfd, flagword flags)); #define bfd_set_private_flags(abfd, flags) \ BFD_SEND (abfd, _bfd_set_private_flags, \ (abfd, flags)) #define bfd_sizeof_headers(abfd, reloc) \ BFD_SEND (abfd, _bfd_sizeof_headers, (abfd, reloc)) #define bfd_find_nearest_line(abfd, sec, syms, off, file, func, line) \ BFD_SEND (abfd, _bfd_find_nearest_line, (abfd, sec, syms, off, file, func, line)) /* Do these three do anything useful at all, for any back end? */ #define bfd_debug_info_start(abfd) \ BFD_SEND (abfd, _bfd_debug_info_start, (abfd)) #define bfd_debug_info_end(abfd) \ BFD_SEND (abfd, _bfd_debug_info_end, (abfd)) #define bfd_debug_info_accumulate(abfd, section) \ BFD_SEND (abfd, _bfd_debug_info_accumulate, (abfd, section)) #define bfd_stat_arch_elt(abfd, stat) \ BFD_SEND (abfd, _bfd_stat_arch_elt,(abfd, stat)) #define bfd_update_armap_timestamp(abfd) \ BFD_SEND (abfd, _bfd_update_armap_timestamp, (abfd)) #define bfd_set_arch_mach(abfd, arch, mach)\ BFD_SEND ( abfd, _bfd_set_arch_mach, (abfd, arch, mach)) #define bfd_relax_section(abfd, section, link_info, again) \ BFD_SEND (abfd, _bfd_relax_section, (abfd, section, link_info, again)) #define bfd_gc_sections(abfd, link_info) \ BFD_SEND (abfd, _bfd_gc_sections, (abfd, link_info)) #define bfd_link_hash_table_create(abfd) \ BFD_SEND (abfd, _bfd_link_hash_table_create, (abfd)) #define bfd_link_add_symbols(abfd, info) \ BFD_SEND (abfd, _bfd_link_add_symbols, (abfd, info)) #define bfd_final_link(abfd, info) \ BFD_SEND (abfd, _bfd_final_link, (abfd, info)) #define bfd_free_cached_info(abfd) \ BFD_SEND (abfd, _bfd_free_cached_info, (abfd)) #define bfd_get_dynamic_symtab_upper_bound(abfd) \ BFD_SEND (abfd, _bfd_get_dynamic_symtab_upper_bound, (abfd)) #define bfd_print_private_bfd_data(abfd, file)\ BFD_SEND (abfd, _bfd_print_private_bfd_data, (abfd, file)) #define bfd_canonicalize_dynamic_symtab(abfd, asymbols) \ BFD_SEND (abfd, _bfd_canonicalize_dynamic_symtab, (abfd, asymbols)) #define bfd_get_dynamic_reloc_upper_bound(abfd) \ BFD_SEND (abfd, _bfd_get_dynamic_reloc_upper_bound, (abfd)) #define bfd_canonicalize_dynamic_reloc(abfd, arels, asyms) \ BFD_SEND (abfd, _bfd_canonicalize_dynamic_reloc, (abfd, arels, asyms)) extern bfd_byte *bfd_get_relocated_section_contents PARAMS ((bfd *, struct bfd_link_info *, struct bfd_link_order *, bfd_byte *, boolean, asymbol **)); symindex bfd_get_next_mapent PARAMS ((bfd *abfd, symindex previous, carsym **sym)); boolean bfd_set_archive_head PARAMS ((bfd *output, bfd *new_head)); bfd * bfd_openr_next_archived_file PARAMS ((bfd *archive, bfd *previous)); CONST char * bfd_core_file_failing_command PARAMS ((bfd *abfd)); int bfd_core_file_failing_signal PARAMS ((bfd *abfd)); boolean core_file_matches_executable_p PARAMS ((bfd *core_bfd, bfd *exec_bfd)); #define BFD_SEND(bfd, message, arglist) \ ((*((bfd)->xvec->message)) arglist) #ifdef DEBUG_BFD_SEND #undef BFD_SEND #define BFD_SEND(bfd, message, arglist) \ (((bfd) && (bfd)->xvec && (bfd)->xvec->message) ? \ ((*((bfd)->xvec->message)) arglist) : \ (bfd_assert (__FILE__,__LINE__), NULL)) #endif #define BFD_SEND_FMT(bfd, message, arglist) \ (((bfd)->xvec->message[(int) ((bfd)->format)]) arglist) #ifdef DEBUG_BFD_SEND #undef BFD_SEND_FMT #define BFD_SEND_FMT(bfd, message, arglist) \ (((bfd) && (bfd)->xvec && (bfd)->xvec->message) ? \ (((bfd)->xvec->message[(int) ((bfd)->format)]) arglist) : \ (bfd_assert (__FILE__,__LINE__), NULL)) #endif enum bfd_flavour { bfd_target_unknown_flavour, bfd_target_aout_flavour, bfd_target_coff_flavour, bfd_target_ecoff_flavour, bfd_target_xcoff_flavour, bfd_target_elf_flavour, bfd_target_ieee_flavour, bfd_target_nlm_flavour, bfd_target_oasys_flavour, bfd_target_tekhex_flavour, bfd_target_srec_flavour, bfd_target_ihex_flavour, bfd_target_som_flavour, bfd_target_os9k_flavour, bfd_target_versados_flavour, bfd_target_msdos_flavour, bfd_target_ovax_flavour, bfd_target_evax_flavour }; enum bfd_endian { BFD_ENDIAN_BIG, BFD_ENDIAN_LITTLE, BFD_ENDIAN_UNKNOWN }; /* Forward declaration. */ typedef struct bfd_link_info _bfd_link_info; typedef struct bfd_target { char *name; enum bfd_flavour flavour; enum bfd_endian byteorder; enum bfd_endian header_byteorder; flagword object_flags; flagword section_flags; char symbol_leading_char; char ar_pad_char; unsigned short ar_max_namelen; bfd_vma (*bfd_getx64) PARAMS ((const bfd_byte *)); bfd_signed_vma (*bfd_getx_signed_64) PARAMS ((const bfd_byte *)); void (*bfd_putx64) PARAMS ((bfd_vma, bfd_byte *)); bfd_vma (*bfd_getx32) PARAMS ((const bfd_byte *)); bfd_signed_vma (*bfd_getx_signed_32) PARAMS ((const bfd_byte *)); void (*bfd_putx32) PARAMS ((bfd_vma, bfd_byte *)); bfd_vma (*bfd_getx16) PARAMS ((const bfd_byte *)); bfd_signed_vma (*bfd_getx_signed_16) PARAMS ((const bfd_byte *)); void (*bfd_putx16) PARAMS ((bfd_vma, bfd_byte *)); bfd_vma (*bfd_h_getx64) PARAMS ((const bfd_byte *)); bfd_signed_vma (*bfd_h_getx_signed_64) PARAMS ((const bfd_byte *)); void (*bfd_h_putx64) PARAMS ((bfd_vma, bfd_byte *)); bfd_vma (*bfd_h_getx32) PARAMS ((const bfd_byte *)); bfd_signed_vma (*bfd_h_getx_signed_32) PARAMS ((const bfd_byte *)); void (*bfd_h_putx32) PARAMS ((bfd_vma, bfd_byte *)); bfd_vma (*bfd_h_getx16) PARAMS ((const bfd_byte *)); bfd_signed_vma (*bfd_h_getx_signed_16) PARAMS ((const bfd_byte *)); void (*bfd_h_putx16) PARAMS ((bfd_vma, bfd_byte *)); const struct bfd_target *(*_bfd_check_format[bfd_type_end]) PARAMS ((bfd *)); boolean (*_bfd_set_format[bfd_type_end]) PARAMS ((bfd *)); boolean (*_bfd_write_contents[bfd_type_end]) PARAMS ((bfd *)); /* Generic entry points. */ #define BFD_JUMP_TABLE_GENERIC(NAME)\ CAT(NAME,_close_and_cleanup),\ CAT(NAME,_bfd_free_cached_info),\ CAT(NAME,_new_section_hook),\ CAT(NAME,_get_section_contents),\ CAT(NAME,_get_section_contents_in_window) /* Called when the BFD is being closed to do any necessary cleanup. */ boolean (*_close_and_cleanup) PARAMS ((bfd *)); /* Ask the BFD to free all cached information. */ boolean (*_bfd_free_cached_info) PARAMS ((bfd *)); /* Called when a new section is created. */ boolean (*_new_section_hook) PARAMS ((bfd *, sec_ptr)); /* Read the contents of a section. */ boolean (*_bfd_get_section_contents) PARAMS ((bfd *, sec_ptr, PTR, file_ptr, bfd_size_type)); boolean (*_bfd_get_section_contents_in_window) PARAMS ((bfd *, sec_ptr, bfd_window *, file_ptr, bfd_size_type)); /* Entry points to copy private data. */ #define BFD_JUMP_TABLE_COPY(NAME)\ CAT(NAME,_bfd_copy_private_bfd_data),\ CAT(NAME,_bfd_merge_private_bfd_data),\ CAT(NAME,_bfd_copy_private_section_data),\ CAT(NAME,_bfd_copy_private_symbol_data),\ CAT(NAME,_bfd_set_private_flags),\ CAT(NAME,_bfd_print_private_bfd_data)\ /* Called to copy BFD general private data from one object file to another. */ boolean (*_bfd_copy_private_bfd_data) PARAMS ((bfd *, bfd *)); /* Called to merge BFD general private data from one object file to a common output file when linking. */ boolean (*_bfd_merge_private_bfd_data) PARAMS ((bfd *, bfd *)); /* Called to copy BFD private section data from one object file to another. */ boolean (*_bfd_copy_private_section_data) PARAMS ((bfd *, sec_ptr, bfd *, sec_ptr)); /* Called to copy BFD private symbol data from one symbol to another. */ boolean (*_bfd_copy_private_symbol_data) PARAMS ((bfd *, asymbol *, bfd *, asymbol *)); /* Called to set private backend flags */ boolean (*_bfd_set_private_flags) PARAMS ((bfd *, flagword)); /* Called to print private BFD data */ boolean (*_bfd_print_private_bfd_data) PARAMS ((bfd *, PTR)); /* Core file entry points. */ #define BFD_JUMP_TABLE_CORE(NAME)\ CAT(NAME,_core_file_failing_command),\ CAT(NAME,_core_file_failing_signal),\ CAT(NAME,_core_file_matches_executable_p) char * (*_core_file_failing_command) PARAMS ((bfd *)); int (*_core_file_failing_signal) PARAMS ((bfd *)); boolean (*_core_file_matches_executable_p) PARAMS ((bfd *, bfd *)); /* Archive entry points. */ #define BFD_JUMP_TABLE_ARCHIVE(NAME)\ CAT(NAME,_slurp_armap),\ CAT(NAME,_slurp_extended_name_table),\ CAT(NAME,_construct_extended_name_table),\ CAT(NAME,_truncate_arname),\ CAT(NAME,_write_armap),\ CAT(NAME,_read_ar_hdr),\ CAT(NAME,_openr_next_archived_file),\ CAT(NAME,_get_elt_at_index),\ CAT(NAME,_generic_stat_arch_elt),\ CAT(NAME,_update_armap_timestamp) boolean (*_bfd_slurp_armap) PARAMS ((bfd *)); boolean (*_bfd_slurp_extended_name_table) PARAMS ((bfd *)); boolean (*_bfd_construct_extended_name_table) PARAMS ((bfd *, char **, bfd_size_type *, const char **)); void (*_bfd_truncate_arname) PARAMS ((bfd *, CONST char *, char *)); boolean (*write_armap) PARAMS ((bfd *arch, unsigned int elength, struct orl *map, unsigned int orl_count, int stridx)); PTR (*_bfd_read_ar_hdr_fn) PARAMS ((bfd *)); bfd * (*openr_next_archived_file) PARAMS ((bfd *arch, bfd *prev)); #define bfd_get_elt_at_index(b,i) BFD_SEND(b, _bfd_get_elt_at_index, (b,i)) bfd * (*_bfd_get_elt_at_index) PARAMS ((bfd *, symindex)); int (*_bfd_stat_arch_elt) PARAMS ((bfd *, struct stat *)); boolean (*_bfd_update_armap_timestamp) PARAMS ((bfd *)); /* Entry points used for symbols. */ #define BFD_JUMP_TABLE_SYMBOLS(NAME)\ CAT(NAME,_get_symtab_upper_bound),\ CAT(NAME,_get_symtab),\ CAT(NAME,_make_empty_symbol),\ CAT(NAME,_print_symbol),\ CAT(NAME,_get_symbol_info),\ CAT(NAME,_bfd_is_local_label_name),\ CAT(NAME,_get_lineno),\ CAT(NAME,_find_nearest_line),\ CAT(NAME,_bfd_make_debug_symbol),\ CAT(NAME,_read_minisymbols),\ CAT(NAME,_minisymbol_to_symbol) long (*_bfd_get_symtab_upper_bound) PARAMS ((bfd *)); long (*_bfd_canonicalize_symtab) PARAMS ((bfd *, struct symbol_cache_entry **)); struct symbol_cache_entry * (*_bfd_make_empty_symbol) PARAMS ((bfd *)); void (*_bfd_print_symbol) PARAMS ((bfd *, PTR, struct symbol_cache_entry *, bfd_print_symbol_type)); #define bfd_print_symbol(b,p,s,e) BFD_SEND(b, _bfd_print_symbol, (b,p,s,e)) void (*_bfd_get_symbol_info) PARAMS ((bfd *, struct symbol_cache_entry *, symbol_info *)); #define bfd_get_symbol_info(b,p,e) BFD_SEND(b, _bfd_get_symbol_info, (b,p,e)) boolean (*_bfd_is_local_label_name) PARAMS ((bfd *, const char *)); alent * (*_get_lineno) PARAMS ((bfd *, struct symbol_cache_entry *)); boolean (*_bfd_find_nearest_line) PARAMS ((bfd *abfd, struct sec *section, struct symbol_cache_entry **symbols, bfd_vma offset, CONST char **file, CONST char **func, unsigned int *line)); /* Back-door to allow format-aware applications to create debug symbols while using BFD for everything else. Currently used by the assembler when creating COFF files. */ asymbol * (*_bfd_make_debug_symbol) PARAMS (( bfd *abfd, void *ptr, unsigned long size)); #define bfd_read_minisymbols(b, d, m, s) \ BFD_SEND (b, _read_minisymbols, (b, d, m, s)) long (*_read_minisymbols) PARAMS ((bfd *, boolean, PTR *, unsigned int *)); #define bfd_minisymbol_to_symbol(b, d, m, f) \ BFD_SEND (b, _minisymbol_to_symbol, (b, d, m, f)) asymbol *(*_minisymbol_to_symbol) PARAMS ((bfd *, boolean, const PTR, asymbol *)); /* Routines for relocs. */ #define BFD_JUMP_TABLE_RELOCS(NAME)\ CAT(NAME,_get_reloc_upper_bound),\ CAT(NAME,_canonicalize_reloc),\ CAT(NAME,_bfd_reloc_type_lookup) long (*_get_reloc_upper_bound) PARAMS ((bfd *, sec_ptr)); long (*_bfd_canonicalize_reloc) PARAMS ((bfd *, sec_ptr, arelent **, struct symbol_cache_entry **)); /* See documentation on reloc types. */ reloc_howto_type * (*reloc_type_lookup) PARAMS ((bfd *abfd, bfd_reloc_code_real_type code)); /* Routines used when writing an object file. */ #define BFD_JUMP_TABLE_WRITE(NAME)\ CAT(NAME,_set_arch_mach),\ CAT(NAME,_set_section_contents) boolean (*_bfd_set_arch_mach) PARAMS ((bfd *, enum bfd_architecture, unsigned long)); boolean (*_bfd_set_section_contents) PARAMS ((bfd *, sec_ptr, PTR, file_ptr, bfd_size_type)); /* Routines used by the linker. */ #define BFD_JUMP_TABLE_LINK(NAME)\ CAT(NAME,_sizeof_headers),\ CAT(NAME,_bfd_get_relocated_section_contents),\ CAT(NAME,_bfd_relax_section),\ CAT(NAME,_bfd_link_hash_table_create),\ CAT(NAME,_bfd_link_add_symbols),\ CAT(NAME,_bfd_final_link),\ CAT(NAME,_bfd_link_split_section),\ CAT(NAME,_bfd_gc_sections) int (*_bfd_sizeof_headers) PARAMS ((bfd *, boolean)); bfd_byte * (*_bfd_get_relocated_section_contents) PARAMS ((bfd *, struct bfd_link_info *, struct bfd_link_order *, bfd_byte *data, boolean relocateable, struct symbol_cache_entry **)); boolean (*_bfd_relax_section) PARAMS ((bfd *, struct sec *, struct bfd_link_info *, boolean *again)); /* Create a hash table for the linker. Different backends store different information in this table. */ struct bfd_link_hash_table *(*_bfd_link_hash_table_create) PARAMS ((bfd *)); /* Add symbols from this object file into the hash table. */ boolean (*_bfd_link_add_symbols) PARAMS ((bfd *, struct bfd_link_info *)); /* Do a link based on the link_order structures attached to each section of the BFD. */ boolean (*_bfd_final_link) PARAMS ((bfd *, struct bfd_link_info *)); /* Should this section be split up into smaller pieces during linking. */ boolean (*_bfd_link_split_section) PARAMS ((bfd *, struct sec *)); /* Remove sections that are not referenced from the output. */ boolean (*_bfd_gc_sections) PARAMS ((bfd *, struct bfd_link_info *)); /* Routines to handle dynamic symbols and relocs. */ #define BFD_JUMP_TABLE_DYNAMIC(NAME)\ CAT(NAME,_get_dynamic_symtab_upper_bound),\ CAT(NAME,_canonicalize_dynamic_symtab),\ CAT(NAME,_get_dynamic_reloc_upper_bound),\ CAT(NAME,_canonicalize_dynamic_reloc) /* Get the amount of memory required to hold the dynamic symbols. */ long (*_bfd_get_dynamic_symtab_upper_bound) PARAMS ((bfd *)); /* Read in the dynamic symbols. */ long (*_bfd_canonicalize_dynamic_symtab) PARAMS ((bfd *, struct symbol_cache_entry **)); /* Get the amount of memory required to hold the dynamic relocs. */ long (*_bfd_get_dynamic_reloc_upper_bound) PARAMS ((bfd *)); /* Read in the dynamic relocs. */ long (*_bfd_canonicalize_dynamic_reloc) PARAMS ((bfd *, arelent **, struct symbol_cache_entry **)); /* Opposite endian version of this target. */ const struct bfd_target * alternative_target; PTR backend_data; } bfd_target; boolean bfd_set_default_target PARAMS ((const char *name)); const bfd_target * bfd_find_target PARAMS ((CONST char *target_name, bfd *abfd)); const char ** bfd_target_list PARAMS ((void)); const bfd_target * bfd_search_for_target PARAMS ((int (* search_func) (const bfd_target *, void *), void *)); boolean bfd_check_format PARAMS ((bfd *abfd, bfd_format format)); boolean bfd_check_format_matches PARAMS ((bfd *abfd, bfd_format format, char ***matching)); boolean bfd_set_format PARAMS ((bfd *abfd, bfd_format format)); CONST char * bfd_format_string PARAMS ((bfd_format format)); #ifdef __cplusplus } #endif #endif binutils/binutils-RUN/opt/binutils/include/bfdlink.h010064400000000000003000000540740732753176700214320ustar000300000000000000/* bfdlink.h -- header file for BFD link routines Copyright 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000 Free Software Foundation, Inc. Written by Steve Chamberlain and Ian Lance Taylor, Cygnus Support. This file is part of BFD, the Binary File Descriptor library. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. */ #ifndef BFDLINK_H #define BFDLINK_H /* Which symbols to strip during a link. */ enum bfd_link_strip { strip_none, /* Don't strip any symbols. */ strip_debugger, /* Strip debugging symbols. */ strip_some, /* keep_hash is the list of symbols to keep. */ strip_all /* Strip all symbols. */ }; /* Which local symbols to discard during a link. This is irrelevant if strip_all is used. */ enum bfd_link_discard { discard_none, /* Don't discard any locals. */ discard_l, /* Discard local temporary symbols. */ discard_all /* Discard all locals. */ }; /* These are the possible types of an entry in the BFD link hash table. */ enum bfd_link_hash_type { bfd_link_hash_new, /* Symbol is new. */ bfd_link_hash_undefined, /* Symbol seen before, but undefined. */ bfd_link_hash_undefweak, /* Symbol is weak and undefined. */ bfd_link_hash_defined, /* Symbol is defined. */ bfd_link_hash_defweak, /* Symbol is weak and defined. */ bfd_link_hash_common, /* Symbol is common. */ bfd_link_hash_indirect, /* Symbol is an indirect link. */ bfd_link_hash_warning /* Like indirect, but warn if referenced. */ }; /* The linking routines use a hash table which uses this structure for its elements. */ struct bfd_link_hash_entry { /* Base hash table entry structure. */ struct bfd_hash_entry root; /* Type of this entry. */ enum bfd_link_hash_type type; /* Undefined and common symbols are kept in a linked list through this field. This field is not in the union because that would force us to remove entries from the list when we changed their type, which would force the list to be doubly linked, which would waste more memory. When an undefined or common symbol is created, it should be added to this list, the head of which is in the link hash table itself. As symbols are defined, they need not be removed from the list; anything which reads the list must doublecheck the symbol type. Weak symbols are not kept on this list. Defined and defweak symbols use this field as a reference marker. If the field is not NULL, or this structure is the tail of the undefined symbol list, the symbol has been referenced. If the symbol is undefined and becomes defined, this field will automatically be non-NULL since the symbol will have been on the undefined symbol list. */ struct bfd_link_hash_entry *next; /* A union of information depending upon the type. */ union { /* Nothing is kept for bfd_hash_new. */ /* bfd_link_hash_undefined, bfd_link_hash_undefweak. */ struct { bfd *abfd; /* BFD symbol was found in. */ } undef; /* bfd_link_hash_defined, bfd_link_hash_defweak. */ struct { bfd_vma value; /* Symbol value. */ asection *section; /* Symbol section. */ } def; /* bfd_link_hash_indirect, bfd_link_hash_warning. */ struct { struct bfd_link_hash_entry *link; /* Real symbol. */ const char *warning; /* Warning (bfd_link_hash_warning only). */ } i; /* bfd_link_hash_common. */ struct { /* The linker needs to know three things about common symbols: the size, the alignment, and the section in which the symbol should be placed. We store the size here, and we allocate a small structure to hold the section and the alignment. The alignment is stored as a power of two. We don't store all the information directly because we don't want to increase the size of the union; this structure is a major space user in the linker. */ bfd_size_type size; /* Common symbol size. */ struct bfd_link_hash_common_entry { unsigned int alignment_power; /* Alignment. */ asection *section; /* Symbol section. */ } *p; } c; } u; }; /* This is the link hash table. It is a derived class of bfd_hash_table. */ struct bfd_link_hash_table { /* The hash table itself. */ struct bfd_hash_table table; /* The back end which created this hash table. This indicates the type of the entries in the hash table, which is sometimes important information when linking object files of different types together. */ const bfd_target *creator; /* A linked list of undefined and common symbols, linked through the next field in the bfd_link_hash_entry structure. */ struct bfd_link_hash_entry *undefs; /* Entries are added to the tail of the undefs list. */ struct bfd_link_hash_entry *undefs_tail; }; /* Look up an entry in a link hash table. If FOLLOW is true, this follows bfd_link_hash_indirect and bfd_link_hash_warning links to the real symbol. */ extern struct bfd_link_hash_entry *bfd_link_hash_lookup PARAMS ((struct bfd_link_hash_table *, const char *, boolean create, boolean copy, boolean follow)); /* Look up an entry in the main linker hash table if the symbol might be wrapped. This should only be used for references to an undefined symbol, not for definitions of a symbol. */ extern struct bfd_link_hash_entry *bfd_wrapped_link_hash_lookup PARAMS ((bfd *, struct bfd_link_info *, const char *, boolean, boolean, boolean)); /* Traverse a link hash table. */ extern void bfd_link_hash_traverse PARAMS ((struct bfd_link_hash_table *, boolean (*) (struct bfd_link_hash_entry *, PTR), PTR)); /* Add an entry to the undefs list. */ extern void bfd_link_add_undef PARAMS ((struct bfd_link_hash_table *, struct bfd_link_hash_entry *)); /* This structure holds all the information needed to communicate between BFD and the linker when doing a link. */ struct bfd_link_info { /* Function callbacks. */ const struct bfd_link_callbacks *callbacks; /* true if BFD should generate a relocateable object file. */ boolean relocateable; /* true if BFD should generate relocation information in the final executable. */ boolean emitrelocations; /* true if BFD should generate a "task linked" object file, similar to relocatable but also with globals converted to statics. */ boolean task_link; /* true if BFD should generate a shared object. */ boolean shared; /* true if BFD should pre-bind symbols in a shared object. */ boolean symbolic; /* true if shared objects should be linked directly, not shared. */ boolean static_link; /* true if the output file should be in a traditional format. This is equivalent to the setting of the BFD_TRADITIONAL_FORMAT flag on the output file, but may be checked when reading the input files. */ boolean traditional_format; /* true if we want to produced optimized output files. This might need much more time and therefore must be explicitly selected. */ boolean optimize; /* true if BFD should generate errors for undefined symbols even if generating a shared object. */ boolean no_undefined; /* true if BFD should allow undefined symbols in shared objects even when no_undefined is set to disallow undefined symbols. The net result will be that undefined symbols in regular objects will still trigger an error, but undefined symbols in shared objects will be ignored. The implementation of no_undefined makes the assumption that the runtime linker will choke on undefined symbols. However there is at least one system (BeOS) where undefined symbols in shared libraries is normal since the kernel patches them at load time to select which function is most appropriate for the current architecture. I.E. dynamically select an appropriate memset function. Apparently it is also normal for HPPA shared libraries to have undefined symbols. */ boolean allow_shlib_undefined; /* Which symbols to strip. */ enum bfd_link_strip strip; /* Which local symbols to discard. */ enum bfd_link_discard discard; /* true if symbols should be retained in memory, false if they should be freed and reread. */ boolean keep_memory; /* The list of input BFD's involved in the link. These are chained together via the link_next field. */ bfd *input_bfds; /* If a symbol should be created for each input BFD, this is section where those symbols should be placed. It must be a section in the output BFD. It may be NULL, in which case no such symbols will be created. This is to support CREATE_OBJECT_SYMBOLS in the linker command language. */ asection *create_object_symbols_section; /* Hash table handled by BFD. */ struct bfd_link_hash_table *hash; /* Hash table of symbols to keep. This is NULL unless strip is strip_some. */ struct bfd_hash_table *keep_hash; /* true if every symbol should be reported back via the notice callback. */ boolean notice_all; /* Hash table of symbols to report back via the notice callback. If this is NULL, and notice_all is false, then no symbols are reported back. */ struct bfd_hash_table *notice_hash; /* Hash table of symbols which are being wrapped (the --wrap linker option). If this is NULL, no symbols are being wrapped. */ struct bfd_hash_table *wrap_hash; /* If a base output file is wanted, then this points to it */ PTR base_file; /* If non-zero, specifies that branches which are problematic for the MPC860 C0 (or earlier) should be checked for and modified. It gives the number of bytes that should be checked at the end of each text page. */ int mpc860c0; /* The function to call when the executable or shared object is loaded. */ const char *init_function; /* The function to call when the executable or shared object is unloaded. */ const char *fini_function; /* true if the new ELF dynamic tags are enabled. */ boolean new_dtags; /* May be used to set DT_FLAGS for ELF. */ bfd_vma flags; /* May be used to set DT_FLAGS_1 for ELF. */ bfd_vma flags_1; }; /* This structures holds a set of callback functions. These are called by the BFD linker routines. The first argument to each callback function is the bfd_link_info structure being used. Each function returns a boolean value. If the function returns false, then the BFD function which called it will return with a failure indication. */ struct bfd_link_callbacks { /* A function which is called when an object is added from an archive. ABFD is the archive element being added. NAME is the name of the symbol which caused the archive element to be pulled in. */ boolean (*add_archive_element) PARAMS ((struct bfd_link_info *, bfd *abfd, const char *name)); /* A function which is called when a symbol is found with multiple definitions. NAME is the symbol which is defined multiple times. OBFD is the old BFD, OSEC is the old section, OVAL is the old value, NBFD is the new BFD, NSEC is the new section, and NVAL is the new value. OBFD may be NULL. OSEC and NSEC may be bfd_com_section or bfd_ind_section. */ boolean (*multiple_definition) PARAMS ((struct bfd_link_info *, const char *name, bfd *obfd, asection *osec, bfd_vma oval, bfd *nbfd, asection *nsec, bfd_vma nval)); /* A function which is called when a common symbol is defined multiple times. NAME is the symbol appearing multiple times. OBFD is the BFD of the existing symbol; it may be NULL if this is not known. OTYPE is the type of the existing symbol, which may be bfd_link_hash_defined, bfd_link_hash_defweak, bfd_link_hash_common, or bfd_link_hash_indirect. If OTYPE is bfd_link_hash_common, OSIZE is the size of the existing symbol. NBFD is the BFD of the new symbol. NTYPE is the type of the new symbol, one of bfd_link_hash_defined, bfd_link_hash_common, or bfd_link_hash_indirect. If NTYPE is bfd_link_hash_common, NSIZE is the size of the new symbol. */ boolean (*multiple_common) PARAMS ((struct bfd_link_info *, const char *name, bfd *obfd, enum bfd_link_hash_type otype, bfd_vma osize, bfd *nbfd, enum bfd_link_hash_type ntype, bfd_vma nsize)); /* A function which is called to add a symbol to a set. ENTRY is the link hash table entry for the set itself (e.g., __CTOR_LIST__). RELOC is the relocation to use for an entry in the set when generating a relocateable file, and is also used to get the size of the entry when generating an executable file. ABFD, SEC and VALUE identify the value to add to the set. */ boolean (*add_to_set) PARAMS ((struct bfd_link_info *, struct bfd_link_hash_entry *entry, bfd_reloc_code_real_type reloc, bfd *abfd, asection *sec, bfd_vma value)); /* A function which is called when the name of a g++ constructor or destructor is found. This is only called by some object file formats. CONSTRUCTOR is true for a constructor, false for a destructor. This will use BFD_RELOC_CTOR when generating a relocateable file. NAME is the name of the symbol found. ABFD, SECTION and VALUE are the value of the symbol. */ boolean (*constructor) PARAMS ((struct bfd_link_info *, boolean constructor, const char *name, bfd *abfd, asection *sec, bfd_vma value)); /* A function which is called to issue a linker warning. For example, this is called when there is a reference to a warning symbol. WARNING is the warning to be issued. SYMBOL is the name of the symbol which triggered the warning; it may be NULL if there is none. ABFD, SECTION and ADDRESS identify the location which trigerred the warning; either ABFD or SECTION or both may be NULL if the location is not known. */ boolean (*warning) PARAMS ((struct bfd_link_info *, const char *warning, const char *symbol, bfd *abfd, asection *section, bfd_vma address)); /* A function which is called when a relocation is attempted against an undefined symbol. NAME is the symbol which is undefined. ABFD, SECTION and ADDRESS identify the location from which the reference is made. FATAL indicates whether an undefined symbol is a fatal error or not. In some cases SECTION may be NULL. */ boolean (*undefined_symbol) PARAMS ((struct bfd_link_info *, const char *name, bfd *abfd, asection *section, bfd_vma address, boolean fatal)); /* A function which is called when a reloc overflow occurs. NAME is the name of the symbol or section the reloc is against, RELOC_NAME is the name of the relocation, and ADDEND is any addend that is used. ABFD, SECTION and ADDRESS identify the location at which the overflow occurs; if this is the result of a bfd_section_reloc_link_order or bfd_symbol_reloc_link_order, then ABFD will be NULL. */ boolean (*reloc_overflow) PARAMS ((struct bfd_link_info *, const char *name, const char *reloc_name, bfd_vma addend, bfd *abfd, asection *section, bfd_vma address)); /* A function which is called when a dangerous reloc is performed. The canonical example is an a29k IHCONST reloc which does not follow an IHIHALF reloc. MESSAGE is an appropriate message. ABFD, SECTION and ADDRESS identify the location at which the problem occurred; if this is the result of a bfd_section_reloc_link_order or bfd_symbol_reloc_link_order, then ABFD will be NULL. */ boolean (*reloc_dangerous) PARAMS ((struct bfd_link_info *, const char *message, bfd *abfd, asection *section, bfd_vma address)); /* A function which is called when a reloc is found to be attached to a symbol which is not being written out. NAME is the name of the symbol. ABFD, SECTION and ADDRESS identify the location of the reloc; if this is the result of a bfd_section_reloc_link_order or bfd_symbol_reloc_link_order, then ABFD will be NULL. */ boolean (*unattached_reloc) PARAMS ((struct bfd_link_info *, const char *name, bfd *abfd, asection *section, bfd_vma address)); /* A function which is called when a symbol in notice_hash is defined or referenced. NAME is the symbol. ABFD, SECTION and ADDRESS are the value of the symbol. If SECTION is bfd_und_section, this is a reference. */ boolean (*notice) PARAMS ((struct bfd_link_info *, const char *name, bfd *abfd, asection *section, bfd_vma address)); }; /* The linker builds link_order structures which tell the code how to include input data in the output file. */ /* These are the types of link_order structures. */ enum bfd_link_order_type { bfd_undefined_link_order, /* Undefined. */ bfd_indirect_link_order, /* Built from a section. */ bfd_fill_link_order, /* Fill with a 16 bit constant. */ bfd_data_link_order, /* Set to explicit data. */ bfd_section_reloc_link_order, /* Relocate against a section. */ bfd_symbol_reloc_link_order /* Relocate against a symbol. */ }; /* This is the link_order structure itself. These form a chain attached to the section whose contents they are describing. */ struct bfd_link_order { /* Next link_order in chain. */ struct bfd_link_order *next; /* Type of link_order. */ enum bfd_link_order_type type; /* Offset within output section. */ bfd_vma offset; /* Size within output section. */ bfd_size_type size; /* Type specific information. */ union { struct { /* Section to include. If this is used, then section->output_section must be the section the link_order is attached to, section->output_offset must equal the link_order offset field, and section->_raw_size must equal the link_order size field. Maybe these restrictions should be relaxed someday. */ asection *section; } indirect; struct { /* Value to fill with. */ unsigned int value; } fill; struct { /* Data to put into file. The size field gives the number of bytes which this field points to. */ bfd_byte *contents; } data; struct { /* Description of reloc to generate. Used for bfd_section_reloc_link_order and bfd_symbol_reloc_link_order. */ struct bfd_link_order_reloc *p; } reloc; } u; }; /* A linker order of type bfd_section_reloc_link_order or bfd_symbol_reloc_link_order means to create a reloc against a section or symbol, respectively. This is used to implement -Ur to generate relocs for the constructor tables. The bfd_link_order_reloc structure describes the reloc that BFD should create. It is similar to a arelent, but I didn't use arelent because the linker does not know anything about most symbols, and any asymbol structure it creates will be partially meaningless. This information could logically be in the bfd_link_order struct, but I didn't want to waste the space since these types of relocs are relatively rare. */ struct bfd_link_order_reloc { /* Reloc type. */ bfd_reloc_code_real_type reloc; union { /* For type bfd_section_reloc_link_order, this is the section the reloc should be against. This must be a section in the output BFD, not any of the input BFDs. */ asection *section; /* For type bfd_symbol_reloc_link_order, this is the name of the symbol the reloc should be against. */ const char *name; } u; /* Addend to use. The object file should contain zero. The BFD backend is responsible for filling in the contents of the object file correctly. For some object file formats (e.g., COFF) the addend must be stored into in the object file, and for some (e.g., SPARC a.out) it is kept in the reloc. */ bfd_vma addend; }; /* Allocate a new link_order for a section. */ extern struct bfd_link_order *bfd_new_link_order PARAMS ((bfd *, asection *)); /* These structures are used to describe version information for the ELF linker. These structures could be manipulated entirely inside BFD, but it would be a pain. Instead, the regular linker sets up these structures, and then passes them into BFD. */ /* Regular expressions for a version. */ struct bfd_elf_version_expr { /* Next regular expression for this version. */ struct bfd_elf_version_expr *next; /* Regular expression. */ const char *pattern; /* Matching function. */ int (*match) PARAMS((struct bfd_elf_version_expr *, const char *)); }; /* Version dependencies. */ struct bfd_elf_version_deps { /* Next dependency for this version. */ struct bfd_elf_version_deps *next; /* The version which this version depends upon. */ struct bfd_elf_version_tree *version_needed; }; /* A node in the version tree. */ struct bfd_elf_version_tree { /* Next version. */ struct bfd_elf_version_tree *next; /* Name of this version. */ const char *name; /* Version number. */ unsigned int vernum; /* Regular expressions for global symbols in this version. */ struct bfd_elf_version_expr *globals; /* Regular expressions for local symbols in this version. */ struct bfd_elf_version_expr *locals; /* List of versions which this version depends upon. */ struct bfd_elf_version_deps *deps; /* Index of the version name. This is used within BFD. */ unsigned int name_indx; /* Whether this version tree was used. This is used within BFD. */ int used; }; #endif binutils/binutils-RUN/opt/binutils/lib/libbfd.a010064400000000000003000011521000732753176600203440ustar000300000000000000! / 996061569 0 0 0 23440 ` @LOX>/L;H-<8(7>h@1;+7`*<,HP":#.7>50)84*$(3P13+X84; 0(80)(*"p62#5")P1 8.x$xX(`::3&9%5X6p9*8<`=(6 0>@'4=!=P!X#`0(4@X)6/@#*@9h3=-;:8P/h4h!8(;p$6:Xp&0. h9@, 0 @.(8,, (95$h78@58x08 #3=x"H,.P H!1H<-`1p%h<$P/(--8<+;5X`/+0h & =:0.-!0=#8+84000/3(\P,0T T4?D <O\R,*}VHh, `(lH:K(T<(¸`T3.<Rh9$t0 U!-oap0  +'bmp0 UH&sap0 A\"bap0 bts0 Pfme0 Pgfme 0 Pfme0 Aflt0 Asfue0 U</ble0 Up"ble0 U.ble0 ble0 ff20   fap0  f_p0 A< s$fle0 Ah /fle0 A bex0 A +bos0 Abag0 bdr0 Qbhe0 A4bhe0 ATfad0 p'bll0 Q[fnt0 bve0 Aftex0 fte0 A fch0 A(7fch0 < /ffo0 T fss0 tfte0  fch0  fch0 Qofch0 @gffo0 A [fan0 A +fle0$@fct0 A@fle0 \ fst0 p fch0 fme0 Ufdr0 U3"fts0 Q fma0 @bue0 bue(0 @wfze0 0?fzex0 D fze0 X_ fme0 AlSfss0 fma0 fze0 P  brt0 @  frt0 A ;fgs0 T / foc0 U foc0 A$fnd0 Dfer0 `fme0 fer0@Pber0 s for0  fsg0  for0  forp0@ fgs0  fer0 ( fle0 <fse0 POfitGd fhe0 Qx%5fss0 A$4ors0 U#1one0 A"0bme0 T!-ool0 U  +fnt0 Q +_fntx0 P 8*ofo0 Q T*{ool0  t*ool0 A )ond0  %[oab0  $bls0  "bls0 A ono0  $ors0  @ols0 X ols0 A p ols0 A oom0   ors!0 U bcs0 Q bme0 A Woab0  ond0 A <oex0  \? o_p0  p#ble0 A {o_p0  ?fal0  fnd0  fng0 A fat0 Q (fes0 A Hfat0 `fit0 A p1 bch0 A 0sfme0  /Wfg20 U . !bts0 U - +bow0 U $, ?!bts$0 Q L+  fts0 T `*  fts%@0 @ t)  f640 @ ( { f64%0 @ ' [ f320  % f640  $ f64&0  #  f64%0  "  f64&X0  ! cf320  +f32&0 $ f32%0 4 f32&0 @D f160 @T f16'H0 df160 |sf16'0 _ f16'p0 K f16'0 Qwfek0 Afat0  fsh0 fll0 @& ; f32' 0 @fnt0 U( fte0 8sfow0 ULfad0 \ foc0 Al C foc)0 |  foc0  bet0  $bal!0  %bndP0 A*b_p0 ,fid"p0 <cbn10 H[f0l0 TSf0u0 `Kf_00 l+ftr0 #fue0  fse0 @ 7 fse0 A  foc)0 A  foc0   fle0  o fle,p0 A fte0 w fne0 ( fse+0 A8 fnw0 QH# fmr0 Q\{ fnr0 Al fnr0 | bin0  bfd0@ bze0 U  *fts0 A  fns)x0 U  fon0 0g fmeH0 AL fup" 0 Ap fup0 U G bts$0 U bte0 U fon0 U fon/0 U fow0  fze0 @0 w but0 UT  fts0 Uto fts0X0 Q7 fze0 P fns0 Q fgs0 AS fay0 A fon0 A# fay0 Q<K fme(0 A\ fme.0x @ fon0 @ fol0 @ fon10 @ fol20 @ fon280 @ fol2`0 @ fon20 @ fol20 U { #bne0 U@s !bol0 Uh bls`0 @# ffo0  fss0  fss0 @ fdf0 QS fab0 A fel0 A / fet0 < fst0 AP fet0 d fet0  bes0@P for0@X for0 Abit0  bze0 U bdd0  bee0 0 [bit0 P bit50 Phfse0 Afte0 Qfnc0 POfce0 Ufup0 fee0 Afit70 Q f_n0 A(")obon0 L!)GbcsP0 Ap#fer0 U$#ber0 U ber0 A%bol0 U? bls0 Abnk0 U8  bol0 Q`%bls0 A %bct0 A gbls3x0 s#bte0 Qbnc0 @(fefH0 P@fse0 U\fup(0 Ufup0 Q[bit6H0 Qbnc0@yec0@prec0@3ed0 @hnk0 @( iec:0(@ eec08@hec*h0 UH bet0 Ah bgs0 Uwbbs0 USbbs0 fme0 Ubne0W@oec+0 UE\ fit90 Q,DZfdr0 @HCZfpe70 UdBY!fes0 UAYfes0 U ppeGX  eue0@ fch`0@( peccoff_write_armap'_bfd_archive_bsd_update_armap_timestampbsd_write_armap_bfd_compute_and_write_armap_bfd_write_archive_contentsbfd_gnu_truncate_arnamebfd_bsd_truncate_arnamebfd_dont_truncate_arnamebfd_generic_stat_arch_eltbfd_special_undocumented_glue/_bfd_archive_coff_construct_extended_name_table"_bfd_construct_extended_name_table._bfd_archive_bsd_construct_extended_name_table_bfd_slurp_extended_name_tablebfd_slurp_bsd_armap_f2bfd_slurp_armapbfd_generic_archive_p$bfd_generic_openr_next_archived_filebfd_openr_next_archived_file_bfd_generic_get_elt_at_index_bfd_get_elt_at_filepos_bfd_generic_read_ar_hdr_mag_bfd_generic_read_ar_hdr_bfd_add_bfd_to_archive_cache_bfd_look_for_bfd_in_cachebfd_set_archive_head'_bfd_create_empty_archive_element_shellbfd_get_next_mapent_bfd_generic_mkarchivebfd_arch_mach_octets_per_bytebfd_octets_per_bytebfd_printable_arch_machbfd_lookup_archbfd_get_arch_infobfd_arch_bits_per_addressbfd_arch_bits_per_byte bfd_get_mach bfd_get_archbfd_default_set_arch_machbfd_set_arch_infobfd_default_scanbfd_default_compatiblebfd_default_arch_structbfd_arch_get_compatible bfd_arch_list bfd_scan_archbfd_printable_namebfd_record_phdr"bfd_get_relocated_section_contents bfd_scan_vma_bfd_set_gp_value_bfd_get_gp_valuebfd_set_gp_sizebfd_get_gp_size bfd_get_size bfd_get_mtimebfd_set_start_addressbfd_get_sign_extend_vmabfd_get_arch_size _bfd_abort bfd_assertbfd_set_file_flags bfd_set_relocbfd_canonicalize_relocbfd_get_reloc_upper_boundbfd_get_error_handlerbfd_set_error_program_namebfd_set_error_handler_bfd_error_handler bfd_perror bfd_errmsg bfd_set_error bfd_get_error bfd_errmsgsbfd_cache_lookup_worker bfd_open_filebfd_cache_closebfd_cache_initbfd_last_cachebfd_coff_set_symbol_classcoff_sizeof_headerscoff_find_nearest_line_bfd_coff_is_local_label_namecoff_print_symbolbfd_coff_get_auxentbfd_coff_get_symentcoff_get_symbol_infocoff_bfd_make_debug_symbolcoff_make_empty_symbolcoff_get_reloc_upper_boundcoff_get_normalized_symtab_bfd_coff_free_symbols_bfd_coff_get_external_symbolscoff_get_linenocoff_write_linenumberscoff_write_symbolscoff_mangle_symbolscoff_renumber_symbolscoff_symbol_fromcoff_count_linenumbers_bfd_coff_read_internal_relocs_bfd_coff_internal_syment_namecoff_get_symtabcoff_get_symtab_upper_boundcoff_section_from_bfd_index coff_object_p_bfd_coff_read_string_tablecore_file_matches_executable_pbfd_core_file_failing_signalbfd_core_file_failing_commandbfd_format_stringbfd_set_formatbfd_check_format_matchesbfd_check_formatbfd_init _bfd_generic_verify_endian_matchbfd_generic_is_local_label_namebfd_log2!_bfd_generic_set_section_contents+_bfd_generic_get_section_contents_in_window!_bfd_generic_get_section_contents bfd_get_bits bfd_put_bits bfd_putl64 bfd_putb64 bfd_putl32bfd_getl_signed_64bfd_getb_signed_64 bfd_getl64 bfd_getb64bfd_getl_signed_32bfd_getb_signed_32 bfd_getl32 bfd_getb32 bfd_putl16 bfd_putb16bfd_getl_signed_16bfd_getb_signed_16 bfd_getl16 bfd_getb16bfd_seekbfd_stat bfd_flushbfd_tell bfd_putb32bfd_write_bigendian_4byte_int bfd_writebfd_init_windowbfd_read bfd_zmalloc bfd_realloc bfd_malloc_bfd_dummy_target$_bfd_nocore_core_file_failing_signal%_bfd_nocore_core_file_failing_command*_bfd_nocore_core_file_matches_executable_pbfd_void_bfd_n1bfd_0lbfd_0ubfd_0bfd_nullvoidptrbfd_true bfd_false bfd_release bfd_zalloc bfd_allocbfd_make_readablebfd_make_writable bfd_createbfd_close_all_done bfd_close bfd_openwbfd_openstreamr bfd_fdopenr bfd_openr_bfd_new_bfd_contained_in _bfd_new_bfd_bfd_chunksize*bfd_generic_get_relocated_section_contentsbfd_generic_gc_sectionsbfd_generic_relax_sectionbfd_get_reloc_code_namebfd_default_reloc_type_lookupbfd_reloc_type_lookup_bfd_relocate_contents_bfd_final_link_relocatebfd_install_relocationbfd_perform_relocationbfd_check_overflowbfd_get_reloc_size_bfd_strip_section_from_outputbfd_get_section_contentsbfd_set_section_contentsbfd_set_section_sizebfd_map_over_sectionsbfd_set_section_flagsbfd_make_section_anywaybfd_make_sectionbfd_make_section_old_waybfd_get_unique_section_namebfd_get_section_by_namebfd_ind_sectionbfd_ind_symbolbfd_abs_sectionbfd_abs_symbolbfd_und_sectionbfd_und_symbolbfd_com_sectionbfd_com_symbol#_bfd_stab_section_find_nearest_line!_bfd_generic_minisymbol_to_symbol_bfd_generic_read_minisymbolsbfd_symbol_infobfd_is_undefined_symclassbfd_decode_symclassbfd_print_symbol_vandfbfd_set_symtabbfd_is_local_labelbfd_search_for_targetbfd_target_listbfd_find_targetbfd_set_default_target_bfd_target_vector_entriesbfd_default_vectorbfd_target_vector_bfd_stringtab_emit_bfd_stringtab_size_bfd_stringtab_add_bfd_stringtab_free_bfd_xcoff_stringtab_init_bfd_stringtab_initbfd_hash_traversebfd_hash_allocatebfd_hash_newfuncbfd_hash_replacebfd_hash_lookupbfd_hash_table_freebfd_hash_table_initbfd_hash_table_init_n_bfd_generic_link_split_section_bfd_count_link_order_relocsbfd_new_link_order_bfd_default_link_order_bfd_generic_reloc_link_order%_bfd_generic_link_write_global_symbol _bfd_generic_link_output_symbols_bfd_generic_final_link _bfd_generic_link_add_one_symbol%_bfd_generic_link_add_archive_symbols%_bfd_generic_link_add_symbols_collect_bfd_generic_link_add_symbols#_bfd_generic_link_hash_table_create_bfd_generic_link_hash_newfuncbfd_link_add_undefbfd_link_hash_traversebfd_wrapped_link_hash_lookupbfd_link_hash_lookup_bfd_link_hash_table_init_bfd_link_hash_newfuncsymbolsrec_vecsrec_vecS3ForcedChunk binary_vec tekhex_vecihex_vec_bfd_stab_section_offset_bfd_write_stab_strings_bfd_write_section_stabs_bfd_link_section_stabsbfd_get_stab_name_bfd_dwarf2_find_nearest_linesom_vecbfd_som_attach_compilation_unitbfd_som_attach_aux_hdrbfd_som_set_symbol_type!bfd_som_set_subsection_attributesbfd_som_set_section_attributeshppa_som_gen_reloc_type reloc_queue bfd_hppa_arch hpux_core_vecarchive.o/ 996061352 0 3 100644 20704 ` 1<$P@4p4$:X:X<$BRk>k>k>k>7D7&44x7>@44x444"4"64@7?U *#7?U4@4"+`h 47?A@4+`H3`"7C>4^ B4@ HG844^@7> X@HK]( :4@7>Ⴠ"@7`!:h4C>4F"h@C>4b"JC>4^("0@+`H?!C> Ӽ!@@7>77 4@5!x74e444@4 z 4z z4x@7>"0 fh e@@ 2`H4|@@ ` 4|@4@@4`4|@4`4|@4`4|@@'`x4|@4/HDX44@7> `@HGX44^@7> (@HG844@@7>ᓀ H G444@5=7`P4|4z  z7>@4Hs g 4|K>YK>K>K>K>K>@O>k?ok?7C@k?!P7K?4@4z`ȀHxK4z7k?0Ȁ@4z (7K?@4zȀ4@4zhxK?4z4hK @K? 24@4zK?@4z44K?YK?@O?k?7K_K @KK?Y@7?k?7K_` BKWh 2KXK7K?Y@7?@4ˀK?Yk?7 KUHJK=KK3x w RX7  @@K?Y@7?k?ok? k?7CKD447?q@4w! 44@7?q * @4Y07?q@4"Z4H@4z"Hh|4Hx4zHtHs`H}k(Hyk @HuJ7!@H|K4z7!Ha؀ j4@4z H7h 4@4 HHw!P@H|K>K?K? @O?@@ ˀK>Hy@4z@hd ˀ}K>Hy@4z@hd bˀ=K>@4WˀK>ˀK>@4]@@4}@@4Hy@4zhd@4ˀuK>k?ok? k?k?k?!k?)KH7CIHd7! 7K&@4z4z@4 7444@4w!:HtJ47ӓh  4?z  4 % 6@4z  7ˀXK>ˀHK>ˀ8K>@44z@44K>K?)K?!K?K?K? @O?@@?4z@4m4zH  4HxK457  H4K7 H 4u4@4zRA4! <  4hg}4k?ok>k>k>k>k>k>k>k>KW7CJHd7"7K(@4z447?q@4w"B+`H&@7?q 7?_ :x7@4z ZHwJ @@@7?q +aH&76? 79@4z !74z@4 H  7454@4w 245z58@4w!(@@@ 4z@5H@4z4K>YK>K>K>K>K>K>K>K>@O>@@ ˀK>Yˀ}K>Y@4ˀUK>Y@44z h4  47 K5z4@ \7 ?5J `4z@h RA4! < 54hh@4zH4@4zHK4z7 7K?C4^ JC0@K&0@H4z@S 0@ @4zς]K>Yk?ok? 7C44 7?q@4w!4 !4?4@4z 4P4 @7?q 44 @7?q 44 @7?q @@4zK>47?q@4 jς@h`ς8K>ˀ(K>ˀK>@4zK>K? @O?@4ˀK>k?ok>k>k>k>k>7CKD44 7?1@4w"*4 "*4?4@4z" 4P4 @7?1!44 @7?1!47?1@4 !HgH4z7!7H@4z!7H44@4wH!@H|K47h H6z? ՋU" Hv44 J7H   @4z !@7ˀHK>Yς8K>Yˀ(K>YˀK>Y@4zK>YK>K>K>K>K>@O>ςh`ˀK>Y@44z@44z@4ˀ]K>Y@@?4z@44zH  4HxK457  H4K7 H 4u4@4zRB4B@\  4h 4k?ok? KU7C4@J44 7?a@4w4 <$24?4@4z$#74 @7?a 2 4@7?a@4 $P@HbHV4z7$07H@4zHk(HtJ(@#H4@4wH#"HsJy( ?z ?_P4_?44^C4 :C5?0^4Ӡ4 C3 88__79a C!4 :C=?0^4Ѐ4 Y C< 8879C6 :C:?B0^4@4 Y C3 8879C5 :C$?0^4 4 Y C= 8879C4 :C"?\0^4Ӏ4 Y `C: 88~=79@4zHy<H|KRX7  4K>K? @O?@@ H}K(@4zHzk@(4z@4ˀ}K>ˀmK>HwςMj(ˀEK>@4]H}k?o7#4^@4z 7K?Y4|@O?k?7"6p7?747@7K?Y@7?k?77#7787@4K?Y@7?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?YKA7F6D%47#7KIЀ !x44 I9@5:"H7@57HpӠ޿4*5| ` 5I)I3Jm55@5x "KzI?C2 6 Z55@5x8 KI4B2 I)ȉ >I9!4@5  HЀ"H4^4 !@4 @H@4 7@57HI4@5 R h ˀK>ςK>ˀK>ˀK> 5 ' IHA255Y H@ 5 @ P7?B0_6`z 60 00@065 ` 4HȈ=H4K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?k?ok> k>k>7C 7:KpƖK@7>@@@k?Ik?Q4Hg>Hk>4z@4 7`@4|@7>?4z@444|K=K>K>K> @O>4d4@4x@44tk>1 4k>!@4K>4 @44k>)K?I@48K?QK>)4D@4@G>4P@4K>4`@44t4 P6?B`0_6`z 60 00@06K>1K>!@4K> | dk?7@40ˀKK?Y@7?k?ok? k?k?K_7D 7#@4ϟxK>K4 44@7?h|@K?8ϟ48k?!4@7?h|K?K?! 78ϟ4Dk?)4@7?h|K?K?) _8ϟz4Pk?17?@4 |PK?K?1 }(H }(J }(hu(K>K?K?K? @O?k?ok? k?k?k?!K_p77DKXƿ@G4@4 7@4ܠ 74z4@4 *4 EHC2e yK>K?!K?K?K? @O?4@4xK>"46@4 6k?ok? k?k?k?!7&7E74^@4H 7G4@47h44@4zXHXC2d X7K>K?!K?K?K? @O?k?ok? k?k?k?!7'7D74^@4H 7F4@4`(74z4@44z4@44? 4\ R4? 4? 4?04 04` H` @\2f ` |K>K?!K?K?K? @O?k?o7?(a4>hdhehfhg hh(hi0hj8hk@hlHhmPhnXho`+7Dh >44&h >h >KHЁ KGIh 0+I h@I4@5+iHK4IK7 "4@5 4Iȉ?IhHJ4>4>4>47*44@4*!544@4* 0"H>@4*@H>р'44? 4x4 x@5ZH>@5ZH>64?i@54?}5@4+4??CC?C?4@C?C?͐@0c?C?ϓ0c?C?ђ0c?C?Ӓ0c?C?Ւ0c?C?ג`0c?C?ٓ0c?C?ۓ@0c?C?ݓ 0c?C?ߓ0c? 0c? 0c?0c?0`0@0 00 0 0 0`00@0 0 0 0 000`0@0 000 0 0`000@0 0C 0c C"`0c"C$@0c$C& 0C(0c(C*0c*C,0c,C.0c.C0`0c0C20c2C4@0c4C6 0c60C80c80C<0c< 0c&C: 0c:7x5Z44x@4#@H>H>4@4H>ы# *5 44@4#HЀ !+`4*4 xՂI?K44xK@4#"44@5:# 5i@ 54?455@57!545@4"  ?o5I-I *5 44@4"JI)ȉ >@ 0+`4%4?HJv47 J505@@4 H77_H4Hb?Ho`HnXHmPHlHHk@Hj8Hi0Hh(Hg HfHeHd4~@O?@@ ˀeHb?@4ˀEHb?ˀ5Hb?ˀ%Hb?ˀHb?ˀHb?ˀHb?ˀHb?ˀHb?ˀHb?ˀHb?@4'ˀHb?ˀ}Hb?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y 79x7C. k>@#A 444 444 $x74@4z$P7HЀ r"6 K@5y BHoIȃ (hK@5y?HoHkЁ`"+`4,4@5z"@I|p|šImI5z7c87 "*`:` @4@55"7IaH65z47ba U 4 KW@(K_ __ K *!" 2 J J T @5!7 Jz @ R74@4z  !614z@69    K:@!J J4@5  )  ^}5IbHV05z7 Ikȉ`=4k?Hv4z5K>J47`7@4 @@5 4z@4p4`@@4 @@5 4z@444K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>k?ok=k=k=k=k=k=k=k=k=k=k=K=Ѧ   4M7CKZHi 677>@644x@7>1 4@7>1K>Hb7.x40hN0Hu4 x7>Qj8Ht45@J0@@7>i7@5@@7>u7@57>4@57>4@47>kB?4@B?B?B?͐ 0b?B?ϒ`0b?B?ѓ0b?B?ӓ@0b?B?Փ 0b?B?ד0b?B?ّ0b?B?ۑ0b?B?ݐ@0b?B?ߐ 0b?0b?0b?0b?0`00@0 0 0 0 0@0 00000`00@0 0000@0  0 0000`00B @0B" 0B$0B&0b B(0b"B*@0b$B, 0b&B.0b(B00b*B20b,B4@0b4B6 0b6B80b.B:`0b00b20b8B<0b<0b:6x7>144x@4w#HlI5z7>!7447>!@4w"ʀ!4 4 ? RI=K6tx I) RZ7Z@ J? HaH67? 7H|K5Z7?77?44@4w!5kd5HwJ57>!77>!44@4w!b x4 I @K 7I458@4w!5  I *44w4@4 4K=YK=K=K=K=K=K=K=K=K=K=K=@O=ˀK=Yˀ}K=YˀmK=Yˀ]K=YˀMK=Yˀ=K=Yk?ok> @7C7>Q@4z"ZHK>K0B6xk044@7?AHb HX04@7?A7?K4@0@0@0 00000 0 @0  0 `0Hs407ju8Ht44J8@4z 7?A4w4@4 z4K=K> @O> 4:049@4 @7ςK=ςK=4040@4 @7ςUK=k?ok>k>k>k>k>k>k>k>K>7?67C7 5j F@5J _ 45(4 x4x@7?4^c? 5X7?q@4@47?14@747?I4p@5Y47?U@5Y47?a@47?4@47?KB?4@B?B?B?͒0b?B?ϒ`0b?B?ѓ0b?B?ӓ@0b?B?Փ 0b?B?ד0b?B?ّ`0b?B?ۑ@0b?B?ݐ@0b?B?ߐ 0b?0b?0b?0b?0`00 @0 0 0 `0 @0@0 00000`00 @0 00`0@0@0  0 0000`00B @0B" 0B$0B&`0b B(@0b"B*@0b$B, 0b&B.0b(B00b*B20b,B4@0b4B6 0b6B80b8B<0b.B:`0b00b20b:0b<6x7?44x@4w"R4z@4HjБ@ 04 z ) S K:Z Z ) U 74z@55)$5k `A?4zIKI7x IJRB4B@V@   $@ 4 I HZ@@ 7H:458@4w 5  I *44w4@4 z4K>YK>K>K>K>K>K>K>K>@O>ˀK>YˀK>YˀK>Y` ! ! __.SYMDEF __.SYMDEF/ / /SYM64/ ARFILENAMES/ // ARFILENAMES///%-d%-12ld%ld%-8o%-10ldarchive.c%-10d bfdWarning: writing archive was slow: rewriting timestamp __.SYMDEFReading archive file mod timestampWriting updated armap timestamp%d%-7o##X!XX X!`X`,X!88X!T D, X!`44P7 X!\DX!``hRX!ttlX!zUX!(%X!((X!D,DX!PpPX!@$FX! (j5X!  `WX! /X!pp%PX!u:X!0P0X!88X!844X!l(-X!(4<X!(p(@JX!LXX!Xo!X!ddX!pX!p|mX!#P@"@(SX!&&{QX!,\+3X!- -| =X 3J2<>(4h@$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$;^;'71 6 7ZZ8 ZZ17  9Ȑ8ZZ8 ZZ 87 cc67985168 78 78v662687v7179Ȑ87v6v77 5216! v6279v 7# 12 5 v6v6   v629p&6%6'6(77#952 1v66)6 28v698Ȑ86$ 6"1 98Ȑ8v679v v7# 6"125 v6v6 89Ȑ8v679V652 17.Ȑ90Ȑ90 7-6)88 7Ȑ7-6)72834 655657778189Ȑ8:83ӐӐ8418  7-6)83>Ȑ3? 7.6)8 7.6)8   #84v37 v98Ȑ9B7C8972838:9BZ8Z9pEv68Dv151 6F 7#Ȑ7GpI7 v61H6Fv77J6)7#72v6 v91H2 (7889Ȑ73 8356578:9Bv2vvv6)  6M7N 89Ȑ83.89B8D1O 89Ȑ8365Ӑ8:9B2Q6) ## ##"### ##"A#"##'%'(0 (D0 QT[l0 0 A0 A0 Q A,LX0 d0 A "20 A( +D Td t 0 A 0 A /0 A s0   ,  <T d c| #@0  0 0  A$S40 U@0 Ut0 U Q ,8D0 APs0 At0 P0 Pg0 P0 0 A,"P`x0 U&0  +  $ 0 U0!-H!archive.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01._bfd_generic_mkarchive bfd_zallocbfd_get_next_mapent bfd_set_error'_bfd_create_empty_archive_element_shell_bfd_new_bfd_contained_inbfd_set_archive_head_bfd_look_for_bfd_in_cache_bfd_add_bfd_to_archive_cacheget_extended_arelt_filenameerrnostrtol_bfd_generic_read_ar_hdr_bfd_generic_read_ar_hdr_magbfd_read bfd_get_errorC$47strncmpmemchr __SB_masks_isdigitatoimemcpy_bfd_get_elt_at_fileposbfd_seek $$dyncall bfd_releasebfd_tell_bfd_generic_get_elt_at_indexbfd_openr_next_archived_file$bfd_generic_openr_next_archived_filebfd_generic_archive_pbfd_check_format bfd_closedo_slurp_bsd_armap bfd_allocdo_slurp_coff_armap bfd_getb32 L$plab_start bfd_get_arch bfd_getl32strlenbfd_slurp_armapbfd_slurp_bsd_armap_f2_bfd_slurp_extended_name_table normalizestrrchr._bfd_archive_bsd_construct_extended_name_table"_bfd_construct_extended_name_table/_bfd_archive_coff_construct_extended_name_tablestrcpysprintfbfd_ar_hdr_from_filesystemtimegetuidgetgidstatmemsetstrncpybfd_special_undocumented_gluebfd_generic_stat_arch_eltbfd_dont_truncate_arnamebfd_bsd_truncate_arname _bfd_abortbfd_gnu_truncate_arname_bfd_write_archive_contents bfd_write_bfd_compute_and_write_armap dcgettext_bfd_error_handler bfd_mallocstrcmpfreebfd_und_section bfd_reallocbsd_write_armap'_bfd_archive_bsd_update_armap_timestamp bfd_flushbfd_statperrorcoff_write_armapbfd_write_bigendian_4byte_intarchures.o/ 996061357 0 3 100644 5248 ` 1 @l  H = G!K_@K0k?ok?+`4?K pk?7` BHvPK?4z7 2HcX`?HvP `?444|K?YK?@O?k?o+`4#Hw H44x @JX?7?77@ 0ˀrH X74x *K06KX?@?7K?Y@O?k?7K\K K97<K?Y@7?K7?K?YKH77K?Y@kYk?7+`47J r6 JK= "K   K@ rKX?@?6+`45kU@4K?Y4@7?k_K?Y4@7?K_@KK_@K K_@KK_@KK_K77\ (ˀ*K K7 @ 7<@k?ok?k?k?7C7$KY(@4 @Hy@ #@Hy0@4"@Hz0@4t 7@Hz(Hy(74@7 @@ 4t"x Hy0@7Z"B h@Hy0 %4@4 0@Hb0E 4@ "@ hHw(Bҙ J8 B4@ 6By ?@0t4@!XH|@@@ r+`H?  \   6?!P4 <? #7444 !  HZW_7XˀhK?YςXK?YςHK?Yς8K?Y@Hy0=@ׂ4K?YK?K?K?@O?+`H?>]4 U@@+`H?@@ @@@p@@h48@@0@@0@848@4@@@@@@@48x48H@@@4@Hw̢4̦4̨4̪4̬x4̮h4̰X4̲H4̴84̶(4̸4Hw4pHw jˀK?Y4@4(4Z4`4z4Hs e(4=K?Y@K\+`4?K r7 JK "K 8 J K@ 2KX?@?74@k?7@@0#K?Y K02@7@7?k?7@k?k?@K?K?@7K?Y@7?k?7@@ 2KR_7K?Y@7?K?Y4@7?V}   1    FpP unknownUNKNOWN! X!  X!p p, X!|8X!LLD0X!dPB X!l\MX!x  hd X!  to X!  z X!   X!0(0 X!X=X 0X!, X!T4TX!44X!<44 X!p@@ >(40@00 >(d@0:$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$CODE$$CODE$$CODE$$CODE$$CODE$$DATA$ $SHORTDATA$;^;$PPv7 PP 6 v7PPWW1  77686gg  gggg30#PP7Ȋ6677% '' % ,@00 <0 T h0 x0 A0@0 A +0 A [  0 @g0 Q,oL0 `0 t0 0    0     ( 0 8 /0 AP70 Ad0 0 A./archures.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. SD$archuresbfd_printable_name bfd_scan_arch $$dyncall bfd_arch_list bfd_mallocbfd_arch_get_compatiblebfd_default_arch_structbfd_default_compatiblebfd_default_scanC$83bfd_set_arch_infobfd_default_set_arch_mach bfd_set_error bfd_get_arch bfd_get_machbfd_arch_bits_per_bytebfd_arch_bits_per_addressS$91$bfd_default_scan strcasecmpstrchrstrlen strncasecmp __SB_masks_isdigitbfd_get_arch_infobfd_lookup_archbfd_printable_arch_machbfd_octets_per_bytebfd_arch_mach_octets_per_byte bfd_hppa_archbfd.o/ 996061363 0 3 100644 7472 ` 180@  843\0\G!+`@H<+`@h:k?7B j@ 4$ h4$+`4?# 7@4 K?Y@7?+`@H:K?Yk?o@7C ` @x @@@7+`#4:@77@4xK?Y@O?@4zK?Y@@@7+`"4:@6@7uK?Yk?7+`k?)H8+`4?@k?1k?!k? 0k?9# 79@7(K?9#7 @7K?9K?@7?9#@7Y0@K?K?Y@7?+`H<@h:+`@h:+`@H<k?7K_` @4ϟ(K?YKWJ@7K?Y@7?k?7K_` @4ϟ(K?YK]KH7K?Y@7?k8p@k7xk?7K_` h@K_h 0bkYpKWJ Y jK?Y4@7?@4ˀ K?Y@4K?Y4@7?@4ˀK?Yk?7#k?74 k?@7@+`H6K?7K?7K?Y@7?k?ok? k? `4k?)7k?1 xk?!4y4 @7+`H6K?)4%K?1747hK?!4y4 @7+`H6K?)4%K?177K?!4yP@4 H77@4K>K?K? @O?k?7K_K *KK@C<K?Y@7?@4ϟK?Yk?7K_K *KC`<K?Y@7?@4ϟK?YkY@4k?oKWH 7CH|PK>Y@O>+`H? K@4z7@@7>@7 ˀuK>YK? hPMK? k?7K_pƟ"KWJK>Y@7>+`H? K@@7@@7>@7 ˀuK>Y]K>K_` KWJ  "@4KY@K<(KX@KK_` JKWJ KZ@kY(0 KX0 k@K_` KWJ  "@4KY@K< KX@KK_` JKWJ KZ@kY 0 KX0 k@k?7@@K?Y@7?k?7K "K J07_@7_K?k?KK?k?Kp7K?Y@7?k?ok? k?k?k?!k?)K\7C7'K7* H64K>K?)K?!K?K?K? @O?K>y4? 78@4z 7ˀ}K> @   K>  K> K> h(K>v  ` K>q @40HeHx 4xKK`?@ςmNo errorSystem call errorInvalid bfd targetFile in wrong formatInvalid operationMemory exhaustedNo symbolsArchive has no index; run ranlib to add oneNo more archived filesMalformed archiveFile format not recognizedFile format is ambiguousSection has no contentsNonrepresentable section on outputSymbol needs debug section which does not existBad valueFile truncatedFile too big#bfd%s %s: %s %s: BFD: bfd assertion fail %s:%dBFD internal error, aborting at %s line %d in %s BFD internal error, aborting at %s line %d Please report this bug. (@Xp8PxX!  X! ,X!XX8X!pD7,X!Pc#X! \X!  hX!(  tX!4<<X!p<<X! ,  X!8X!8LLX!2X!X<<AX!<<QX! P a X!t\tlX!PllX!8<8X!4t4 X!(88X!`44( X!4X!T0T@X!LX  NX >( \L@Ld>( @P p>(P@`$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$ $SHORTDATA$ $SHORTBSS$;^;'PPPPRR8 W6W56\\9 1 \\8 QQ\\8 7 8```QQ``1v71v91ȃ8 ``v3ȃ8 ``v4``v3`v11 1 1p 6!6"7#p 6!6"7#8*v97182 ###### # "####:9## ##" ####1 "#%' $@X 0@`0<@ L0 X0 l0 0 s T 0 @P0 80 T0 t0 A 0 U 0 T /0 A ;0 @ 0 P ( 0 40 L0 AhS0 _0 0 ?0 @w0 0 @40 QL`l|0 U30 Ubfd.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.SD$bfdSB$bfd bfd_errmsgsC$41 bfd_get_error bfd_set_error bfd_errmsgerrno xstrerror dcgettext bfd_perrorperror__iobfprintf_bfd_default_error_handlervfprintf_bfd_error_handlerbfd_set_error_handlerbfd_set_error_program_namebfd_get_error_handlerbfd_get_reloc_upper_bound $$dyncallbfd_canonicalize_reloc bfd_set_relocbfd_set_file_flags bfd_assert _bfd_abortxexitbfd_get_arch_sizebfd_get_sign_extend_vmabfd_set_start_address bfd_get_mtimebfd_last_cachebfd_cache_lookup_workerfilenofstat bfd_get_sizebfd_get_gp_sizebfd_set_gp_size_bfd_get_gp_value_bfd_set_gp_value bfd_scan_vmastrtoul __SB_masks _isxdigit_isdigit_islower"bfd_get_relocated_section_contentsbfd_record_phdr bfd_allocmemcpycache.o/ 996061367 0 3 100644 3060 ` 1 @< << hG!+`H? kZ08kZ(k_0H7J(k_(k0KX0k(@h:K_0KW(+`j0KX(KY0k8(H3S K]0h= 8h @k?o+`H? "44K?Y@O?K(Hx * h@Hc(Hw?@`?4@Hzh|8@4zeK?Y`M4k?ok?7D@KZ b4@4 +`H?7?h74|K?YK?@O?@44k?oKX7C +`H?` @@@ @@4z+`H76h9K?Y4@O?#@7Z@4M+`ˀK?Yk?7K_ 2KWpƗ@"@@K?Y@7?ςK?Yk?o4A+`H5`7C@@!"Hh7?  "Hz@6x |@7>ш "K> @@Hz# Hz@790 |4hx@H| @@4z @H|K>Y@O>ˀK>YH@? Hz"`@6y ?] |#Hz@70- |ˀeK>Yk?oKXp7CƘ@H 7Hy R+`H7w @4z@4zH|K?Y@O?@4z x@HzHy8@4?@ˀK?Y#47@4HˀMK?Ycache.crr+w+  X!<< X!8<8,X!xtx8%X!l``D=X!|L|PY#X!H44\|X!|h2X!t#X ,>(<@>(P@$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$ $SHORTBSS$;^;'RRRRRRRRRR 6661PPP1PP51PPP2 P6PP5776Պ6 Ԋӊ RR116 83 ### ( @ 8GD  X? dwt 0 O 0 0 (0 4P`cache.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.SB$cacheinsertbfd_last_cachesnip close_oneftellbfd_cache_deletefclose bfd_set_errorbfd_cache_initC$39 bfd_assertbfd_cache_close bfd_open_filefopenstatunlinkbfd_cache_lookup_worker _bfd_abortfseekcoffgen.o/ 996061384 0 3 100644 21556 ` 1A$T4@808)?? A$FIAHxLtAHG!Lk?ok? k?k?k?!K]7D7#KJt74!@g4^!4y4@7?qc?7?7?q@4K?C70`@@4 @ @k?17@4 7K?1@4`4 J4@4 x744@4y 4@4 h7ˀ(K>ˀK>׀4K>K?!K?K?K? @O?Hxh044H}h84xHs hHHt(hHu0hHv@hxHKJ7Hy8h44yH|Hh44h hHH"HV7h ӀޟhHv@ H ֿ_h Ha( H ן? h ς5K>k?ok>k>k>k>k>k>k>k>7D,7CKEpKF7$`6D,BD,Ǻ²D,ǙD,BH ht4z4H ` Hap?` hap K huHv0h`JJ7"@7H|K7>7`&4zK `'8G'F@5y!745Z5x@4w|!HvJ4z4K7!Z 44 HsJw j 7?9J4z747?94z@4 i 俇HsH|4MhpHjp_?=hjpHip?_-hipHhphhpHbp_ hbpˀ8K>Y4z@5hep4hfK>YK>K>K>K>K>K>K>K>@O>k?ok;k;KB7CHYK=Xk;K%P@4"7444@4w!HuJ4z4J7;74z@4HaH84z7;K7!zG=G< k;K;@4z!X7G=44@4wG=!*HtJ7=)4zK47G= )4K;4z@7;K;YK;K;@O;@@ ˀK;YˀK;Y@4@@4ˀmK;Yˀ]K;YˀMK;Y? `K\ j= z *KЃ (@K?@+`4<@+`@4<+`@4<+`@4<k?oKW7CJK70ϟHx7 K?Y@O?k?ok?KX7C7$KJ70ϟHvHb6? HWP7? 6H4?_7?`Z  6H45H 6H4 6wH4  H|K?YK?@O?k?ok?K77#7_ 7Hw z`KK @@7 @Hz \ 4K?YK?@O?44y@4 k?# 7:@4 %K?Ȁm4k?/,ok?k?!k?)k?1k?9k?Ak?Ik?Qk?YK?7$7FK>764 4K #2HHV6xJx `&` 4x%7?9G%!D@ ! 7Hx!5 H4@4!@Hx5:5Y@44x'@7?Hx9G&DK?YK?QK?IK?AK?9K?1K?)K?!K?O?@/0,K>` y}4|Hx@4zM4|H% k?7KX7]KW H4 JJ?? 7K?Y@7? *J!0@J?@?KK5JJ@ H K:8 K= K KXJa467jvKS J7Z K= KX7K6k@@?7Z?67k?#7k?4k?@k?K?K?K?mK?K?K7<J  K04@ˀ@k?ok?K? 7$7K @Hߟ+`49?  `X `!KXK aXH JPH   KBHW h@@w$H 4( `JXXK8 `XH sH }K?YK?@O?K0 ht#7@44? yXH} zk?ok? k?k?k?!k?)k?1k?9KE7(4KG7D @440ˀzh"h4+`4?4a4? K]ƽ@2KS  2Jj @"}@  779 K]ƽ@8@KS  2Ju @"}@  779 K]ƽ@8@KS  2Jt @"}@  779 K]ƽ@@@KS  8@Js @"}@  7^=797 K]ƽ@2KS  2Jv @"}@  779"`4+`4?4a4? K]ƽ@BKS  2Ji @}@  779 K]ƽ@H@KS  2Jb @}@  779 K]ƽ@H@KS  2Ja @}@  779 K]ƽ@H@KS  2Jv @}@  7^E797 K]ƽ@BKS  2Ja @}@  779H |R]7ӵ !4P4?+`4747@Jtƴ@ Ju "7?_7ZaZ 487KUƵ@2KH 8: 879KTƴ@2KG 8: 879KSƳ@2KB 8: 879K]ƽ@"KA 7 :779~7 H4!24  @4  kG( 7K*0 A_4? 2 05F75X@4AW66`P45WAV6674c6@@4c4>  H 4K>K?9K?1K?)K?!K?K?K? @O?k?ok? k?k?k?!K_7C"xKD @4z"87H0" @@*H @׀ Jh @ǙHwJ74 &'7?Q4?H KX4zK8G'F w @h h HǕj4@6a 4H<*@ JV0@J  Jj ҠҠJҠ ҠҠ@67~6@=4K>K?!K?K?K? @O?"6@4m4k?ok? k?k?k?!k?)k?1k?9K(7'7F7 6!@5H @5@w44Ί 7@u6A2HI?K$HI4y4K7$@K>HIHTЈ (J#7@@4 @4k?A! H47?K`5:5Y7k?HIWJ "JH `4= }H7S HI34zPJx"HJfĢHh`P64hgXH9 H 47?Kx5:5Y7k?K>45XI@H :k?H E 4I@H ""46@4K?A4@4!H `  %  fHZ  K>K?9K?1K?)K?!K?K?K? @O?"604z@4H5@4]K>5@4-@ H4z@4K>H `74 fH  "46@4 -Hk?ok>k>k>k>k>k>k>k>G047k>C47G7$C6 6HhHǘ@H +`4)5"4?d(K>k?44K> k?4@K>HJa4H)h@59"7HJ44K 5X745Z58@4"4@5Y@6a2HK4Kp@59"@7@6 4 k?Hk f k?J7P4k?K>5K745Z58@4!@@65kGk?4@5YHfh(44Hb"  gK>YK>K>K>K>K>K>K>K>@O>H +`4"_ 4?d(+`4* _(KX _(K: _8d( _(d(K>ˀ K>YˀK>YˀK>YˀK>Yk?ok? k?+`7#g?i7D6g?eK? k?!48!g?aHzk?YǔA(@KXJtg?aHx KPH} = k?YHJ "Hw JXK0 k?Y4@4y @KH"pg?eg?iHj4c?mK Htg?aHyk?Y# 78Pς x2HJ 4c?m4c?mk?K>44yk?K>7?9k?K?!@c?oK>K?K? @O?k?7K387`!K80K4@!zK< K !bKbC6 K6 JX Jȓ k`4}4 b6sK5 JX7J0JP h`V a?6s4k3@KV7?!}J6$@K5 JXK&a8G&iFi kk?K>7k?K>@k?K>@7?k?ok>k>k>k>k>k>k>k>KD7Ck? k>k>k>KFHI jHe Z@HK>7 Y <k>H?@HaH94@4z$zk? Hf 47>7> 4z@59 7K"0$(k?7? 7>k?4z@59#4m4HsK? ju(K>%HvJ77?A77?A44@4w#HeHH x@He b@H27H44@4w#H?@Hf!(44! @I:74z@59 7Iw0"HtJH704(@HsJ|K04_8@I:5I458@4w"44K> K> K`xx@_W 4d?Jx@֟x@6??  7:? ]C(C(4?=BKH "6@4 >4K>YK>K>K>K>K>K>K>K>@O>ˀK>YˀK>Y7? 7>k?@4z;4ˀMK>Yˀ=K>Yˀ-K>YHxK64zK7 }@I0C4'=?HsC6]'HsH}KJ "5044 @4wHzKUJˀ-K>YHuJ47?77?4w4@4<@ˀK>Y"46@4 >E@k?ok? k?k?k?!k?)KE7CHH@4"7Hf"P@H""HHg4@4z"x@H!4K< KX&!K:KVJ7!p744@7?k?I4z7?k?Ht4JJ(7444@4w!p@I 5k? 4z7?k?H}4KJv(7444@4w @ ?]5  >-4H=@4z@44K>K?)K?!K?K?K? @O?ˀK>ˀK>ˀK>ˀK>@K<8k?ok? k?k?k?!KT7G7#JJK>G0 0C4k?44y7!R0!B4΃%!2HK@x@KH ם (02 04Ȁ 4ʈ ZH(P@׿?P`# P_h(HP@_C _ߓP P`K>K?!K?K?K? @O?k?ok? k?k? `4y@@k?!!h7@(:Ap@HHK?!@@!x7@K?!k?)H4@K?! @@(8A(@HHK?!4@4@(?A7HH (@K?!K?)@4 44K>K?K?K? @O?@4Ƞ444z@4 K?!m4Ƞm444z@4 "K?!44z@4 @k?ok?k?7$@(4  4c_@@4y 8744K?YK?K?@O?44@4x k?ok? k?K_7CKp! H}K6wh7(&'@7?A8G&F@42D HyK94@4z 444@4w ZHvjp4K>K?K? @O?ςK>ˀK>ـ @@4ˀK>k?ok? k?KW7CJ!J!JH}K6yh6('@' 7?A44z8G&F@  447?@4w!@@@4 4@42EȠ4?k?)44@4wK?)!2H0k@4 Ƞ4Ԡ44K>K?K? @O?HdH7?77@"6`6p@4 +`H6Hy747@4Ƞ4@4Ƞ4k?oK_7CKp@ 0@Kx @@HxkpHK@ *K @@Hyk K?Y4@O?k?ok>k>k>k>k>k>k>k>k>k>k>K_7D4K '4K(4@42C%HIK(4@Ջ%x HI`(@4(K hI7hHKp9 '@4?45k8 8 k8 8 k8 8 k8 8 k8 8 k8( 8 k80 8 k88 8 _u79@7(&7?4k8G&F L:HJ}5x4K5Y7A64  5nk?H5k@5yk?K I 4k?J5YE0A47k?544y@5A65Gk? I 5k@H4k@4"€g4i+`4*4 A"4K jA?6`ZI4P" @4"X7I-XA,6  .I?"5,  47  7 z7 @ b7  J7  27  7  774@5!745@55?5@5 -A,6x K594Jv7! @@4!H7I8A,6   :` 4|`4|`4|`4|@JHK 2  59P@4 <PA,6HH459P4@J <A,6`@4|I9 >oH *A,644|K>YK>K>K>K>K>K>K>K>K>K>K>@O> @@47I7  =A,6l i 6@'A"4Hi iRI5)>HJ(9E->4|#@7Z@4v4|k?7K_` *K7x6K?Y @7?@4K?Y4?@7?k?ok?7C@4H 0744K?YK?@O?44H@4h h0h8h@ k?ok?7C@4H 0744K?YK?@O?4@4z h0Ȁ4h8+`4?h 4 h@] k?ok?k?7D7%7:7@7H0 JC:HK K RS6s>uE uK?YK?K?@O?k?ok?7D@7 K0 KKhzK hwK(hxK0hyh} K0B2HHS xRA4!>?E 4K?YK?@O?@4ˀK?Yk?ok?k?7D7@6!K0!C6A KPKXh}K`hwKhhxKphyKxhz hs(CH8:HK H| RB4B>\E |CHW:HKT Ha RE4>СE aCHe:HK" H_RX7>E }4K?YK?K?@O?@4ˀK?Yk?ok>k>k>k>k>k>k>k>k>k>7E7k> :# HxK>@4K>YHf0%HK RK5k> Hg8K>xE@4@ H RL5>џEk?Hw44 k?yD0k?@4k?@6k?D(ҸK>@D,@6 !4 i f AsHIlP3 5m@ RA4!>,Ek?K>4p@k?HK45K>K47 @@4_!ڇ!"k?ExX4K>@Ew\AlHL:Iah RT6>K>ҘE@4@65) i#HH84@K>H#4Ht J04 K>@  ?40K>YHw0+` 48Hv8048 470 K>047@@4K>YK>@4@6D0 Em\k?4K>IxP@EwXIx` "Euh Avl>@6A|lk?4K>@Ewh@6HJ@x@D0JmH =k?4`40@4 AbHIhB 7 RZ7Z>_Ek?Iv`5k?IwX@K>@67:@4yH}k?+` @Hz8Hg0@ 4?p@04?k?Hs 47PJxK>047`4Y0@@K>YK>K>K>K>K>K>K>K>K>K>@O>C?0\4C704@k?ok>k>k>k>k>k>k>k>k>k>k>k>K>7>7Ek?K>7$7 k?K> 76k?H534k?y@k?#JK>#Jk?H64k?y45Xk?4wk?@k?"   HH? "ʁ "I+ `"I6(ז K4Al4 0@Am65N K j@K2I}H04?4 I? Aa65y@  OrE(ӹ`@4 :A4l!A66 꿟E(I? 4H4 #*H4 "pK K K0"`KC"675@  G (K`7C67@! 4 `74XC6 G X HˀK>YςxK>YςhK>YˀXK>YˀHK>Yˀ8K>YI? 5OOJI : ڠ(@Iz I I?  RW6>Ix E @* jA|4=Aa6H؃=4K(=4K bo4K0 K8UH8@ I 7? H5(57 (0"    *H航 4@4Ph؀ "k k(Hk0k84K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>7KSJwГ 0JXJP  067X'6`' 7?8G&F @7?k?ok? k?k?k?!7F7%@7 7H0!4@@4 744@@4d0+`47`4H Jd(Hh @4ˀK>ˀK>K d(Hh KXJtd(H KPH  h HJ0H 0KX0H"0 0h HKpd,hd0@c44K>K?!K?K?K? @O?coffgen.cstrange.file.debugbfd%s: bad string table size %lu%scoff %s %s[%3ld](sec %2d)(fl 0x%02x)(ty %3x)(scl %3d) (nx %d) 0x%08lx %s File AUX scnlen 0x%lx nreloc %d nlnno %d checksum 0x%lx assoc %d comdat %dAUX tagndx %ld ttlsiz 0x%lx lnnos %ld next %ldAUX lnno %d size 0x%x tagndx %ld endndx %ld %s : %4d : 0x%lx %-5s %s %s %sngl ngl '' (X!  80X!0 0D0%X!|<|PU3X!8\\\X!@@hX!TtX! X!000+X! ` X! |0 0X! ,+X!  C"X!TeX!lGX!`P`3X!0\\X! X!"NX!p*X! P X! X(X!!tD D4.X!"x"8x@X!#0"LX!$p#pX8X!%ph$hdIX!%%XpYOX!*X@)@|X!*`*`X!*x*xxX!+pl*lX!++\X!,t + X!--dX!1d 0 } X!11X!54P4P X!5858X 6]6@>(8@D W!>(( @$TEXT$ $PRIVATE$$THREAD_SPECIFIC$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$$TBSS$;^;'88667787 v3 v9  ,v8 79 v7 v3 82 H 79 v3 2 v7 79 v3 9 51 ccbbccbbv6 v6 $6 8ȗ2*!689 v3 178*ȗ2  cc!27ccLccScc=73  771ȗ2ȗ6v7 7$6%v2 "v9&3'88  bb 4#7v8 9)2 v9 bbcccc79(<9( 6 8 7 9* v2 9)6ȗ72 9+ v7 9) v2 3' 7 8 v7 8. v8 9)v 2 v9 3ȗ7$76%89  13' 7 8689 189 561 v6 ȗ84p5v3 111 763PP*v3 v4 40 66p86%78.8v7 682612 178.77bb2=71771 ȗ8Aӗ 9A7Av9 ֗p8ӗԗ7A 84 2Bp8ӗ  9E 9F)7y7778.cc1+ # ###"## #8###""#.# #"# ##### ((@ Q8Xd0 p# ! U0 (?<P0 Ad0 0 AW0 Q &6@0 U DTdp0  0 A  P /0 A 0   T o 8 H h  UxS U U0 0 0 A T0 H  Q`";0 p"0 $0 %[ '@0 A)0 $*0 Q@*{0 P`*|0 Q+_0 U +0 T!-!!0 A"00 U$#1@#h#0 A$40 Q%5coffgen.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. TBS$coffgenmake_a_section_from_filememcpystrtol_bfd_coff_read_string_tablestrlen bfd_allocstrcpystrncpybfd_make_section_anyway $$dyncallcoff_real_object_pbfd_read bfd_release coff_object_p bfd_get_error bfd_set_errorcoff_section_from_bfd_indexbfd_abs_sectionbfd_und_sectioncoff_get_symtab_upper_boundcoff_get_symtab_bfd_coff_internal_syment_nameC$40 bfd_assert_bfd_coff_read_internal_relocs bfd_mallocbfd_seekfree bfd_zalloccoff_count_linenumberscoff_symbol_fromfixup_symbol_valuecoff_renumber_symbolscoff_mangle_symbolscoff_fix_symbol_namebfd_get_section_by_namebfd_tellbfd_set_section_contents _bfd_abortcoff_write_symbol bfd_writecoff_write_alien_symbolcoff_write_native_symbolcoff_write_symbolscoff_write_linenumbersmemsetcoff_get_linenocoff_pointerize_auxbuild_debug_section copy_name_bfd_coff_get_external_symbols dcgettext_bfd_error_handler_bfd_coff_free_symbolscoff_get_normalized_symtabM$39coff_get_reloc_upper_boundcoff_make_empty_symbolcoff_bfd_make_debug_symbolcoff_get_symbol_infobfd_symbol_infobfd_coff_get_symentbfd_coff_get_auxentcoff_print_symbolfprintfbfd_print_symbol_vandf_bfd_coff_is_local_label_namecoff_find_nearest_line#_bfd_stab_section_find_nearest_line_bfd_dwarf2_find_nearest_linecoff_sizeof_headersbfd_coff_set_symbol_classcorefile.o/ 996061388 0 3 100644 1204 ` 1<@<@<`8`G!gk?7K_` @4ˀ(K?YKWJ7K?Y@7?k?7K_` @4ˀ(K?YKWJ7K?Y@7?k?7K_` BK7` 2KXK7K?Y@7?@4ˀK?YX!<< X!<<<,X!DxD8$$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$;^;(1v61v6v710 ,P d0 t?0 A{corefile.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.bfd_core_file_failing_command bfd_set_error $$dyncallbfd_core_file_failing_signalcore_file_matches_executable_pformat.o/ 996061392 0 3 100644 2620 ` 1 <@XXG!wk?7@4K?Y@7?k?ok? k?k?k?!k?)k?1k?9k?Ak?IK_h7D7)74 #H`ppb#H H4+`H<7@ #7  fh`H  444@4#ZHH`64} 7#(7$ +`46#0@+`H7J!@+`4)+`4*64?!b 44@4"@@4HH`774 7 ` K` ` IX74 5` K` ` 4  @4ςK>@@!@ `>}5k?@ !h`@4 @@4ˀ K>@44K>K?IK?AK?9K?1K?)K?!K?K?K? @O? ?84K>ˀ}K>ˀmK>ـ  @4ς=K>  h`@4@4ˀK>ˀK>  0h`@@ @@4ˀK>@4?k?oK_h 0P7CH`pp* R ?84K?Y@O?@4K?Y4@O?hy`Hw64z 70h``K?Y@O?@p@p2FF jBJB *# @7<@#@@7\#@7"@6 #@70invalidobjectarchivecoreunknownX! X!,IX!8WX!XXDlX l$(P$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$LIT$;^;)8 SS6 8v6XXYYXXZ1vZ 15  1v6Ȏ# #0 A(0 Q@`t 0 A$0 8 Pformat.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.bfd_check_formatbfd_check_format_matches bfd_set_error_bfd_target_vector_entries bfd_mallocbfd_seek $$dyncallfree binary_vecbfd_target_vectorbfd_default_vector bfd_get_errorbfd_set_formatbfd_format_stringC$39init.o/ 996061395 0 3 100644 660 ` 1@(L@ `4@G!.@X! $TEXT$ $PRIVATE$$CODE$;^;*0 (init.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.bfd_initlibbfd.o/ 996061402 0 3 100644 10928 ` 1*@$l3ddG~$G!k?7@4K?Y4@7?@4k?7@4K?Y4@7?@4@4@4k?7@4K?Y4?@7?@k?7@4K?Y4@7?k?7@4K?Y4@7?k?7@4K?Y4@7?k?7@4K?Y4@7?k?o@7C2_` K?Y7@O?k?@4 K?k?7 @7:@@@7 @K?Y7@7?k?@4 K?k?ok?@7D (7` B44z@44|K?YK?@O?@4 4|k?7 0"@@K?Y@7?ˀK?Yk?ok? k?Jp6ƕk?Q7?AYHeXH8H'A'I8G'QFQ w*  4$@4 HHv8 4@K?QHb8D he84K>K?K? @O?7?A+`H?''8G'F k?YK@4z7K?QK?Y@4`7H|8 ha8K?Y>4+`H? K@4zG_4 @@}4@@@@k?ok? k?6Jpk?A7?AYX'AƗ@'I+`8GH?7?A'F!KK?A4@4`7Hu8 hv8 *+`48ph4@44K>K?K? @O?8G7?A'1FHeHx8H1  Z 76 ?@*@H  Ȁ- HHs8 4@K?AHa8$ hb8@4zEK?Ak?7k?7:@7?K?7?4@4 @K?Y@7?#47@4K?Yk?oKXpƘ7CH|8+`H? K@4z7@@H Hwx  4<h|8K?Y@O?k?7K_pޟˀJ+`H? K@@7@@K?Y@7?k?7KXp7_Ƙ@`k?+`H7 J @44?K?Y7@7?k?"46@4eK?@77@?e@@@K?@7E7k?@4K?k?ok?k?k?77C 7$!20!RHypƙARHt` *Hu0 H}8"2+`H?"*K (4H Hwx @4"7+`H$@4z4,!@@4+`h$"6@42Hyp4 Hfhd8(HHs8 d ha84?HHxh  r 67 `j@H P  @4 ߀4hw8@4 ߀444@4z\@@4 @4 Hz8 Dhd8 h|84K?YK?K?K?@O?C_CW @ \C_CW @ \C_CW_  Y @ C_CW_  Y @ :_@?:_@?CTCY ׹ C_CW Sֿ  V@ \C]CX= ֘ CWC_ 7Z Sֿ @ \CTCY ׹ C_CW S  A \֢ @ C]CX= ָ CWC_ 7Z Sן  Vւ @ k?7#7@4,K?Y4@7?k?7#7@4ZK?Y4@7?k?7#7@4K?Y4@7?k?7#7@4K?Y4@7?:X_8W?@7:X_8W?@7k?7#7@4 K?Y@7?k?7#7@4 4K?Y@7?k?7R\7׀ 77]@!7?RA4!8Ax4P7?3 XT6? ӽ_7Z(a  XS4S? 7S xz4:?ӽ Ӻ6} 7? z7 x}6?Z ]9~6zK?Y@7?k?"4k?64 Rk?@k?K?K?K?K?k?7R\7׀ 7=7_ !7RU6Ҹ4A4P7?=0 XS4S? ֜  t\_7Z(a 0 X]4=? ֜ 7Z0 XS7? 4]} 7Z ] X0VS6? ׽ 7Z ] X0US6? ]  \9~7ZK?Y@7?k?"4k?64 @k?K?K?K?k?oK?k?` k?K?Hw K94@ 7  K?K?4@4x `@K?Y4@O?K?Y4@O?@4ˀK?YˀK?Yk?7#47@4 "K?Y@7?k?oK?k?` xk?K?4@  ZK?K?4@4x *4K?Y@O?ςK?YˀK?Y_ 4?7@KWB004\C9 84@k?oK77CKXKJ  K?Y4@O?"060 66 @4 +`H6Hy77@4ˀeK?Ylibbfd.cbfd%s: compiled for a big endian system and target is little endian%s: compiled for a little endian system and target is big endian3X!  X! , X! ( 8X!HD' X!PP2 X!X\= X! ` hHX!tV X! aX!$ oX!D }X!d X!<<X!T@TX!TTX!h00X!XX&X!p X!88%X!8\\AX!ll[X!HHpX!H('X!t4/X!H@ X!\L X! p X X!   d X! 0p X! @| X! P,, X! |,,( X! 8 (83 X! 8 `8> X! ( (IX! @( (ZX! h( (kX! ( (|X! 8  X! X  X! $ x$X! $ $ X! @< <X! |@ @$X! <0X!H( (< X!pd dHX!TT1 X!$p$`< X!lG"X xi$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$;^;$111111161671681918 gg 69gg gg9ll178629ȟ3 gg66" gg66$gg13 66&7'1gg8*ll6!1ll2)76    ȟ2)ȟ2)ȟ2)ȟ2)ȟ2)ȟ2)@ȟ3 Cȟ3  8(91ȟ3 8(9 ȟ8DpEv2F1#"@#0 (80 L#0 \+0 pK0 |S0 [0 c0 0 A0  0  0 8 0 P ` 0 Al C| 0  U0 U0  s0 U 0<0 @H0 @l& ; |20 0 0 A0 Qw0 $K0 4_0 Ds0 \0 @t0 @0 0 0  +0 ! c0 " 0 # 0 $ 0 % 0 @4' [0 @D( {0 @T) 0 Td* 0 Qx+ 0 U, ?0 U- 0 U. 0  /W0 A0s0 A@1h1x1 1libbfd.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. bfd_false bfd_set_errorbfd_truebfd_nullvoidptrbfd_0bfd_0ubfd_0l_bfd_n1bfd_void*_bfd_nocore_core_file_matches_executable_p%_bfd_nocore_core_file_failing_command$_bfd_nocore_core_file_failing_signal_bfd_dummy_target bfd_mallocmalloc bfd_reallocrealloc bfd_zmallocmemset real_readfreadbfd_readmemcpybfd_last_cachebfd_cache_lookup_workerbfd_init_window bfd_writefwriteerrnobfd_write_bigendian_4byte_int bfd_putb32C$53 _bfd_abortbfd_tellftell bfd_flushfflushbfd_statfilenofstatbfd_seek bfd_assertfseek bfd_getb16 bfd_getl16bfd_getb_signed_16bfd_getl_signed_16 bfd_putb16 bfd_putl16 bfd_getb32 bfd_getl32bfd_getb_signed_32bfd_getl_signed_32 bfd_getb64 bfd_getl64bfd_getb_signed_64bfd_getl_signed_64 bfd_putl32 bfd_putb64 bfd_putl64 bfd_put_bits bfd_get_bits!_bfd_generic_get_section_contents+_bfd_generic_get_section_contents_in_window!_bfd_generic_set_section_contentsbfd_log2bfd_generic_is_local_label_name _bfd_generic_verify_endian_match dcgettext_bfd_error_handler $$dyncallopncls.o/ 996061406 0 3 100644 5520 ` 1 @ , '  G!"k?o@4 (744|K?Y@O?@@h| h`h+`4?h `h`8h`h``h`h`xh`@h`h`h` `h`p5h`H@4 `4|k?o@7CHx74kK?YkhHy k @O?k?ok?7D@k? 0744|K?YK?@O?K?@4y @@@Hz@4z@4`}4| d44z@hh?G4|@4@Hz@4z`4|k?ok? k?k?7D4k?!@k?)K?)4@4!@7@@!07K?!@4y!Х:!j!8 K?)@4( | 44 @4H!* d!r0hwh hzh@4z!r4hx@`4|`4|@4@Hz@4z`4|K?)@4 | K?)@4 |@Hz@4z44|K>K?K?K? @O?4hyh44 @4u@@Hz@4z`]4|k?ok? k?7C7@k?! 8744K>K?K? @O?K?!@4 @@@4@H@4Ȁu4 44hh@ ?74@H@4Ȁ4k?ok?7D4@k?@@ 0744|K?YK?@O?K?@4y 0@@Hz@4z`4| d44z@hh?W4|@4@Hz@4z`4|k?ok>K_h 0H7CHtHw`64z 7 8@H|K(4z7 2Ԁ44K>YK>@O>@4z 7Huh HvpHz@7>Ɉ h@@4k>@ӚK>G>4 : SHz@y@Hz@4z4k?ok>@7C 7Hshd HtpHz@7>ɋ h@@4k>@ӚK>G>4  ]Hz@ӹ@Hz@4z4K>YK>@O>k?ok?k?7D@7%2C`B d H 44z@h`h4|K?YK?K?@O?k?oKYh 7C@4ˀpK?Y@4 |74K?Y4Hwphwphxhh`8@O?k?oKTh 7CHzpƚHyH`784z 7 ˀ`K?YH}K(4z7 :ˀ K?Y@4K?Y4@O?h`8+`4hw 443hup44zhshwhh``h`h`xh`@h`h`h` `h`Hh`h`h`@h`K?Y4@O?k?7@KZ 7K?Y7@7?k?@4 K?k?o@k? 7K?4@4zK?Y4|@O?k?7@KZK?Y@7?rr+opncls.cX! X!<<,X!P8(&X!xDNHX! P$X!P\'X!|h(X!tt X!` `(X!dld9X!PJX!@<<iX!|88}X!4X P>(@>(@$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$ $SHORTDATA$;^;*65UU15 571 1 16 18 57Ȏ73 611 1 7ӎ35 711 1 61571 1 6 1 v6v67671 1 67671 1 5 716 v6v1UU7 7"17!8$2&###0(@0 <P`t0 0 A0 Q{, 8PDP`0 Qt#0 A0   0 w0 A0 , oD 0 T l 0 A  0 A  0 @ 7 opncls.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01._bfd_chunksize _bfd_new_bfd bfd_zmallocobjalloc_create bfd_set_errorbfd_default_arch_struct_bfd_new_bfd_contained_in bfd_openrbfd_find_target objalloc_freefree bfd_open_file bfd_fdopenrfcntlC$38fdopen _bfd_abortbfd_cache_initbfd_openstreamr bfd_openw bfd_close $$dyncallbfd_cache_closestatumaskchmodbfd_close_all_done bfd_createbfd_set_formatbfd_make_writable bfd_mallocbfd_make_readablebfd_check_format bfd_alloc_objalloc_alloc bfd_zallocmemset bfd_releaseobjalloc_free_blockreloc.o/ 996061416 0 3 100644 22088 ` 1EDVH@ABDpDpEDOEh RTEhG!SBk?7K_ ‡@* @ r@Z B # 47@4xK?Y@7?ςK?YτK?YψK?YˀK?YϐK?Y4 ψK?Yk?o"K?b@׿u@?7?79?!y!4F wYF ҇BRB @ "# 7:4@4>4|K?Y@O? ?x@ ?4|x@  7(4u4| ?x@` 4=4|x@ ?4|x@4?Ӏ  (44|k?/,opk>k>k>k>k>k>k>k>k>k>677& 7(7EK>@77?<I+`HI 454I4 '!9G')E) 8@#+`4- I@ @04 H8 Rk?K>45k?54k?7#zI-@@457IJI K rp@H0 ` Bk?@4H0H7@H7HH(h@LH` l@@8 %@*#ƒC "D$B4 4|K>YK>K>K>K>K>K>K>K>K>K>O>@/0,I KXHH K+0KPH +  7 I H K I6XJ0I<PH`   `06@= HH@ I9P ? iHK ! K@59 @HKZ@59 @I K H0I6PI `i|4|d4| I5PI i H0 HPҜ HX    6X  H Ivh47HPHXӇ H   'Kx 4 \BZ47m4|H IP47HPHX  HH6` | k Z474|H I6P47HPHX | HJv`\U dZ47-4|H IVh47HPH  HXJx Z474| 44@4dU4|k?/,opk>k>k>k>k>k>k>k>k>74& 7(7E7K>@67?<I +`II 4<4I4 '!9G')E#`)H8 Zk?K>4k?55k?7#@IIV@ I K IHHKX KK0KPH  Y I" I\XH`K0IUP u 0 X k  IWP iHK$ r!@ K@5Y JHK@5Y "I   K H0 H0 Bk?@4H0H7@H7H(Hl@H` h@@0 #R@""Ab!"4 4|K>YK>K>K>K>K>K>K>K>K>O>@/0,IXPI  `mi|e4|dU4|=IWP IWPI ` i@HPҳ s HX    V HHVh47HPHXӔ H  Ix  _Sz474|HIP47HPHX< H   HV` wZ47}4|HH6P47HPHX H < = H6` Z474|HI6847HPHX\ g H < =HH Z47M4|k?7K?7KH τzKS K?K?  H6 KXHT0KPKU`    48@ K?Y@7?k?ok? k?k?k?!k?)k?1k?9k?Ak?IKU7 7G`JKKKH(7$6@44 X7" "R "" 46@4 "(@i#@ 47Z@4 >H0 4Hl@_4_?՟!@4b@H0HP֟6?5!՟?,_& &""""" 46@4 .k@HPHX@s@ ׹   #8 <G# 47@4 l4K>K?IK?AK?9K?1K?)K?!K?K?K? @O?HH6h4z7k>k>k>k>k>k>k>k>K 7$6k>H4@47D 4@52G#HHk?444@4x#HHh@44@(׿`(4@K>C`4A"H!4K>7?a! k?a " k?K>44xk?@4HXJpJx  ] Jx6jx : r ꓀ !b45@4 (? 5)"J@484|K?a`! K444k?H4J@K?a7?M@k? 44JJ4k?JyHJ0K97>@k? 4k?KHSKk?HKK8JyK@K7>-@bk?44k?4x@45@4v  @@444|K>YK>K>K>K>K>K>K>K>K>@O>@@uninitialized@@BFD_RELOC_64BFD_RELOC_32BFD_RELOC_26BFD_RELOC_24BFD_RELOC_16BFD_RELOC_14BFD_RELOC_8BFD_RELOC_64_PCRELBFD_RELOC_32_PCRELBFD_RELOC_24_PCRELBFD_RELOC_16_PCRELBFD_RELOC_12_PCRELBFD_RELOC_8_PCRELBFD_RELOC_32_GOT_PCRELBFD_RELOC_16_GOT_PCRELBFD_RELOC_8_GOT_PCRELBFD_RELOC_32_GOTOFFBFD_RELOC_16_GOTOFFBFD_RELOC_LO16_GOTOFFBFD_RELOC_HI16_GOTOFFBFD_RELOC_HI16_S_GOTOFFBFD_RELOC_8_GOTOFFBFD_RELOC_32_PLT_PCRELBFD_RELOC_24_PLT_PCRELBFD_RELOC_16_PLT_PCRELBFD_RELOC_8_PLT_PCRELBFD_RELOC_32_PLTOFFBFD_RELOC_16_PLTOFFBFD_RELOC_LO16_PLTOFFBFD_RELOC_HI16_PLTOFFBFD_RELOC_HI16_S_PLTOFFBFD_RELOC_8_PLTOFFBFD_RELOC_68K_GLOB_DATBFD_RELOC_68K_JMP_SLOTBFD_RELOC_68K_RELATIVEBFD_RELOC_32_BASERELBFD_RELOC_16_BASERELBFD_RELOC_LO16_BASERELBFD_RELOC_HI16_BASERELBFD_RELOC_HI16_S_BASERELBFD_RELOC_8_BASERELBFD_RELOC_RVABFD_RELOC_8_FFnnBFD_RELOC_32_PCREL_S2BFD_RELOC_16_PCREL_S2BFD_RELOC_23_PCREL_S2BFD_RELOC_HI22BFD_RELOC_LO10BFD_RELOC_GPREL16BFD_RELOC_GPREL32BFD_RELOC_I960_CALLJBFD_RELOC_NONEBFD_RELOC_SPARC_WDISP22BFD_RELOC_SPARC22BFD_RELOC_SPARC13BFD_RELOC_SPARC_GOT10BFD_RELOC_SPARC_GOT13BFD_RELOC_SPARC_GOT22BFD_RELOC_SPARC_PC10BFD_RELOC_SPARC_PC22BFD_RELOC_SPARC_WPLT30BFD_RELOC_SPARC_COPYBFD_RELOC_SPARC_GLOB_DATBFD_RELOC_SPARC_JMP_SLOTBFD_RELOC_SPARC_RELATIVEBFD_RELOC_SPARC_UA16BFD_RELOC_SPARC_UA32BFD_RELOC_SPARC_UA64BFD_RELOC_SPARC_BASE13BFD_RELOC_SPARC_BASE22BFD_RELOC_SPARC_10BFD_RELOC_SPARC_11BFD_RELOC_SPARC_OLO10BFD_RELOC_SPARC_HH22BFD_RELOC_SPARC_HM10BFD_RELOC_SPARC_LM22BFD_RELOC_SPARC_PC_HH22BFD_RELOC_SPARC_PC_HM10BFD_RELOC_SPARC_PC_LM22BFD_RELOC_SPARC_WDISP16BFD_RELOC_SPARC_WDISP19BFD_RELOC_SPARC_7BFD_RELOC_SPARC_6BFD_RELOC_SPARC_5BFD_RELOC_SPARC_PLT64BFD_RELOC_SPARC_HIX22BFD_RELOC_SPARC_LOX10BFD_RELOC_SPARC_H44BFD_RELOC_SPARC_M44BFD_RELOC_SPARC_L44BFD_RELOC_SPARC_REGISTERBFD_RELOC_SPARC_REV32BFD_RELOC_ALPHA_GPDISP_HI16BFD_RELOC_ALPHA_GPDISP_LO16BFD_RELOC_ALPHA_GPDISPBFD_RELOC_ALPHA_LITERALBFD_RELOC_ALPHA_ELF_LITERALBFD_RELOC_ALPHA_LITUSEBFD_RELOC_ALPHA_USER_LITERALBFD_RELOC_ALPHA_USER_LITUSE_BASEBFD_RELOC_ALPHA_USER_LITUSE_BYTOFFBFD_RELOC_ALPHA_USER_LITUSE_JSRBFD_RELOC_ALPHA_USER_GPDISPBFD_RELOC_ALPHA_USER_GPRELHIGHBFD_RELOC_ALPHA_USER_GPRELLOWBFD_RELOC_ALPHA_HINTBFD_RELOC_ALPHA_LINKAGEBFD_RELOC_ALPHA_CODEADDRBFD_RELOC_MIPS_JMPBFD_RELOC_MIPS16_JMPBFD_RELOC_MIPS16_GPRELBFD_RELOC_HI16BFD_RELOC_HI16_SBFD_RELOC_LO16BFD_RELOC_PCREL_HI16_SBFD_RELOC_PCREL_LO16BFD_RELOC_MIPS_LITERALBFD_RELOC_MIPS_GOT16BFD_RELOC_MIPS_CALL16BFD_RELOC_MIPS_GOT_HI16BFD_RELOC_MIPS_GOT_LO16BFD_RELOC_MIPS_CALL_HI16BFD_RELOC_MIPS_CALL_LO16BFD_RELOC_MIPS_SUBBFD_RELOC_MIPS_GOT_PAGEBFD_RELOC_MIPS_GOT_OFSTBFD_RELOC_MIPS_GOT_DISPBFD_RELOC_MIPS_SHIFT5BFD_RELOC_MIPS_SHIFT6BFD_RELOC_MIPS_INSERT_ABFD_RELOC_MIPS_INSERT_BBFD_RELOC_MIPS_DELETEBFD_RELOC_MIPS_HIGHESTBFD_RELOC_MIPS_HIGHERBFD_RELOC_MIPS_SCN_DISPBFD_RELOC_MIPS_REL16BFD_RELOC_MIPS_RELGOTBFD_RELOC_MIPS_JALRBFD_RELOC_386_GOT32BFD_RELOC_386_PLT32BFD_RELOC_386_COPYBFD_RELOC_386_GLOB_DATBFD_RELOC_386_JUMP_SLOTBFD_RELOC_386_RELATIVEBFD_RELOC_386_GOTOFFBFD_RELOC_386_GOTPCBFD_RELOC_X86_64_GOT32BFD_RELOC_X86_64_PLT32BFD_RELOC_X86_64_COPYBFD_RELOC_X86_64_GLOB_DATBFD_RELOC_X86_64_JUMP_SLOTBFD_RELOC_X86_64_RELATIVEBFD_RELOC_X86_64_GOTPCRELBFD_RELOC_X86_64_32SBFD_RELOC_NS32K_IMM_8BFD_RELOC_NS32K_IMM_16BFD_RELOC_NS32K_IMM_32BFD_RELOC_NS32K_IMM_8_PCRELBFD_RELOC_NS32K_IMM_16_PCRELBFD_RELOC_NS32K_IMM_32_PCRELBFD_RELOC_NS32K_DISP_8BFD_RELOC_NS32K_DISP_16BFD_RELOC_NS32K_DISP_32BFD_RELOC_NS32K_DISP_8_PCRELBFD_RELOC_NS32K_DISP_16_PCRELBFD_RELOC_NS32K_DISP_32_PCRELBFD_RELOC_PJ_CODE_HI16BFD_RELOC_PJ_CODE_LO16BFD_RELOC_PJ_CODE_DIR16BFD_RELOC_PJ_CODE_DIR32BFD_RELOC_PJ_CODE_REL16BFD_RELOC_PJ_CODE_REL32BFD_RELOC_PPC_B26BFD_RELOC_PPC_BA26BFD_RELOC_PPC_TOC16BFD_RELOC_PPC_B16BFD_RELOC_PPC_B16_BRTAKENBFD_RELOC_PPC_B16_BRNTAKENBFD_RELOC_PPC_BA16BFD_RELOC_PPC_BA16_BRTAKENBFD_RELOC_PPC_BA16_BRNTAKENBFD_RELOC_PPC_COPYBFD_RELOC_PPC_GLOB_DATBFD_RELOC_PPC_JMP_SLOTBFD_RELOC_PPC_RELATIVEBFD_RELOC_PPC_LOCAL24PCBFD_RELOC_PPC_EMB_NADDR32BFD_RELOC_PPC_EMB_NADDR16BFD_RELOC_PPC_EMB_NADDR16_LOBFD_RELOC_PPC_EMB_NADDR16_HIBFD_RELOC_PPC_EMB_NADDR16_HABFD_RELOC_PPC_EMB_SDAI16BFD_RELOC_PPC_EMB_SDA2I16BFD_RELOC_PPC_EMB_SDA2RELBFD_RELOC_PPC_EMB_SDA21BFD_RELOC_PPC_EMB_MRKREFBFD_RELOC_PPC_EMB_RELSEC16BFD_RELOC_PPC_EMB_RELST_LOBFD_RELOC_PPC_EMB_RELST_HIBFD_RELOC_PPC_EMB_RELST_HABFD_RELOC_PPC_EMB_BIT_FLDBFD_RELOC_PPC_EMB_RELSDABFD_RELOC_I370_D12BFD_RELOC_CTORBFD_RELOC_ARM_PCREL_BRANCHBFD_RELOC_ARM_PCREL_BLXBFD_RELOC_THUMB_PCREL_BLXBFD_RELOC_ARM_IMMEDIATEBFD_RELOC_ARM_ADRL_IMMEDIATEBFD_RELOC_ARM_OFFSET_IMMBFD_RELOC_ARM_SHIFT_IMMBFD_RELOC_ARM_SWIBFD_RELOC_ARM_MULTIBFD_RELOC_ARM_CP_OFF_IMMBFD_RELOC_ARM_ADR_IMMBFD_RELOC_ARM_LDR_IMMBFD_RELOC_ARM_LITERALBFD_RELOC_ARM_IN_POOLBFD_RELOC_ARM_OFFSET_IMM8BFD_RELOC_ARM_HWLITERALBFD_RELOC_ARM_THUMB_ADDBFD_RELOC_ARM_THUMB_IMMBFD_RELOC_ARM_THUMB_SHIFTBFD_RELOC_ARM_THUMB_OFFSETBFD_RELOC_ARM_GOT12BFD_RELOC_ARM_GOT32BFD_RELOC_ARM_JUMP_SLOTBFD_RELOC_ARM_COPYBFD_RELOC_ARM_GLOB_DATBFD_RELOC_ARM_PLT32BFD_RELOC_ARM_RELATIVEBFD_RELOC_ARM_GOTOFFBFD_RELOC_ARM_GOTPCBFD_RELOC_SH_PCDISP8BY2BFD_RELOC_SH_PCDISP12BY2BFD_RELOC_SH_IMM4BFD_RELOC_SH_IMM4BY2BFD_RELOC_SH_IMM4BY4BFD_RELOC_SH_IMM8BFD_RELOC_SH_IMM8BY2BFD_RELOC_SH_IMM8BY4BFD_RELOC_SH_PCRELIMM8BY2BFD_RELOC_SH_PCRELIMM8BY4BFD_RELOC_SH_SWITCH16BFD_RELOC_SH_SWITCH32BFD_RELOC_SH_USESBFD_RELOC_SH_COUNTBFD_RELOC_SH_ALIGNBFD_RELOC_SH_CODEBFD_RELOC_SH_DATABFD_RELOC_SH_LABELBFD_RELOC_SH_LOOP_STARTBFD_RELOC_SH_LOOP_ENDBFD_RELOC_SH_COPYBFD_RELOC_SH_GLOB_DATBFD_RELOC_SH_JMP_SLOTBFD_RELOC_SH_RELATIVEBFD_RELOC_SH_GOTPCBFD_RELOC_THUMB_PCREL_BRANCH9BFD_RELOC_THUMB_PCREL_BRANCH12BFD_RELOC_THUMB_PCREL_BRANCH23BFD_RELOC_ARC_B22_PCRELBFD_RELOC_ARC_B26BFD_RELOC_D10V_10_PCREL_RBFD_RELOC_D10V_10_PCREL_LBFD_RELOC_D10V_18BFD_RELOC_D10V_18_PCRELBFD_RELOC_D30V_6BFD_RELOC_D30V_9_PCRELBFD_RELOC_D30V_9_PCREL_RBFD_RELOC_D30V_15BFD_RELOC_D30V_15_PCRELBFD_RELOC_D30V_15_PCREL_RBFD_RELOC_D30V_21BFD_RELOC_D30V_21_PCRELBFD_RELOC_D30V_21_PCREL_RBFD_RELOC_D30V_32BFD_RELOC_D30V_32_PCRELBFD_RELOC_M32R_24BFD_RELOC_M32R_10_PCRELBFD_RELOC_M32R_18_PCRELBFD_RELOC_M32R_26_PCRELBFD_RELOC_M32R_HI16_ULOBFD_RELOC_M32R_HI16_SLOBFD_RELOC_M32R_LO16BFD_RELOC_M32R_SDA16BFD_RELOC_V850_9_PCRELBFD_RELOC_V850_22_PCRELBFD_RELOC_V850_SDA_16_16_OFFSETBFD_RELOC_V850_SDA_15_16_OFFSETBFD_RELOC_V850_ZDA_16_16_OFFSETBFD_RELOC_V850_ZDA_15_16_OFFSETBFD_RELOC_V850_TDA_6_8_OFFSETBFD_RELOC_V850_TDA_7_8_OFFSETBFD_RELOC_V850_TDA_7_7_OFFSETBFD_RELOC_V850_TDA_16_16_OFFSETBFD_RELOC_V850_TDA_4_5_OFFSETBFD_RELOC_V850_TDA_4_4_OFFSETBFD_RELOC_V850_SDA_16_16_SPLIT_OFFSETBFD_RELOC_V850_ZDA_16_16_SPLIT_OFFSETBFD_RELOC_V850_CALLT_6_7_OFFSETBFD_RELOC_V850_CALLT_16_16_OFFSETBFD_RELOC_MN10300_32_PCRELBFD_RELOC_MN10300_16_PCRELBFD_RELOC_TIC30_LDPBFD_RELOC_TIC54X_PARTLS7BFD_RELOC_TIC54X_PARTMS9BFD_RELOC_TIC54X_23BFD_RELOC_TIC54X_16_OF_23BFD_RELOC_TIC54X_MS7_OF_23BFD_RELOC_FR30_48BFD_RELOC_FR30_20BFD_RELOC_FR30_6_IN_4BFD_RELOC_FR30_8_IN_8BFD_RELOC_FR30_9_IN_8BFD_RELOC_FR30_10_IN_8BFD_RELOC_FR30_9_PCRELBFD_RELOC_FR30_12_PCRELBFD_RELOC_MCORE_PCREL_IMM8BY4BFD_RELOC_MCORE_PCREL_IMM11BY2BFD_RELOC_MCORE_PCREL_IMM4BY2BFD_RELOC_MCORE_PCREL_32BFD_RELOC_MCORE_PCREL_JSR_IMM11BY2BFD_RELOC_MCORE_RVABFD_RELOC_AVR_7_PCRELBFD_RELOC_AVR_13_PCRELBFD_RELOC_AVR_16_PMBFD_RELOC_AVR_LO8_LDIBFD_RELOC_AVR_HI8_LDIBFD_RELOC_AVR_HH8_LDIBFD_RELOC_AVR_LO8_LDI_NEGBFD_RELOC_AVR_HI8_LDI_NEGBFD_RELOC_AVR_HH8_LDI_NEGBFD_RELOC_AVR_LO8_LDI_PMBFD_RELOC_AVR_HI8_LDI_PMBFD_RELOC_AVR_HH8_LDI_PMBFD_RELOC_AVR_LO8_LDI_PM_NEGBFD_RELOC_AVR_HI8_LDI_PM_NEGBFD_RELOC_AVR_HH8_LDI_PM_NEGBFD_RELOC_AVR_CALLBFD_RELOC_VTABLE_INHERITBFD_RELOC_VTABLE_ENTRYBFD_RELOC_IA64_IMM14BFD_RELOC_IA64_IMM22BFD_RELOC_IA64_IMM64BFD_RELOC_IA64_DIR32MSBBFD_RELOC_IA64_DIR32LSBBFD_RELOC_IA64_DIR64MSBBFD_RELOC_IA64_DIR64LSBBFD_RELOC_IA64_GPREL22BFD_RELOC_IA64_GPREL64IBFD_RELOC_IA64_GPREL32MSBBFD_RELOC_IA64_GPREL32LSBBFD_RELOC_IA64_GPREL64MSBBFD_RELOC_IA64_GPREL64LSBBFD_RELOC_IA64_LTOFF22BFD_RELOC_IA64_LTOFF64IBFD_RELOC_IA64_PLTOFF22BFD_RELOC_IA64_PLTOFF64IBFD_RELOC_IA64_PLTOFF64MSBBFD_RELOC_IA64_PLTOFF64LSBBFD_RELOC_IA64_FPTR64IBFD_RELOC_IA64_FPTR32MSBBFD_RELOC_IA64_FPTR32LSBBFD_RELOC_IA64_FPTR64MSBBFD_RELOC_IA64_FPTR64LSBBFD_RELOC_IA64_PCREL21BBFD_RELOC_IA64_PCREL21BIBFD_RELOC_IA64_PCREL21MBFD_RELOC_IA64_PCREL21FBFD_RELOC_IA64_PCREL22BFD_RELOC_IA64_PCREL60BBFD_RELOC_IA64_PCREL64IBFD_RELOC_IA64_PCREL32MSBBFD_RELOC_IA64_PCREL32LSBBFD_RELOC_IA64_PCREL64MSBBFD_RELOC_IA64_PCREL64LSBBFD_RELOC_IA64_LTOFF_FPTR22BFD_RELOC_IA64_LTOFF_FPTR64IBFD_RELOC_IA64_LTOFF_FPTR64MSBBFD_RELOC_IA64_LTOFF_FPTR64LSBBFD_RELOC_IA64_SEGREL32MSBBFD_RELOC_IA64_SEGREL32LSBBFD_RELOC_IA64_SEGREL64MSBBFD_RELOC_IA64_SEGREL64LSBBFD_RELOC_IA64_SECREL32MSBBFD_RELOC_IA64_SECREL32LSBBFD_RELOC_IA64_SECREL64MSBBFD_RELOC_IA64_SECREL64LSBBFD_RELOC_IA64_REL32MSBBFD_RELOC_IA64_REL32LSBBFD_RELOC_IA64_REL64MSBBFD_RELOC_IA64_REL64LSBBFD_RELOC_IA64_LTV32MSBBFD_RELOC_IA64_LTV32LSBBFD_RELOC_IA64_LTV64MSBBFD_RELOC_IA64_LTV64LSBBFD_RELOC_IA64_IPLTMSBBFD_RELOC_IA64_IPLTLSBBFD_RELOC_IA64_COPYBFD_RELOC_IA64_TPREL22BFD_RELOC_IA64_TPREL64MSBBFD_RELOC_IA64_TPREL64LSBBFD_RELOC_IA64_LTOFF_TP22BFD_RELOC_IA64_LTOFF22XBFD_RELOC_IA64_LDXMOVBFD_RELOC_M68HC11_HI8BFD_RELOC_M68HC11_LO8BFD_RELOC_M68HC11_3BBFD_RELOC_CRIS_BDISP8BFD_RELOC_CRIS_UNSIGNED_5BFD_RELOC_CRIS_SIGNED_6BFD_RELOC_CRIS_UNSIGNED_6BFD_RELOC_CRIS_UNSIGNED_4BFD_RELOC_860_COPYBFD_RELOC_860_GLOB_DATBFD_RELOC_860_JUMP_SLOTBFD_RELOC_860_RELATIVEBFD_RELOC_860_PC26BFD_RELOC_860_PLT26BFD_RELOC_860_PC16BFD_RELOC_860_LOW0BFD_RELOC_860_SPLIT0BFD_RELOC_860_LOW1BFD_RELOC_860_SPLIT1BFD_RELOC_860_LOW2BFD_RELOC_860_SPLIT2BFD_RELOC_860_LOW3BFD_RELOC_860_LOGOT0BFD_RELOC_860_SPGOT0BFD_RELOC_860_LOGOT1BFD_RELOC_860_SPGOT1BFD_RELOC_860_LOGOTOFF0BFD_RELOC_860_SPGOTOFF0BFD_RELOC_860_LOGOTOFF1BFD_RELOC_860_SPGOTOFF1BFD_RELOC_860_LOGOTOFF2BFD_RELOC_860_LOGOTOFF3BFD_RELOC_860_LOPCBFD_RELOC_860_HIGHADJBFD_RELOC_860_HAGOTBFD_RELOC_860_HAGOTOFFBFD_RELOC_860_HAPCBFD_RELOC_860_HIGHBFD_RELOC_860_HIGOTBFD_RELOC_860_HIGOTOFF@@overflow: BFD_RELOC_UNUSED@@reloc.ccoff-Intel-littlecoff-Intel-big(8HXhx0H`x 8Ph(@Xp0@Ph 8Ph(@Xp0H`x 8Pp  0 P x 8 P p  8 P h  8 P h  ( @ X p 0Hh(Hh0H`x @`x0Pp0Hh(@Pp0Hh0Pp0H`0Ph(@Xp0Hh 8Xp 8Ph(Hh0Xx8Pp  8 P p !!(!@!X!p!!!!"" "@"`"""""##(#@#X#p#####$$($H$h$$$$$%%(%H%h%%%%%&&(&@&X&x&&&&''8'X'x''''((8(X(p((((()))0)H)`)x))))** *8*P*h*****++(+@+X+p+++++,,,0,H,`,x,,,,,-- -8-P-h----- VRT32  X! X!,X! ll81]X!xDLX! \h hPX! \ D\\EX! $ $h-X!D t<.X!djX!  y X!  X!>X (H.0>(:4@4>(A@8 $TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$ $SHORTDATA$;^;$ ȃ.3 ȃ.3"+6XXYYv9 0 6 9!7 .. (v6 v2 v vv vv v.3*6XXv9 %7 .. 6 9!v6 v2 v vv vv v9 6ȃ.3ԃ 6 Ճ ԃ v6 vMփv2 vv7 6ȃ.2ԃԃPPԃPP 769 9ȃ9.31 v9 vv9.21# #"####"*###"*####" ######)###########"##"# # #"#"###0#######H##]#E#,#"##.#"#######"##L##q##"##"#1####0#####1#4##)#"###a#"*#"#"0#####-####)#(###1)""###=%A##"#####5#"#"##"########v1##H####0F#I#"###"#-###1##.#"##"##"##%%# ( @ 8@80 H ` Hl0 U|0 U    ,0 U80 UT 0 Ut G0 A 0 A 0 g0 U 0 A4 0 UP      reloc.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.DS$relocSD$relocbfd_get_reloc_sizeC$33 _bfd_abortbfd_check_overflowbfd_perform_relocationbfd_octets_per_bytebfd_abs_sectionbfd_und_section $$dyncallstrcmpbfd_arch_bits_per_address$$divUbfd_install_relocation_bfd_final_link_relocate_bfd_relocate_contentsbfd_reloc_type_lookupbfd_default_reloc_type_lookupbfd_get_arch_info bfd_assertbfd_get_reloc_code_namebfd_generic_relax_sectionbfd_generic_gc_sections*bfd_generic_get_relocated_section_contentsbfd_get_reloc_upper_bound bfd_mallocbfd_get_section_contentsbfd_canonicalize_relocfreesection.o/ 996061420 0 3 100644 5676 ` 1,@   @ @",sH,G!k?oKC` @k?Hz@K? @Hc`?@4K?Y4|@O?k?ok? k?k?k?!7%7k?1@7:7@72DȀ4@4 4He k?9#7~ `@K?94@4`K?1@4?4` e4K>K?!K?K?K? @O?44@@4fEK?9k?7k?@k? K?@K?K?Y@7?k?ok?k?k?KE7C7&K_ 7D@444K?YK?K?K?@O?H44 @H4z4je HhH|K87!j5  7K?74@4z 7Ƞ4 +`H76h54z Ht6hv h hh hhhxhhhhHaH67>5h4z@4Ƞ44@4zȠ4k?ok? k?7C7:Hdk?! @4 !@K?!@4 @K?!@4 @K?!@40 Ҁ @@H@K?! @H?@K?!@4zK>K?K? @O?+`4<+`4<+`4<+`}4<ˀuK>k8 @4k?ok? k?KE7D4k?! Hk?)K?)K?!447H?4cH (@K>K?K? @O?"46@@4zK>k?7K_ *k8@K?Y4k8H@7?@4ˀK?Yk?ok? k?k?k?!K= 7$7C76a@(3 ?@H@@HH栺K>砪 Hh@ ړ@G@44K>K?!K?K?K? @O?@4ˀK>@4ˀK># 7:@4@4>@4hzH (@  4@4k?H4z4K`447 4ςhtˀK>k?7K= 7@PK?`jK3H w xJ  t: bςHK?Y4@7ς K?Y@44K?Y@7?@"4@7ςK?Y*K6 @7ςK?Yk?KU7J@7MK?YK?X K!4K K 3 7K?@K X@K BJ 06J!0@K?7@ KKkK0kK(40@0KXp?@K *: KTX KZ@?@@ K?K>@@4KKK7:?@k*COM**UND**ABS**IND*section.c.%dH0H0  X!HH X!H,%X!0 083X!dPdDD'X!4Pk.X!  \ X!,hX!848tX!HlH#X!4X!t X  &4>(4@49>( @m$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$ $SHORTDATA$;^;$7 667Ȋ87 37 7 1 v7 7QQQv62Ȋ7 ӊӊӊ7WWSSUUYY v3 Ȋ3 11Ȋ3 8v98 18v9!# #% % %% %% %% %%%%% % ( @  8 @0H @0\ @0p @0 @0 @0 @0 @0 @  0 A0 QK<HXdt0 A#0 A0 AS  0 Q0 P40 QP70 Ulo0 U  0 @ wsection.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. DS$section SD$sectionbfd_com_symbolbfd_com_sectionbfd_und_symbolbfd_und_sectionbfd_abs_symbolbfd_abs_sectionbfd_ind_symbolbfd_ind_sectionC$34bfd_get_section_by_namestrcmpbfd_get_unique_section_namestrlen bfd_mallocstrcpy _bfd_abortsprintfbfd_make_section_old_waybfd_make_sectionbfd_make_section_anyway bfd_set_error bfd_zalloc $$dyncall bfd_releasebfd_set_section_flagsbfd_map_over_sectionsbfd_set_section_sizebfd_set_section_contentsmemcpybfd_get_section_contentsmemset_bfd_strip_section_from_outputsyms.o/ 996061427 0 3 100644 7364 ` 1@ $G!k?7K?4  4K?Y@7?K9 ˀK?YK]K7K?Yk?7K_` P@K_h 0*kYK?Y4kX@7?@4ˀK?Yk?oK? K0k?"K8 X K#@6#7(ߓ B4 u 4@uv 4@k?t 4@k?s_` 4@k? 4@ǃ 4| 4@c8k?4k?y@K?K>@O?# 4a 4@k?yk?o+`k?4#Hz@ R@@HyK?@7 B4cHz@?@4~K?Y@O?@k?oK_ 7CK @+`47 @+`48!@Hw@!+`49? 4ƒ @KHs"Ӝ4‚@ @׀Ӝp4H"4@K?Y(444K?Y@O?4~4~\04"\04 \04@k?ok?7C@7$ @Ӛ  0HzHx K0Hw  Hz K?YK?@O?k?ok? k?k?k?!K_7C7&76 4K4z7@K4z47` @@44?K>K?!K?K?K? @O?K4z7u@@7?U7?HK4z47 @ 4 @Kk?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=K=7D7) @KM4k>)K=MK= K=k>!K< `H#k>1k>k>k>  Hk>Hg*:Hh**K>)He0H0pK>14X@4)7 4p@4 |4@4 |H 0 KHKH4k>9@4 |K>9@4 |Hx 0 2k?Hy4@4)@K>9k?44Hy@Hx(@Hy@4h7@5Z2H@(Hy45@57hzajI !Z4 @5 IK(jK(ZK(JK (:K((*KX(HH|IlJP 7IqJ!H" IsHL0H7 IbJP  ] HHy L IkK` y 7 @`>5J @@5h`(Hg 4 H44 H@!rHJ6P47H!b@0Hs(6u@0hu(4 ׁ 4 @ 8644Ha(47?+x4Hx   RG4 9 Z ݠ"72 R T fݨ77?? ς K=Y7 H}(7ht(4 4 5@ Hn(5ho(H(%Z7hl( Y @4%0h| Hu(Hl4 4 Hh44 g4 L4 4H4A4?&j$)&HaK>9"  UZHKP5 7\(Hr( &HJVP547Hu Hz Hy Hx Hw ji H k(H50@5HzP X75@4 0@HbPD @4 @HzP @@@@4 @4h|P)7@5HuP @4HiPK> IH( 2@4t H(K> 4K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=ςmK=Yˀ]K=YK>ς= ˀ5K=Yˀ%K=YˀK=YˀK=Y @@5ˀK=Y44@4 +`H677@4 @@5ˀMK=Yς=K=Yˀ-K=Y HJP447Hs H} Hz Hy kH} ji H| h (50HJVP547 A? 4 `4Hq % 5?5A (`rHJ6P7775+0 HJVP57 Hr(G@ 5Hw  A HJP47Hv  B  <Hn  Ha 4HH|  KHn i Hr k(Hi  X K>) 4? pHjHw E Hu +`Hq 4Hp j 40Ht j@(hy(K>H7@Hz He0H0K>15 Hs8f4H04Hi@HgHHKP547 B<7 @ %Hr( X 5@HH 7H8H0H4 4 4 444H4A? !ځ! ( 8!H85)韧44 K> i4 ^@S 6@K> gH(HH6P5:7ܡ@HKVP5:7K>! @ HKP5:H7 ҠZHJh5: 7K>!\hi@hr8hgH he0Ҩ4@4 >_4 -H8ˀK=YK_K7 @4? 4@%08lx %c%c%c%c%c%c%c*DEBUG*.bsszerovars.datavars.rdata.rodata.sbss.scommon.sdata.textcode.drectve.idata.edata.pdata.debug.stab.stabstrbfdUnsupported .stab relocationN b(b8d@dHrPrXs`cpgxttiiepN  X!PP X!LPL,X!8"X!0ddD=X!PVX!|$$\r X!` `h}X!t"X!p X! 0x 0X!($$X X Le>(@&$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$;^;Jv v71Ȇ8'9PP6 8 \\]]^^66 6v6v71v6v(07Ȇ7 79769v6v21 v=7vv6 8 7!167"7#18mmv11 v6vvv v$o o4 v2vvvv###### #########"#'% ( @0 A4 L 0 Q\Sp0 @   0 (0 <0 @\#0 Up0 Us0 U {  , < \ |    A   @    syms.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.DS$symsbfd_is_local_label $$dyncallbfd_set_symtab bfd_set_errorbfd_print_symbol_vandfC$36fprintfcoff_section_typestrlenstrncmpbfd_decode_symclassbfd_und_sectionbfd_ind_sectionbfd_abs_sectionbfd_is_undefined_symclassbfd_symbol_info_bfd_generic_read_minisymbols bfd_mallocfree!_bfd_generic_minisymbol_to_symbol#_bfd_stab_section_find_nearest_line bfd_zallocbfd_get_section_by_name bfd_allocbfd_get_section_contentsbfd_get_reloc_upper_boundbfd_canonicalize_reloc dcgettext_bfd_error_handler cmpindexentry L$plab_startqsortstrcmpstrcpystrchrtargets.o/ 996061431 0 3 100644 2912 ` 1 `@ LLG!k?o+`H#k?H :K@K? 4cH?K+`4#Hz@ :4@K? Z4cHz@?4@44K?Y@O?H|H|?@4?7K?Yk?7+`H? k?@K @@K? "׀4K?Y@7?+`h<ςK?Yk?ok?7D (7## @7:7 r#7@4 Jh` @40 |K?YK?@O?4hz +`H? ˟ +`H7J˘ xk?7+`H7J@ (467 ?67@  74K?Y@7?+`H7J?K?Y6K7?6K?Yk?o+`H#k?Hz@ Hk?K?K?7 :4cHz@?K?4K?Y@O?H|hppa*-*-bsd*hppa*-*-hpux*hppa*-*-hiux*hppa*-*-mpeix*hppa*-*-osf*GNUTARGETdefault 0@0X! X _p,+X!0XX8IX!Dc"X! PX!\,\\>(hP@Ph>( @P t$TEXT$ $PRIVATE$$CODE$$LIT$$CODE$$CODE$$CODE$$CODE$$DATA$ $SHORTDATA$;^;$QQ7PP81 # ## # #RR76RRȋ6 76RRQQQQ6QQ QQv7 % %%%%%%%%% ,@0<@X0T@P0 l 0 0 A  0 00 A@/ \l|./targets.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. DS$targetsbfd_target_vectorbfd_default_vector_bfd_target_vector_entriessom_vec find_targetstrcmpfnmatch bfd_set_errorbfd_set_default_targetbfd_find_targetC$228getenvbfd_target_list bfd_zmallocbfd_search_for_target $$dyncallsrec_vecsymbolsrec_vec tekhex_vec binary_vecihex_vec hpux_core_vechash.o/ 996061436 0 3 100644 4680 ` 1 H@d  P 6 G!Ik?ok? k? 7k?!7C@7% | @7@4 4K>K?K? @O?@K?! | 7@4 ˀK>K?!@4 d4] ek?7@4K?Y@7?k?o7C@KZ `K?Y@O?k?ok? k?k?k?!k?)k?1k?97C867$7C44 H77X 1 X  ? 4 ?6% 1% H|Hy Ҷ 5: @ H7IS3 IZ@4 IJ@?@!"Hv44y47 7 BHz@4 74@44 D IHb H DHe 5\K>K?9K?1K?)K?!K?K?K? @O?@5\@5\@4 @u5\k?77TK:73JJ K " Z6J?@"46@4xK?Y@7?k?77\ 7:@4K?Y@7?k?oKZ@7#2_` K?Y7@O?k?@4 K?k?ok? k?7C4k?)KX k?!Hw B4K?)K?!7 2H?4H4䟅@K>K?K? @O?k?77\k?@ k?K?@4(0ˀBK?K?@74?  k K?Y@7?k?o@4@ (744|K?Y@O?+`H9@4z "h` h`(h`0h`8@4z`}4|k?7@@ 4k8K?Y@7?k?7@k?@K?K?Y@7?k?ok?k?k?7C7% H64z44@4 7ϟpK?Y4(@4z!p7 8 @47@4z!2 h 4? H? Hz @4Hw H87   0h} H6hHu 6h| Ha( Hb0 0hd( hD hd0HK?YK?K?K?@O?ϟK?YϟK?Y@K\ k?ok? k?k?k?!K$(7C K%8H@4 `7HKx7?477?44@4w 444@4w bH ??H4K>K?!K?K?K? @O?ˀK>ˀK>hash.cX! X!,X!0$$8)X!TxxD7"X!hLhPYX!4((\qX!\@@hX!||tX!\\X!tddX!(X(X!$$X!$$$X!H X!PX ,>(@4$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$;^;)517881!0 7 v8 77 10 Ȏ3771v7 786ff71511 976  6v2 9 #'0 Q(DXl0 A0 0 U   0 PO 0<0 QL0 Ad0 P| Q0    @ 0  [0  0 U, D 0 P 0 Ahhash.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.bfd_hash_table_init_nobjalloc_create bfd_set_error_objalloc_allocmemsetbfd_hash_table_initbfd_hash_table_free objalloc_freebfd_hash_lookupstrcmp $$dyncallstrcpy$$remUbfd_hash_replaceC$38 _bfd_abortbfd_hash_newfuncbfd_hash_allocatebfd_hash_traversestrtab_hash_newfunc_bfd_stringtab_init bfd_malloc L$plab_startfree_bfd_xcoff_stringtab_init_bfd_stringtab_free_bfd_stringtab_addstrlen_bfd_stringtab_size_bfd_stringtab_emit bfd_writelinker.o/ 996061453 0 3 100644 19240 ` 13K(@+,D$1138d3@ 3G!)k?77\k?@ k?K?@480ˀ:K?K?@7 k K?Y@7?k?7K77_kW 7k(@k0K?Y@7?k?7@@K? 0@@K "K(K 0K?Y@7?k?ok? k?k?k?!7FK:7#k?1K> 7HB044@ 844@4 @@4: b"64@4 24k?9Hz4@4 k?Hz4K?1@K>74|K>K?!K?K?K? @O?@4@7 P7`4|@K?9@7 7`M4|k?H"6B0 4@ 4@4HzK?14@47@44|k?H4C0  @K?9HzK?14@47@4 4|k?7@@K?Y@7?k?7K8 7? P7WJ0 k j0J( 0j(K?Y@7?k?#@7Z k?@4K?mK?k?77\k?@ k?K?@4H0ˀ:K?K?@7 k@ k8K?Y@7?k?o48@k? (744|K?Y@O?+`H8K?@4z?4|@4z`4|k?ok?KW 7CHxK4z7`74z@4h|70 jHK4z7`Jh|4K?YK?@O?ˀK?YˀK?YˀK?Yk?7@4K?Y@7?k?7@4K?Y@7?k?7K_` " r@@HK?Y +aH8+bH8@@K?Y@7?@4ˀK?Yk?ok? 7C7@k? "4K>K? @O?k?Hx4zK?@HwK>k?77\k?@ k?K?@4 0ˀ*K?K?@7 K?Y@7?k?7@@K?Y@7?k?ok>k>k>k>k>k>k>KG7C7$#(k>HzKU +cKEH9 @7?1#"ŀ4H44@7?1#`74@7?1#:I 5KK?@44şEHH(4(He胠!44?HI 0 HJt0!I ܁P  !*I !HyK64zI97!7I_'84@5Z piFK>7?5Z47!X@K? iE iFI) >@H4' H>WH@7?1ςhe4@4z0ς@4ˀK>YˀK>Y5 eHI44@7?1=KH4G  H@7?14K>YK>K>K>K>K>K>K>@O>k?7@4K?Y@7?k?7@4K?Y@7?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>7D77&@6!HH +`"4)64 !HI HM @I O#4 k?H4I@44#87I #I J "I( ! J@4"8i0I Jy0I @i(I04\I ?!5@@6:I0I0J?ˀK>YJK64I70ˀk?H46@H  m`K>YJKV64I7  mK>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>ˀuK>YK@6:I0I0J?0k J0I4 I( i(47HςK>Yk?ok>k>k>k>k>k>k>k>k> 67Dׂ7%+`4(K>+`"4)617?iHlI _ "I  J ^"_@II 4 4w׀JH?w4k?44k?iI k?Ik?Ik?k?y@k?q IƚK?i K j i(G44/4K77JxˀK>YHJ H @K?iK@ *I  ZK  J  :k@I K `I?`iK?ii(4cÝHl4K>YK>K>K>K>K>K>K>K>K>@O>K_ KZ(K_?@2 KW0JK@" ˀ@@K\(K_0@Kk?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK=+`4,k>K=7D7%k>K=7K= (W:4 k>/k?IA(4 4 k?IS04k?Jtk?HJJIY7/2k?K>47k?4@44.7J_ @JB(B.҈ "K6YjP(@HiR(I] k>4  _+"k?IA(44 k?I_04k?Kk?HKKIY7*iF0IP 0 Y  XK>"iH(@bN"@| K>61B5?61B24Y":5P4 @6:"B?4_ 4!B6B16!҆)k?H04k?J 44IX7!jˀK=َ*k?IQ04 4k?IB(k?J5k?HKJIY7)IQ(iH(@5IT04@K>H@7-7K>@6:j0H5Y@6 0!bςK=و H@5Y LH@4'i\0iH(@5K>IA04" <5@@4IV0IA0H0 j IY0 Rk?H44k?Jv(IX7*ri@0IJ(4K>2K> 2 IWW 69 4?K> 44HK6IX7+H7IAIZ4jIUjI]jIT jIS(j IV0j0j0HIR(JZ@K>=@IX4 &x4'0@I_0XIW(H$IV048!k>k>K=q "@I*@"H 2H z44@4y Rk?H44JPIY447"*K=yk>4b+`k>42+`k>41!k>5!k>5 *4 4 k>!]4w4 ek>Ɨ+`4=k>4k>H ` k>`^k>K=qK> K>" Bk?44k?4@4x\84k?H44y@47@=WH ׀4K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>45 @4 @ K5YiE(@HwiE(4] T5 @4 @k?ˀK=45 4 @7%k?ˀ}K=H@4IU0I\0KhK IX 7}@HJz0 Z(iJ O5 @4 Lk?ˀK=ْ  IS0Jx@4k?H4k?JVk?IYk?76@ˀK=K>IBF *K>? K> 65@k?H47k?Kk?IYk?K75@ˀUK=45 4 6@76?5 @4 Mk?ˀK=ˀK=!`5z`5yp@4 +`H6J74x677@4ˀEK=k?H44k?K5Y474E@ˀK=ˀK=I\  HJ0 A(iJ UIJ(k?H5Zk?@J(IXK>76473m@ˀK=IW  HK0*54k?H5Zk?@J(IXK>76472@ˀEK=ˀ5K=ˀ%K=k?ok>k>k>k>k>k>k>7C7$k@k@k?9K_ zK RJ0J 0C(֟0c(J?JK?@Hp B7?94z4@4#H?7?9k?A+dH9 7?9k?I7?Ak?Q@H44z@7?9#H!He!hxH!H  Hx6hx H I 5:@5b7@5Z2G@"jI75:5@4bH7Ix"BHx hx@4H>HHx B @4z"hphxH __h H>ghxHe 4H H7?" :4z44@4 BˀxK>Yk?4z44@4!bH?_HH?-@4K>YK>K>K>K>K>K>K>@O>ˀK>YˀK>YˀK>Yˀ}K>YˀmK>Y#@7Z 4@7ꝍHxˀ%K>Y4z44@4>HˀK>YˀK>Yk?ok?KW7C7K?b 43 Hz ]=Hz7@ rh|HyHz : 4 Hu6 hvK?YK?@O?ˀK?Yk?ok>k>k>k>k>k>k>k>k>k>k>k>k>7#7k>7:@k>#Hx!He!HX!@H?@pHeƟ2HX 4I II ??iK @ %i HX 2% HI4@4$(I HoI4z7"2Hl!5K>7k K>@!HeHp +`4'+`4(+`!B4)5J14 4 !4HI _ *I  J @ >WHXI(! 2K>K>@5$ i84şG44K>YK>K>K>K>K>K>K>K>K>K>K>K>K>@O>ˀ}K>YˀmK>Yˀ]K>YƟ@I  :k?I44k?@K>2k?H44@I7HXIiI(I?? iI( I0Mi I_@iI( I0i 5 @4ri I  *It ޿I I 8ǟ*HX@04I  J Ҁ@rH`0 HI 8I 4z@5 4I K =@C(U[%@]445 @4I ˀ=K>Yk?7K77_6?Bʆ""!چ!!b!2 K  KƖ@z#7 @4`XK?YJ @8@+`44!@+`48k K?Y@7?"46 @4RK?YK+`43k uk+`47Mk K+`45k  kK60k K=(K׿kK<0k K3(K K!(>5+`49ek k?"6 @4K?k?ok?k?7#KY87D !R4h8HKX!: 0@KH4@4 H@ P@HzK_K7 7H  4@4H?h4Hz@Hy Z4K?YK?K?@O?ςK?YςK?YˀK?Y#47 @4u4k?/,opk>k>k>k>k>K"7&7k>р@#6Hdp#@K>@4 #7H H K>@H# HH 0@H K=K \KHk?4H 4k?K>4@K"K8"H7@ K_H *H H H|p8Hex@@7@7"7H H84K>@H0b"4k?& @K>7>K>4y4&9G&E@7@4" H|pHex $Hhx5hx4K>YK>K>K>K>K>O>@/0,k?H44H KH4HY7 ˀ]K>Y"46 @42=Hdp"46 @46K>ˀK>Y@4ˀK>Y@4ˀK>YˀK>Y"46 @4HHH Jv8 KK9k?H4k?J@k?K7<4@4ˀK>YˀK>Yk?o7#@4(0ˀJH 0h|h|K?Y@O?k?/,oJ6k?A7?k?1k?9 @$p 7?AHwk?K?1K?AHx '9G'E@K>O?@/0, j "#@47Z @4Jk?K?14wK?9@K?AuK>K?A@4wMK>k?/,ok?k?!k?)K 76xk?AH@42D!zH  04 86@€(4 6@$ @K?A7?QH4yk?K?A4'9G'E@7@44|K>K?)K?!K?O?@/0,"6 @4eH`4|k?/,opk>k>k>k>k>k>k>k>k>k>k>k>K 77C7&6H`$H IX$II PH$I @Hj$2H Ix Hp$2K>!z@4$HH - *B+`4++`"b4,6m14I/I  "I  K ^ I( I z :k?I44zk?@4*k?H44@I 5@75)II/A(5C2IH@@ 7A(.C2IH Hk?4z4Hk?4@57 7$ @4z7?!H4zk?44'9G'E@" @@5:4K>YK>K>K>K>K>K>K>K>K>K>K>K>O>@/0,!5 @4HςMK>Y! 5: @4I P @4Z @4I @ 4: @4H!5`5@4 HHb+`7H6HHX7@4ˀ-K>YˀK>Y"46 @4xB@#47 @4z}@ @@5:ς}K>Y@ 84K_ 0 7KZ@?@@@4          __wrap___real_linker.cCOMMONGLOBAL_bfd%s: indirect symbol `%s' to `%s' is a loopAttempt to do relocateable link with %s input and %s output##X!XX X!0X0,X!PP8X!XD-9X!PfX!4dd\tX!XXhX!\p\tX!LX!dX!X!``X!|TTX!PPPX! *X!<dd83X! kX!<yX!xXx2X! P X ))xKX! $T TX! x (-X!D4:X!(@&X!H<HL7CX!llXz3X! pd"X!!p pHX!$PP#P|X!$$ %!X!%d$FX!&lX%XecX!)()D( X!))l >(+@ $TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$DATA$;^;$78799Ȋ8 9 66 7 1 3Ȋ2787ee81 v67v7888eeee8169 787ee7"97(v77$v81%7#1 9 9&9&6p( 976'7) v89 v p*p+9,=?%/%0%2%3%5%6%7%9%4%1%8%;%:%=%<%>%D%B%C%@%A%?##"*#  p+v99 2vԊ8 vv6'677K3L26'7)v9v87Gp*9 v9pHp(Ӡ-ӠEp*993F227)v9v8IpJv41 v96.vv$9Nee38P7Q6 9R1 79U9T 29S7V6#9v6 8Pp+p*p( 993F2'7W 3FȊ2p*p(3FpH29v62X8PȊ3F&77Y96Z6[9\6]9^1 v9Ȋ3F1v7! 6] 9^Ȋ3F9T9`$ 6 6] 9^1 Ȋ2-(6p*p+992X6 9a6] 9^1 28IpJv313F1  ''''!'O0 Q(D\0 Qt[0 U0 U  *(4@0 PLh0 @0 Q0 s #@  8 0 AH g Ql 0 A  Q  Q? Q #0 Q@l  U  Q S A U0[Xh|0 U  )x      , < L \@ l | < T x d |  |       , < LX \ l*|x0 A0 U?0 A8 Qd0 U  U %0 U $#  0 @ H d     0 A # U $ 0 0  X!)G0 A |")olinker.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01._bfd_link_hash_newfuncbfd_hash_allocatebfd_hash_newfunc_bfd_link_hash_table_initbfd_hash_table_initbfd_link_hash_lookupbfd_hash_lookupbfd_wrapped_link_hash_lookupstrlen bfd_mallocC$37strcatfreestrncmpbfd_link_hash_traversebfd_hash_traversebfd_link_add_undef bfd_assert_bfd_generic_link_hash_newfunc#_bfd_generic_link_hash_table_create bfd_alloc L$plab_startgeneric_link_read_symbols $$dyncall_bfd_generic_link_add_symbolsgeneric_link_add_symbols%_bfd_generic_link_add_symbols_collectgeneric_link_add_object_symbols*generic_link_check_archive_element_collect-generic_link_check_archive_element_no_collect%_bfd_generic_link_add_archive_symbols bfd_set_errorgeneric_link_add_symbol_listarchive_hash_newfuncarchive_hash_table_initbfd_openr_next_archived_filebfd_check_formatbfd_hash_table_free"generic_link_check_archive_elementbfd_log2bfd_com_sectionbfd_make_section_old_waybfd_und_sectionbfd_ind_section _bfd_generic_link_add_one_symbolC$54hash_entry_bfd $0000008B $0000008C $0000008D $0000008E $0000008F $00000090 $00000091 $00000092 $00000093 $00000094 $00000095 $00000096 $00000097 $00000098 $00000099 $0000009A $0000009B $0000009C $0000009D $0000009E $0000009F $000000A0$L14 _bfd_abortstrcmpbfd_abs_section dcgettext_bfd_error_handlerstrcpybfd_hash_replace_bfd_generic_final_link _bfd_generic_link_output_symbols%_bfd_generic_link_write_global_symbolgeneric_add_output_symbolbfd_get_reloc_upper_boundbfd_canonicalize_reloc_bfd_generic_reloc_link_orderdefault_indirect_link_order_bfd_default_link_order bfd_reallocbfd_is_local_labelset_symbol_from_hashbfd_reloc_type_lookupbfd_get_reloc_size bfd_zmalloc_bfd_relocate_contentsbfd_octets_per_bytebfd_set_section_contentsbfd_new_link_orderdefault_fill_link_order"bfd_get_relocated_section_contents_bfd_count_link_order_relocs_bfd_generic_link_split_sectionsrec.o/ 996061463 0 3 100644 15400 ` 1$L<(@H""|$L(n$p|1 $pG!8k?7+`H? 4@h7K?Y@7?k?o@7CH Z40@4z Zh|4k k(4K?Y@O?ˀK?Yk?o7W7#7?4@4 8@@@4 wϟK?YC?K?Y@O?k?ok? 77C (k? @4 K>+`H?  @4 $  g?#77 @4 +`H6Hy7?K?77@4K>K? @O?#77?@4=#k?ok?k?7$7C7@42_ˀ4HwJ J 0 _Hyk? H}7hsK?YK?K?@O?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y44k>44@k>4 4)4K>@7>'7+`4&"6k>+`4(4 4 H4 @-$ 4 M%zm &ʍ'"K>44K>@7> P7 m( :K>@7> 7 m(0#&&@44(h7 K>7>@4 7I& Ҽߋ 2 P6@4' \ 7-K>7>@61 07I&" Ӽ߃?_& 6?K>@'76@4@4K>@7>4 P7 m( :K>@7> 7 m(0%jM "K>@7>%x7Ѷ ӟ P4ױK> @7>ӓ ҟ?7K>6@68% m(0_$⬢K>@K>K>7?Q7?4@4%@C?S4 4ƃ8$C?U $֏  Q: @4z@6:$p76'K>44z@68$04oC?Q2K>6A? 4?! 46? 5K>@7> H7!@K>@7> 7?@!zK>K>K" 669@7?q@7?qK>@777?q@7K>@5"7i04i i8iHiK>@7>87K> ": @4zςhK=K>K>4@5@K>K>4@5@K>K>4@5p@@5E@@5@K>K>4@5@K>K>4@5@K>K>4@5>K>K>K>4@5H@ 8(C?U 88K>K>@4 @@4 @@4z4K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>ɀK>CC6?7  Y 0 CC׸ 6?  2X   X7C ӳ֓CC 6? CҶ   Q PQ6 P :mUMI0IH :OK> iHCC7  6< CC8 7 ]} k  !XCCX C ֐ C2 T  UHњK>ֺЧ   J ij@5ςUK=k?o@7C44@4z!:7?44@4w! C?4!@C?+`4? 4ƃ C?  C?  @4z @@4z @H| Hvp hvpH|K?Y@O?ˀK?Y@4ˀK?YˀK?Yk?o@7C44@4z 7?44@4w @C?4H C? @4z @@4z @Hz@ Hyp?@ hypH|K?Y@O?ˀK?Y@4ˀK?YˀK?Yk?ok>k>k>k>k>k>k>k>k>k>k>k>k>77%k?aK944@k>4%4K>@7?a%+`4(4 4 !`4 f4 b 0&rK>7?4@4%C?  P C?  _ 5z@4C?C?    |֜  P: @4z@6$P76K>44z@6$4oC?4 J HHD% @@5ςK>YAA55?     AA_ 5?    9  W_5AA 5AA        ӳ v H0Z \ҵ ֜  _ d "45?!7??Z_P7_?B  ӓ B  ֓ 4 6_4a@@  764    ӕו |   TT          ==  A 7~6K>@7?a:@K?a  @@4z4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>@O>HH8  @@4zςMK>YHH  @@4zς K>Y5z@4mK>"6@4"`6z@4#7@4</k?ok?7#6k?K8؈ Xk?@HyHh|؈ 7HH jK?@4y ZHwK? @K?4K?YK?@O?ˀK?YˀK?Yk?7 2+`4?k_4K?Y@7?@@K?Yk?ok? k?k?k?!k?)7&KC7Hk?16@4 7K>""H _5@4 `7K?15@4+`H9 24 |ˀK>ˀK>H8 G  6?B"Ht4 u4 v H8   H *K  dHw P4JHX26J @J6 H0 d4K>K?)K?!K?K?K? @O?k?o7_4c=q7=q7#`C7S42A6}2 .@. *&Ab& "@b?@HK<"6 | 7 49|5 #  7 @4U | |  4    7K<@ xP4x?"6BӁ! B|# 7Bt _6ar 76Ӗ6 7|# c#  B|" ""  Ӂ|! !  Ҝ|< b 6~6 }RB4BBT "6Y| tC w44# !| 7 T74@4x|(4K<@O=k?7K]7=C46 H4P 7 7K] ?@k?4@4K=Y@7=k?ok? k?k?k?!k?)k?1K77$k?AK 4+`4&H 稀6Hi@K?A47   k?HK?A@5 jH U5(4K>K?1K?)K?!K?K?K? @O?ˀK>k?77?K?k?KX@K?Y@7?k?ok(@dN->( @ p{$TEXT$ $PRIVATE$$CODE$$LIT$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$DATA$ $SHORTDATA$;^;*QQ0Q%%%%%%%%%%#"2## # ##07 9 5 1 ^^68ccv487 87 p%'^ 6 ^7"^77#1$ 86&9 p% 1$6 7  86(77#7) 7 1$4 6! `089 p%66 1 089 66 1 87 p%9 2- 1$6  p7 2-78,8/p182 7 8/VV>0ȂB95(94UU680994948 Ȑ86(957< 96(957 6;66877:7=7=7B 7pE(2GȐ8I2J9I%'L'M'N'O'P'Q'R'S'T'L'M'N'O'P'Q'R'S'T'U'+'V''W'?'X'Y'.'Z'['\']'V'^'_'`'C'D'A'H'F'a'_'V'b'c'd'0'3'@'e'f'g'h'i'j'k'l%'L'M'N'O'P'Q'R'S'T'L'M'N'O'P'Q'R'S'T'U'*'V''W'>'X'Y'.'Z'['\']'V'^'_'`'C'D'A'H'F'a'_'V'b'c'd'0'3'@'e'f'g'h'i'j'k'l# # (@ 4@ @ L\0l@0x@ / A T  ,8DT l Q| / \    4 d     , 0@P`lx      Q ;  U k8  QD \ x  U + U   G Q ( A4w Ph A3   A  $ 43 ATCh P|K Tk0@p $4D\l|Ht  8 \      , H l 0 @srec.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.DS$srecSD$srecC$38 srec_inithex_initChunkS3Forced srec_mkobject bfd_alloc srec_get_bytebfd_read bfd_get_error srec_bad_byte bfd_set_error __SB_masks_isprintC$47sprintf dcgettext_bfd_error_handler $$dyncallsrec_new_symbol srec_scan $0000004C $0000004D $0000004E $0000004F $00000050 $00000051 $00000052 $00000053bfd_seek bfd_malloc_isspace bfd_reallocstrcpyfree _hex_valuebfd_tell$L9strlenbfd_make_section srec_object_psymbolsrec_object_psrec_read_section bfd_assertsrec_get_section_contentsmemcpysrec_set_arch_machbfd_default_arch_structbfd_default_set_arch_machsrec_set_section_contentssrec_write_record bfd_writesrec_write_headersrec_write_sectionbfd_octets_per_byte$$divUsrec_write_terminatorsrec_write_symbolsbfd_is_local_label#internal_srec_write_object_contentssrec_write_object_contents symbolsrec_write_object_contentssrec_sizeof_headerssrec_make_empty_symbol bfd_zallocsrec_get_symtab_upper_boundsrec_get_symtabbfd_abs_sectionsrec_get_symbol_infobfd_symbol_infosrec_print_symbolfprintfbfd_print_symbol_vandfsrec_vec bfd_getb64bfd_getb_signed_64 bfd_putb64 bfd_getb32bfd_getb_signed_32 bfd_putb32 bfd_getb16bfd_getb_signed_16 bfd_putb16_bfd_dummy_target bfd_false_bfd_generic_mkarchive_bfd_write_archive_contentsbfd_true+_bfd_generic_get_section_contents_in_window%_bfd_nocore_core_file_failing_command$_bfd_nocore_core_file_failing_signal*_bfd_nocore_core_file_matches_executable_pbfd_voidbfd_nullvoidptrbfd_generic_stat_arch_eltbfd_generic_is_local_label_name_bfd_generic_read_minisymbols!_bfd_generic_minisymbol_to_symbolbfd_0l*bfd_generic_get_relocated_section_contentsbfd_generic_relax_section#_bfd_generic_link_hash_table_create_bfd_generic_link_add_symbols_bfd_generic_final_link_bfd_generic_link_split_sectionbfd_generic_gc_sections_bfd_n1symbolsrec_vecbinary.o/ 996061467 0 3 100644 5984 ` 1 `@ T 4 4  = ` G!@4k?oKY  07C@4K>Y4@O>4hz7>@4z@ @@4ˀK>Y#7@4z 7ˀ]K>Yk04K>Yk K>kHkH|h@O>k?o6k?k?@4 RK?K?44x@K? 4K?Y@O?ˀK?Y@4 k?ok? k?k?7DKZ@k?!K?!@7 7@4 H7+`4#4|K>K?K?K? @O?"H6K?!@4z@z@?4|+`4$44fH H@  0 @?4 4|@@ k?ok?k?k?7#KE7F@42Dˀz +`49@4 +`4 49 4 h h(@h0h8HH+`4h@4904hHhPhX@h`hhHH+`44h44hphxh d4060 v76d0 s4c4 `K?YK?K?K?@O?k?7@40K?Y@7?k?77:@7K?Y@7?k?ok? k?k?k?!k?)k?1K>7C7$k?A hk?I4K>K?1K?)K?!K?K?K? @O?ƿςK>Hb!Hg44!X44 4J X= 2JH " J8Ԁ J84J?@ 4 4 H H8 7 hHH pZ"606@@4 +`HH7H67H?GH 4hfH  >-@ςK>k?K?A4z4@K?IK>@4.data_binary_%s_%sbfdWarning: Writing section `%s' to huge (ie negative) file offset 0x%lx.startendsizebinary    X! X!, X!,TT8&X!D: X!PE'X!h\l#X!phX!  tX!t,t X!  X (_h>(@$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$;^;'17Ȅ7896 7 ]]9__ 67 ]]7 ]]]]bb7 2%Ȅ8hhv39# "F###"#% '''' '!'"'#'$'%'''' '!'"'#'$'%'&'''''('')'*'+','''-'.'/' '''-''0'.'''1'2'3'4'''5'6'7'8'9':';'< ( < Pd t  U  A   ( @4@P A`x  P U/  $4 A\ 0x @(         0 H X h     0 D d      0 P x     binary.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.binary_mkobjectbinary_object_p bfd_set_errorbfd_statC$40bfd_make_sectionbinary_get_section_contentsbfd_seekbfd_readbinary_get_symtab_upper_bound mangle_namestrlen bfd_allocM$39sprintf __SB_masks_isalnumbinary_get_symtabbfd_abs_sectionbinary_make_empty_symbolbinary_get_symbol_infobfd_symbol_infobinary_set_section_contents dcgettext_bfd_error_handler $$dyncall!_bfd_generic_set_section_contentsbinary_sizeof_headers binary_vec bfd_getb64bfd_getb_signed_64 bfd_putb64 bfd_getb32bfd_getb_signed_32 bfd_putb32 bfd_getb16bfd_getb_signed_16 bfd_putb16_bfd_dummy_target bfd_falsebfd_true+_bfd_generic_get_section_contents_in_window%_bfd_nocore_core_file_failing_command$_bfd_nocore_core_file_failing_signal*_bfd_nocore_core_file_matches_executable_pbfd_voidbfd_nullvoidptrbfd_generic_stat_arch_eltbfd_generic_is_local_label_name_bfd_generic_read_minisymbols!_bfd_generic_minisymbol_to_symbolbfd_0lbfd_default_set_arch_mach*bfd_generic_get_relocated_section_contentsbfd_generic_relax_section#_bfd_generic_link_hash_table_create_bfd_generic_link_add_symbols_bfd_generic_final_link_bfd_generic_link_split_sectionbfd_generic_gc_sections_bfd_n1tekhex.o/ 996061479 0 3 100644 13196 ` 13@Pd#T[ C*p  G!#Bk?7+`H"@!4@h?46+`4:hU@747Y736aA446\76V 46]64STU7Z4  Y7X79bH7!46bJ67b\44b 79Y7K?Y@7?KSBw+`4? 4!H6w4 7?5P7?B ּ \6_79?` BBּ  Ӕ UBB}5  Y 9ә !Tה6U |\W>7?W@K5B+`43  64 4P7?  X a_7`@ X  7 76 6t6  7 X ? 4 X  @!k?ok?k?k?K]7$7CK XԀ(H8 8@H% @(H7?@ 4@4z#B7Y7@4z7 0Ƞr4@ 44@HyK?(h$h?Hse4K?YK?K?K?@O?k?ok?7#7@7П   _ 4=K?YK?@O?k?ok>k>k>k>k>k>k>k>k>k>k>4 lk>1k>9Y#Pk>)4 fy!K>YK>9@48K>)CM$7K>9 7?Q7>)K>)K>97k>)K6kK>9JpjpK>9KHNi0K>9J@ ,7K>9@5$ I7?Q@5i ѳx h @7>)Hy0 < K>)C!"8K>Y7?Q@7>)K>97@7?Q p74K>9@4y"(747?Q@4xK>9@47K>)C!R4p4j4b4h44 4 4 `  8K>9!>K>)K>9@7>)K>)B 7+`4$B ׇ EK>94x@ K>)57k>)4cB?BK>YK>K>K>K>K>K>K>K>K>K>K>@O>!45@4R47k>)@7>)h|0@7>)hj H}0 hvH"46@4 K>9#47@4Ik?ok= k=k=k=!k=)k=1k=94k=Ak=I@4!+`4#7=4J4ƈ"j4K=A44 @5!A i "A A z ! K=A6?45@5X!j HK=A9K=I57K=A44@4C= 4( 4K=A4@4@ 4%>M@?4/!@45Z@4+`"46@4 A # 7:4@4e H K74k?AK%04 K>4  Щ@K?A  `  ` u`0 `4?u4cK>K?1K?)K?!K?K?K? @O? ` X  `7 4 Uk?7K= ӳ` K?Y4@7?K?k?4@k?K?Y4@7?k?7@@K?Y@7?k?ok? k?k?KT7D7#k?! k?)H H jH0HH ڠB4@4H0HH  4?&4H?m@Hu Ҷ 24K>K?K?K? @O?k?K>44yk?K?!@K?)ςK>K_448}@ ҕ B?6s?4b4`7_@6v`?7|7P47?#7}@ Ӂ 77?_6s?O_ }@ 7?|@7? 7?|@Ҽ   }@ Ҕ s 757?e_k?ok?k?KE7C !`7$44 \Ab4` 4 47?!7P47?47@477?7Z?_7`j 4777 K?YK?K?@O?@44  :4b "46 4}7?#7  4E7?k?ok? k?6 k?!4 "6Ң7 ҵ| 4J   k?44z DP6?+`49CS3 ҕ _7Z` 7Z_@4 BT 3 D7 = 4 ҡ< 6 u7ZC?+`4!C? 6 C? 7 7? 5  "    ӡ Ӣ|  g?K?!4@4 r4 4K?!4z4@4 `@K>K?K? @O?# 7:4@4B]4#47@4JuK>k?ok=k=k=k=k=k=k=k=k=k=k=k=@7CHdH(" @ !4D4&4@7>q4 (4+4 4 4# 4# 4#` 4#z 4#Z@ 4#: 4# 4" 4" 4" 4"@ 4"z 4"Z 4": 4" 4! 4!` 4! 4!@ 4!z 4!Z 4!: 4! 4  4 @ 4  4  4 z 4 Z 4 : 4 ` 46@#zk?qI} @7?q405n K?q \ӵ| K?q 9K?q7Xk?qM 4| K?qK?q7/k?q  | K?qoK?q7k?q K?q ѽ| K?qNK?q5k?q\  :| K?q K?q5k?qӖ  ]| K?q K?q5k?qҵ  :Ҙ| K?q AK?q4\k?qt ӯ|6 K?qK?q46\k?qK?q4l4z@585J@HxU5@(H%84 Hd 7>q4bk?yH@7?yK?y6uk?y7?yf@H0H0HH @7?yK?y4f4z@4H?Ok?yHd!zH!j#74~7>q4f4 n4 p4 l4 h4 d@@ 7 k?7?I @J5?4? @K?6k?I@7?I K?07?I@ K?4f4z@4 @>4 404w4@4!b4K=YK=K=K=K=K=K=K=K=K=K=K=K=@O=K?6k?K?6wk?ukK?6k?MK?7k?%K?7Ok?I@4ˀK=Y 44@46m4@4k?o7C@48 k00K?Y@O?k?77:@7K?Y@7?k?o7䀨k? : "HxK?@6PhK?YH Kk?K?@4y#HwK?7`@K?K?Y@O?0123456789ABCDEFtekhex.c$%0781010 %s %-5s %s  tekhexX! X  $, cX!l8X!DDX!|PX!L`L\X!,hHX!<t0X!8t8> X! ,I X! <LLTX! b#X! < X! H HX! \ X! x X! H  X! T  X!t (X!,IX!0e X!484pX! l (~X! tt4>(p@p@>( @pL8 >(R@\$TEXT$ $PRIVATE$$CODE$$LIT$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$DATA$ $SHORTDATA$$BSS$;^#;*QQ0QPPP PPPP%'%(%*%.%,%)%+%-## ##VV1VV)7 8 7  7 786 77 876VV3 30 8VV9v3 3V  7 089VV6kk27 4874Ȃ(36#ȏȂPPPP9%3 ( 0Ȃ2!i4$ 2"06/2" 2!4$9%1137426ȏ882998%';'<'='>'?'@'A'B'C';'<'='>'?'@'A'B'C'D''E''F'&'G'H''I'J'K'L'E'M'N'O'''3'7'5'P'N'E'Q'R'S'' '2'T'U'V'W'X'Y'Z'S' "# (@ 8@p H Td t A A Pc P (8D @\l|  Aw       @l T  U0  QP l U  @  @  T    $ 4 D T d t   A3 ; Po0 TD\h0@,<Td 8hx(Xx tekhex.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. BS$tekhex SD$tekhexC$33 tekhex_inithex_initgetvalue _hex_valuegetsym find_chunk bfd_allocmemset insert_byte first_phasebfd_abs_sectionbfd_get_section_by_nameC$43 _bfd_abortmemcpybfd_make_section pass_overbfd_seekbfd_read $$dyncalltekhex_get_symtabtekhex_get_symtab_upper_boundtekhex_mkobjecttekhex_object_p L$plab_startmove_section_contentstekhex_get_section_contentstekhex_set_arch_machbfd_default_set_arch_machtekhex_set_section_contents writevaluewritesymstrlenout bfd_writetekhex_write_object_contents $0000007F $00000080 $00000081 $00000082 $00000083 $00000084 $00000085 $00000086bfd_decode_symclass$L9 bfd_set_errortekhex_sizeof_headerstekhex_make_empty_symbol bfd_zalloctekhex_get_symbol_infobfd_symbol_infotekhex_print_symbolfprintfbfd_print_symbol_vandf tekhex_vec bfd_getb64bfd_getb_signed_64 bfd_putb64 bfd_getb32bfd_getb_signed_32 bfd_putb32 bfd_getb16bfd_getb_signed_16 bfd_putb16_bfd_dummy_target bfd_false_bfd_generic_mkarchive_bfd_write_archive_contentsbfd_true+_bfd_generic_get_section_contents_in_window%_bfd_nocore_core_file_failing_command$_bfd_nocore_core_file_failing_signal*_bfd_nocore_core_file_matches_executable_pbfd_voidbfd_nullvoidptrbfd_generic_stat_arch_eltbfd_generic_is_local_label_name_bfd_generic_read_minisymbols!_bfd_generic_minisymbol_to_symbol_bfd_n1*bfd_generic_get_relocated_section_contentsbfd_generic_relax_section#_bfd_generic_link_hash_table_create_bfd_generic_link_add_symbols_bfd_generic_final_link_bfd_generic_link_split_sectionbfd_generic_gc_sectionsihex.o/ 996061490 0 3 100644 11932 ` 1@.@,tDD@!lId' |dG!>k?7+`H? 4@h7K?Y@7?k?oK_ 87C4@4z 2h|4K?Y@O?ˀK?Yk?o7W7#7?4@4 8@@@4 wϟK?YC?K?Y@O?k?ok? 77C (k? @4 K>+`H?  @4 $  g?#77 @4 +`H6Hy7?K?77@4K>K? @O?#77?@4=#k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7D4@4+4h47>@k>k>444 4/h74Ƈ/*04t*@47?!7?44@4**+`4*7?!4? _ f)ʯ?6C?!C?#C?% ] m׍ V C?' \ C?) B ӳճ _ C?+ӳ \C?- Y 9 - C?/ X Z W  T Ӳ7K>?  X R 0 4z@6(7k>44z6@4(P4m 04  A (7@  4 " P5? R  M Bb V  B =Ӕ  ?_7a 7 B  T  ]   X 60B S 6 Q  P M BU @V\ m B1 A <Қ U  Q  A ! ]  V סҴA W  W tӕ  Q  W  ~}7 Q  - B R  X ״y = Rr&RR$"r"b&*" JI<0I?H    @  hi<H )X@H 549@7?a@7?a7@4$X75:@7?a4@59$7i+H4  i" n i*0i*8hi,d%AAA X  ] A՝ U  T ѿ     h%AA Y AҶ6A K Ӌ q AA ל A S  _  B ? T  A P8A. V    H \ B ז  | !   hhd$AAAA W  Z Zz T Ҵ S ђ O Һ K Y  ` h$AA Z AՒA \  ,  A  U _՟   d$h H hK>4@4(@K>4@4 @@4z4K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>7?! K>4@4#77@4 B6W+` O  N 1  q k?H6H747@4=@H0h @5ς-K="66 @4 +`H6H747@4"`6z6y@4 +`H6H747@4#77 @4 +`H6H747@4# 7:79@4 +`H6H747@4@AA A A ] A ѯ B  I ҡB6  W v  h4 4@7>07K>;-@ @4zς5K=#77@@4 +`H6H7457@4k?o@7C44@4z!z7?q44@4w!C?q4t!`@+`4?47?s4? !:"?7C?C?  Ңׂ  @@4z!@@4z @H|K>@O?@@4 ˀK>ˀK>@4@@4ˀuK>@4ˀUK>@4ˀ5K>ˀ%K>k?ok>k>k>k>k>k>k>k>k>k>77'K97C@4$4k?a4z@7?a4#4+`4)4 t 0$7?q44@4w#C?}C?C?q 6 lլC?s 9 ҕ  :  3 Aa$8S  M *4@5#@75445@4w#4 "4P5? Z z  K B 4  = S֓  4_6ar  \ |  A "  , ד   6 B b K A !  " ҽ  78 L l  @A <  ! Қֺ  7 M m  @< 6  < y֙  4~6HH 5z44@4w 4z@7?a<5@HHW#77@4 +`H6Hy77@4 @@44K>YK>K>K>K>K>K>K>K>K>K>@O>#7@47?q# 7:79@4 +`H6Hy77@4π @5zςK>Y @4ςK>Yk?ok?6K77#k? Hk?@HyHh|؃ p7K?@4y ZHK? @K?4K?YK?@O?ˀK?YˀK?Yk?ok? k?k?k?!k?)K>7D7&k?1!6H _4 @4 74@4 7K?15@4 hH8  v eHK ZJJ `ςK>ˀK>ˀK>K P7KHy=27K @KY7 xH|04K>K?)K?!K?K?K? @O?k?o @K>4_ ֢ "| 6  a 7W4t|֔ C|֜ !  z|  c ּc?1ց ֘ k?!֢ ֺ k?)  "7?3:P7:?SC| CҢ 7Ct _7Har@ 776| 7uӃ a| vt Ң |c|  uA v"| uT Ӝ u 6sY~744Ҽ| ҳ  T67?!4@4x|(4K>@O?k?ok>k>k>k>k>k>k>k>k>k>k>k>KH7C4I"H44 ? 7?A~HH!H 5 쨀4 Rz#k?x x g?A444@4z ˀK>Y Bg?A44k?4@4z#"44Ԡ  k?д к g?A444@4z#Jk? 4 4z@5#  > H=@H!" 7?k?  *xԊ ԀԆ ԟ k?444@4z ˀK>Y7?k?K GE _ k?444 @4z!k?444z@404K>YK>K>K>K>K>K>K>K>K>K>K>K>@O> 4:@4t%k?ˀUK>Y 4p4@7?Q44@4 +`H6Hy77?Q7@4ˀK>YˀK>YˀK>YˀK>Yk?o7C@40 K?Y@O?k?o@7#0` 4K?Y@O?ˀK?Y@40123456789ABCDEF\%03obfd%s:%d: unexpected character `%s' in Intel Hex file %s:%d: bad checksum in Intel Hex file (expected %u, found %u).sec%d%s:%d: bad extended address record length in Intel Hex file%s:%d: bad extended start address length in Intel Hex file%s:%d: bad extended linear address record length in Intel Hex file%s:%d: bad extended linear start address length in Intel Hex file%s:%d: unrecognized ihex type %u in Intel Hex file ihex.c%s: internal error in ihex_read_section%s: bad section length in ihex_read_section%08lx%s: address 0x%s out of range for Intex Hex file  ihexX!,, X!H,H,X!TtT8$X!HD5-X!PbX! 4 04\,X! ` d`h0QX!DtX!8D8X!|X X]OX!9X!(x(IX! 00WX!Ph >(l@ls>($@p>(P@x$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$CODE$$CODE$$CODE$$CODE$$DATA$ $SHORTDATA$ $SHORTBSS$;^.;*QQ0Q795 1 [[6 8``v48 87 69ee-7u86777|4 18``v41 1``v3``v``v``v718``v41 089ee6651  87ee97J8``v21 128``v21 178878/Ƞ"s9##" =#":#BA# "##0# .9! ȍ288``v31 7&8(%'+','-'.'/'0'1'2'3'+','-'.'/'0'1'2'3'4''5''6'$'7'8''9':';'<'5'='>'?'@'%'='>'A'@''' ')'B'C'D'E'F'G'H'A# (@p 4@x @P `/t Aw T  , D  Tdt  3 Q g  U< UHG Uh        {  Q   A00H@Xh(Ddt,<Pp|$@dihex.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.SD$ihexSB$ihex ihex_inithex_init ihex_mkobject bfd_alloc ihex_get_bytebfd_read bfd_get_error ihex_bad_byte bfd_set_error __SB_masks_isprintC$44sprintf dcgettext_bfd_error_handler $$dyncall ihex_scanbfd_seekbfd_tell _hex_value bfd_reallocstrlenstrcpybfd_make_sectionfree ihex_object_pihex_read_section bfd_assertihex_get_section_contentsmemcpyihex_set_section_contentsihex_write_recordC$51$ihex_write_record bfd_writeihex_write_object_contentsihex_make_empty_symbol bfd_zallocihex_set_arch_machbfd_default_set_arch_machihex_sizeof_headersihex_vec bfd_getb64bfd_getb_signed_64 bfd_putb64 bfd_getb32bfd_getb_signed_32 bfd_putb32 bfd_getb16bfd_getb_signed_16 bfd_putb16_bfd_dummy_target bfd_false_bfd_generic_mkarchive_bfd_write_archive_contentsbfd_true+_bfd_generic_get_section_contents_in_window%_bfd_nocore_core_file_failing_command$_bfd_nocore_core_file_failing_signal*_bfd_nocore_core_file_matches_executable_pbfd_voidbfd_nullvoidptrbfd_generic_stat_arch_eltbfd_0l_bfd_n1*bfd_generic_get_relocated_section_contentsbfd_generic_relax_section#_bfd_generic_link_hash_table_create_bfd_generic_link_add_symbols_bfd_generic_final_link_bfd_generic_link_split_sectionbfd_generic_gc_sectionsstabs.o/ 996061496 0 3 100644 5560 ` 1 @   4 4p "  |< G!rk?77\k?@ k?K?@4 0@K?K?@7 K?Y@7?k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=KH7H7Ck>)$7$k>1k>Y,Pk>aJH@,:0@8@F 4,$07>!0N1 9$G &J+K>1H ǼK@K>)HX +`4!+K>1HX @+`4<+jk>H!4k>40@4z (7@@ (7 44@4+`H94@4("4@4zh(K !5 !Uk K>)56H&F0@"6.`Hk>907>!4z0N0&IIk>A49? @7k>IK='7K>A k>K>)4k>QK>1@@IHk>Y@JHk>aK>Y@ 0jK>)K8H44zk?@K>Y&(@K>1K:H4k?K>a@4z%k>!K>)44K>YIhH  6ՄK>Q+`4)4 4 D4 PI$*@ !k>!Hx4KP7K>! 4? "bHuJP6:7 B"@I? x . 6'BZ  :6R&BZ ?6RI?6W?6B ?U@X6144͂x5Ax&&j6?5784k>HwK>!4K>aJP 7 k>iK>94HZ@4M! 444̀@5B? *% 6?61&B?K>96OK>i44@5" 7J *J4 @J1 ?@4 @4z!K>Y gK>IK: =<5@4!JJ4滭5K>Y@k>YK>ak>a@K>AK>)K>) W iR@@0K _K>1@0k Jq ?_jq K>9K>9@I:I("`j@K>4z@K>I <K>Y @@K>YK>a @@K>a4K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=K>A !(4K>AP4?K>Q7J6k>Q77_` 76977 77(`770@777 m79 !ς%K=YςK=YςK=YςK=YςK=Y8@61@@I?@@I?4?X u59g54?E# 7:0@4k?/,opk>k>k>k>k>k>k>J7D7K& HK>HvHk?44HyX@HwPK>YIG HHxH@HH % 5KV`H7H H?HHtH 445J @4A,  @!B 44@59HJ`4 @7A< ҉%!HJ`k>@HK>477H}X7H&E0@07>HJvx4 0N0'7?745)(5JHs@ H|@k?44HyX@HwPK>YK>K>K>K>K>K>K>O>@/0,#70@4*H#70@4^H 4:0@4vH|@k?oK#!k?K?Y4@O?KPk?@HzHb(HSXK?JH @H(KX4KKP 4 @K? ˀK?YHy@K? ˀK?YH(KX+`46>@K?Y4@O?#70@4H(@Hz@4zK?Y4@O?7J K?KH"K@  @7?J 7?#7/@6'F0@00N0'  7 `7 `'7@7??UUUUU\ ?UUUUU\?UUUUU\.stabstrstabs.cX!PP X!$P$,{X  2 @8X!(t(D6X!  P&X!  \>( @h$TEXT$ $PRIVATE$$CODE$$CODE$$LIT$$CODE$$CODE$$CODE$$DATA$;^6;*78(ȖTTTT759YY8 7 7 8 6  9 ` v6 v``v99 7 7 1666`` 2 #(9v2 Ț8v6vv 26 87TT211 Ƞ!' Q(H`0 UxS  @ @$@L\ |  0 Uw8X d 00 A 0 U   8stabs.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.stab_link_includes_newfuncbfd_hash_allocatebfd_hash_newfunc_bfd_link_section_stabsbfd_abs_section bfd_alloc_bfd_stringtab_initC$40_bfd_stringtab_add L$plab_startbfd_hash_table_init_nbfd_make_section_anywaymemset bfd_mallocbfd_get_section_contents $$dyncall __SB_masks_isdigitbfd_hash_lookupfree_bfd_stringtab_size bfd_assertS$38DD$_bfd_link_section_stabs_bfd_write_section_stabsbfd_set_section_contentsmemcpyS$41DD$_bfd_write_section_stabs_bfd_write_stab_stringsbfd_seek_bfd_stringtab_emit_bfd_stringtab_freebfd_hash_table_free_bfd_stab_section_offsetS$43DD$_bfd_stab_section_offsetstab-syms.o/ 996061498 0 3 100644 5356 ` 1@ T4 8HG!7_?4?#7 #@7 @4<#@7 "@60"@6@"@6P"`@6|`#@7p#@@7\# @7<#@7"@6#@7 @4<#@7"@6"@6"@6"`@6| #@70#@@7\@# @7<P#@7`"@6p#@7 @4<#@7"@6"@6"@6"`@6|#@7#@@7\# @7<#@7 "@60#@7@ @4<P#@7`"@6p"@6"@6"`@6|#@7#@@7\"`@6|#@7#@@7\# @7<#@7"@6 "@60@4GSYMFNAMEFUNSTSYMLCSYMMAINROSYMPCNSYMSNOMAPOBJOPTRSYMM2CSLINEDSLINEBSLINEDEFDFLINEEHDECLCATCHSSYMENDMSOALIASLSYMBINCLSOLPSYMEINCLENTRYLBRACEXCLSCOPERBRACBCOMMECOMMECOMLWITHNBTEXTNBDATANBBSSNBSTSNBLCSLENGSETASETTSETDSETBSETVINDRWARNINGX! X x,$TEXT$ $PRIVATE$$CODE$$LIT$;^:;*Ƞ67ӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶӶ%%4%/%0%1%2%3%5%%%%%%%% % % % % %%%%%%%%%%%%%%%%%%% %!%"%#%$%%%&%'%(%)%*%+%,%-%.##"##"##########"#####0 , D T d( t4 @ L X d p |     $ 4 D T d t     $ 0 < H T ` l $x 4 D T d t           , $8 4D DP T\ dh tt   pstab-syms.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.bfd_get_stab_name $00000001 $00000002 $00000003 $00000004 $00000005 $00000006 $00000007 $00000008 $00000009 $0000000A $0000000B $0000000C $0000000D $0000000E $0000000F $00000010 $00000011 $00000012 $00000013 $00000014 $00000015 $00000016 $00000017 $00000018 $00000019 $0000001A $0000001B $0000001C $0000001D $0000001E $0000001F $00000020 $00000021 $00000022 $00000023 $00000024 $00000025 $00000026 $00000027 $00000028 $00000029 $0000002A $0000002B $0000002C $0000002D $0000002E $0000002F $00000030 $00000031 $00000032 $00000033 $00000034 $00000035$L0C$12dwarf2.o/ 996061510 0 3 100644 14808 ` 1(,9@"L"&&`(,,O(Pb2(PG!63@C<C?4 @7?k?7K_7:Kh7K?Y@7?k?7K_7:KP7K?Y@7?k?7K_7:K87K?Y@7?@7<k?ok?C?7#7 :4 44|K?YK?@O?@4z7 444 t@]} |\67_79@444 t@]} |\76_794@`2@?v@?7@? \@k?77_Cx H7: z "46@40K?YKJxK87K?Y@7?KKJP7K?YKK?Kh7K?Y77?"6/''G0@00N1 9$G 'J 4 *KS @K(?@4@7?k?/,/-o`k>k>k>k>k>k>77%k>K$ K>@4 $74@4P@4 +`H677@4Ȁ4K>@4Hy % K>74@7?aK?a7$X & "6/ ' 40@K>K>74@7?a K?a 4@K> 4K>4@7?aK?a ' K>74@7?aK?a7 ! H *7H @ ك"h H H 4H77?ahH @K>K?a K>74@7?aK?a7 >G 7?E'AE0@00N08G'IHI   h(fHw Hh K>4@7?aK?a77@4!8 <40 4HHhy @K> |70ȀHa k?44@K>0ȀH} @#7@7@4 +`H6Hx 747@4Ԁ44K>YK>K>K>K>K>K>O>/0-@/0,k?ok? k?k?K7%6k?!K97C7YH"`6WH7X?4? 4@4 |@x(4K?!@4K?!4@7 4K?!7@4 H  eK?!@4K?!4@7 4K?!7@4 HD  eK?!@4 |K?!@4 |K?!@4 |K?!7?@4 |K?P4K?!@4K?!77?@4 K? 7K?!@4 H$  eK?!@4K?!4@7 4K?!7@4 H  eK?!@4 |K?!@4 |K?!7?@4 |K?4K?!7?@4 |K?P4K?!@4 |K?!@4 |K?!@4 |K?!@4 |K?!7?@4 |K?p4"6@6P@4 +`H6H77@44K>K?K?K? @O?k?ok?k?k?7$7FKZ76@40H0h0K?K?k k(K?YK?K?K?@O?k?7K]77?r"6@6@4 +`H677+`4<K?Y@7?K_(4^C?K?Y J KS 7?u @KZ+`449 @7EK?Yk?ok?k?7C7$7_K$ ZK x7K?KHz @ Z d `he @K?YK?K?@O?Hz@4H} |k?/,/-/.///0/1o k=k=k=k>k> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>YKB7%7Ck>K6(,z 4@4Z@@+74@4`@4 +`H677@4Ȁ461K>@69ӟh61 R-Jk?4 4k?5y6@5W 4 5n4z5@5x X@K>69@7?$E0@0H7>7K?0N 08G'H  *7 H(@=+0h(HH(֙  RK>69@7?HH(  <K? 1 69K>@7?HH(74 K?  69K>@7?HH(_S K?H79HhK>@48K>74 Hy@k k(k0H(HtP @44K> @44K>@44K>@4Ә7>K>444@' K>@44K>7@44K>59@ӇӈK>@5H5)7 K>@59 \5)b?5JK>59@7?! 7"b6/ '$E0@0H7>K? I 0N08G$IH I  *7 H @ &xh H5ah59H 7?@K>?7K? K>5Y@7?"@7"6. &$E0@0H7>K? * 0N08G'H  27 H("@@h(%HH(ս K>5Y@7?HH( K? J 59K>@7?HH( K? ) 59K>@7?HH( |K? 5YH7h7?@K>=7K? %7>!5, "6/ '!5&&10n4 4@4744 44 4 K>@69ӟ74? 7 61k? Wk?7>  46' 1@1@0N1N 01!8G'K9W'V F  * + 5y@5W 4 5n>@%G4 4HHh0@K>h(70Ȁ2H0k?44@K>0ȀHuPH0@#7@7@4 +`H6HyP7H07@4Ȁ`4ȀP4Ȁ@44z@69@sx|e q 44K=YK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> K>K=K=K=O=/01/00/0//0./0-@/0, `4z@4yP@4 +`H677@4Ȁ4k?45yk?6@5W<@ɀ5nK>69@7?7>\K? &P9G&XEXt]@K>69@7?K?:% K>69@7?K?7 q @4@K>69@7?K? Q }@27> 0N09W'Gu-@K>@69$ KZ0@ K_ @0RK( Ky KT4B7K @?K(4@ˀ@K4K@@ 2K_? KW7"KZ@?@@4KY@4k?ok>k>k>k>k>k>k>k>k>KD A7Ck>KIX44E4\4$4"7?aK>@59K?a7 0Hy0@5z 7I\!*4 IT!4 IY , 7?y57@4xK?y !@7 ! !IwK?0 IX `4z@4y@4 +`H675y7@4ˀK>YK>@4 Hup|h|pK?( sK? zK? }IX5 gIY IA 4=7?a4K>YK>K>K>K>K>K>K>K>K>@O>k?ok>k>k>k>k>k>k>K)7$ 8 597F@64Ӄ 5)  "4@59ȼ0 ' 4@597 ' 4@59Ӈd 5* !Z44@4!7Ȁx4 4:@4 #7@7@4 +`H674y7@4Ȁ4!@5Z@5Y@4 +`H67447@4ȀX4+`"H6647@444K>YK>K>K>K>K>K>K>@O>7?Q4@5YK?Q7 xJ ! 5:@59P@4 +`H6747@4Ȁ44@59 x7!5@5@4 +`H6747@4Ȁ]44@474cxk0k`Hg 464$4 H} 7?i4@4K?i 7* ?r? BK?y0h(Hz4FoH} 5hX4hHK?yhPK?y K?y}h K?y Z4t@5Z \8*C?4\ C0^7h@K]8 @47_K K8"K?@@4@4k?ok? 7Ck?KY8k? !k?!Hzh RH}H K>@4z h|h@4z @HzhK>K?@K?HzpK?7@K?!7 4 4K>K? @O?ˀK>4ˀhx84ˀhw84ˀh8k?ok? K#@KC z Hz@4 X@@4Hz4@7 Hc`?Hz44|K?YK?@O?k?ok>k>k>k>k>k>k>k>K=k>K>K*0I W  `K> K> k>K>#P 4!@K>@48#P7 K>@4#07 04K=HK>@ ?7K>@5"  K>@4 7I*H rk?H459H  K>@  @H +  J  K>@59?U7H h ! H"H BK>5@59!@I?5HH5!@K>7Hk?559k?4x@4"@HH!m@4K>YK>K>K>K>K>K>K>K>@O> 0#7@4 wˀeK>YˀUK>YˀEK>Y#@7Z@4 fHˀK>Yk?559k?4x@4K>Y@K>7H  >UhK>458@4H i h>7H  I =K>5@59=@k?559k?4x@4K>YςK>Y?k朕y?k朕y??ədwarf2.c.debug_abbrevbfdDwarf Error: Can't find .debug_abbrev section.Dwarf Error: Abbrev offset (%u) greater than or equal to abbrev size (%u).Dwarf Error: Invalid or unhandled FORM value: %d.Dwarf Error: mangled line number section (bad file number)..debug_lineDwarf Error: Can't find .debug_line section.Dwarf Error: Line offset (%u) greater than or equal to line size (%u).Dwarf Error: mangled line number section.Dwarf Error: Could not find abbrev number %d.Dwarf Error: found dwarf version '%hu', this reader only handles version 2 information.Dwarf Error: found address size '%u', this reader can not handle sizes greater than '%u'.Dwarf Error: found address size '%u', this reader can only handle address sizes '2', '4' and '8'.Dwarf Error: Bad abbrev number: %d..debug_info.gnu.linkonce.wi..gnu.linkonce.wi./X! X!, X!((8X!(D(D%X!(l(P4X!\C X!PPhNX!l<<t^ X!`(`i X!tX!llX DDX!OXX!$$$eX! Hpp X! 8&X! ` @X!  xRX!lTl X!@88" X!x/)X!8``XvX!@@(X!X4X!x,x@X!$  LA>("@ @XR$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$DATA$;^B;$v6v6v66Ȍ3 v6vvȏ%%%%%% %!%"%#%$%%%&%'%.%(%%)%*%+%,%-%.%6%7%8%9%:%;%<%=%>%?%@# #".#J#1#",#F#)#-#a"#GȌ78ccv1178 7 77798ccv31 Ƞ/7 77877878 878 8 7778 8ccv21 7Ȍ8ccv1p2937Ѐ(Ȍ78ccv117 403487 8 7777778B7  8 A717#40 798ccv317 8ccv11408 8 717  8 7 9 Ȍ8ccv217" 7 777 8Ȍ2G8ccv21ccv3ccv 8 8ccv7ccv797H   756E9C8D Ȍ7L68M  77K7 9 7I 79JȌ2G 79F 7I ## A( A8  AP d AtG Ao Q Q Q Q+ A     A0  D  Q` t           U4  H x X  h  x d            X         (  8  H 0 X D h X x x   T A ; @ P  A { P  < D (p 8 H X h  x  @  D  p UW Q   U<P` Al U[ A/0 Udwarf2.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. read_1_byteread_1_signed_byte read_2_bytes $$dyncall read_4_bytes read_8_bytes read_n_bytes read_stringstrlenread_unsigned_leb128read_signed_leb128 read_addressC$44 _bfd_abort lookup_abbrevS$45DD$lookup_abbrev read_abbrevsbfd_get_section_by_name dcgettext_bfd_error_handler bfd_set_error bfd_allocbfd_get_section_contents bfd_zalloc bfd_reallocS$46DD$read_abbrevsread_attribute $00000023 $00000024 $00000025 $00000026 $00000027 $00000028 $00000029 $0000002A $0000002B $0000002C $0000002D $0000002E $0000002F $00000030 $00000031 $00000032 $00000033 $00000034 $00000035 $00000036$L4 add_line_infoconcat_filenameM$43concat arange_adddecode_line_info $00000059 $0000005A $0000005B $0000005C $0000005D $0000005E $0000005F $00000060 $00000061 $00000062 $00000063$L10S$51DD$decode_line_info!lookup_address_in_line_info_table lookup_address_in_function_tablescan_unit_for_functionsparse_comp_unit bfd_assertstrchrcomp_unit_contains_addresscomp_unit_find_nearest_linefind_debug_infostrcmpstrncmp_bfd_dwarf2_find_nearest_linesom.o/ 996061556 0 3 100644 72564 ` 1t@ʀYذذH~G!=}@!6?  @ =}@YW@ 7w@7?@ k?o79?y@WW@!K?Y \@O?4 ] k: @ 7\44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"`6} : (K?Y`K?Ycc4xb4 7#84zCk7! : `ӣ44 7 Cu0K?Y#47@4K?Y4|@O?=7?4?#7 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#7 7C7:@4` C4@a C ^4Y@@ # C#7 @@ h C@`H C"6@@ c C#7 @@  C@` C#'76@  C@` h C#7@ 8 Cz0K?Y"`46z@4K?Y4|@O?@@@@k@ k@(k@0@k@8K k0K(k8Kk Kk(KK@k?7 ҏ" K]KVVKS]KBBS&! KT0KW kW0K_TKTkT KW_KU8UK](k]8K\k\(WK?Y@7?$?U@KY KXYKUkU KYXKS(SKAkA(uY"46 @4EK?Yk?ok?7#K7 (k?@4x H!H *K?@4x H H  8@K?@4x @H( H0 8@K?@4x @H8# R4?K?YK?@O?ˀK?YςK?YτK?YφK?Yk?ok? k?7K>7$k?!64z@6 P77? H6 K?!@4cH4|K?!4z@4H %  e 4|K>K?K? @O?k?ok? k?k?k?!k?)k?1K>7'7E76k?4>4 4_ H? Kx744y4@4@74 Hy77  w4 ^ڀ k?4?B 4>4 HKx744y4@474K>K?1K?)K?!K?K?K? @O??44 26? Hs6t] t4 hk?78? 7]0 44y4@4Ȝ46?\78 HJx4744y4@4Ȝ]4k?ok? k?778K>k?!47?p7E 46 44k?@4K>K?K? @O?B ـzk?44 H7Kx7K?!44@4EK> ׂ|k?4 47 HJx7K?!44@4K>44 HKV`77K?!44@4 K>k?ok? k?k?k?!k?)K>46k?1J7C7$46``>4=Y4=ab4=b4>B@ WZ4? K>4K>k? 6 HJ 4 K?14z4@ 744K>K?)K?!K?K?K? @O? Y>9    < HJ07H~ Z ZJ  r46 \r44 `P  K>4z4k?K?1@4Ȝ4й Hh4Ix47K>k?4z4K?1@4 Ȝ4@ H4_ W *_ ?7@@4?K?K? K_P K7  k=@4k?ok? k?k?k?!k?)k?17(7K>k?A6@40K?A7@47` `h4|&RK>4J K0&*K^ K H 4^k04|4"ԃ܀Zր*҂ʄ"b́ȁā* d ` `8 K?A@4 |0`* 400   d ` K?A@4 |0`4 d `8 K?A@4 |0`*4 d ` K?A@4 |0`4 d `x K?A@4 |0`j4 d ` K?A@4 |0` 4 d ` K?A@4 |0`4K?A@4 |0`j 44 d ` 4"4 4"4| !K?A@4 |K?A@4 |K?A@4 |K?A@4 |H @Hz Hs`0` 48 44 0Hv4Ha 8HzGhd 0@  @ Hh`(  z0@N`  @ 4|K>K?1K?)K?!K?K?K? @O? "4 4"9'4@4m  0 ?O4|4N-  ?'4|K?A@4 |K?A@4 |K?A@4 |K?A@4 |H @Hy H} `]4| 48 440Hu4H|Hy'hd 0@  @ }h`(k?74=` 9 Z+` : 4? 8 P k?# 7: k?@4 lK?K?4K?Y@7?k?ok?k?k?7C7$7@6!h`pH4x hxpD7=`4?#7 Hupֿhup4@4zHy<HvJ!jHw `4J U2HHJ0J@ Y  4J?@HH HPhHuJHHˀK?YH|p4 ZhzpHap44]h}pHvp?uhvpH|pןUh|pˀ8K?YHt hzJHP4*4@4zHh}Hvj8Huj0Htj@HHtj`H HsjbHHHb hWPH% HsjyXHbHZDD@H|K?YK?K?K?@O?k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=7&7EK:@74 7H (@H4G @4G@H44z@4H<'H` 'X44 H4 P4 ?4 ;{4 4HX 4 @4g 7>44H@4&K> c @k>7@4&7K>@54@5&X7C> _I  _i K>5k?C>ӹ?C>C>@x_%K>%K>Hh s 4 @4ez44P7>@4%H@K>Hh Z '  ] 4@4dK>i0K> iK>@凟$i`47?@4PK>#444P7>@4$BK?# @k?7@4$7K?@6:4@69#7C>ӓk?6:C>C>Ӹ@5#h@@47?j5C>ҿ]7?4$"##ғ0J< A0j! C>Ӏ J" _?j" C>J? _j? C>J! ?j! K>و 2K> 0J6 0 j7 K? BJ< ן_j< K? j=J6K?j+xK>K?)T`:4B7>7?K>j:0K>j"@K>j!HK> j3K>@Қ凟 j<`K>6_4K?) i@`iHI0K?9YK?A  i@IK?) 8K?1 iHH`55H@ !x7 @@4z @@44K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=J7 8j7 J9 ?j9 J8 j8 C>@@C>J? j? H J4@4 H 4?@+`H744@4 4P4? iЯ_6`j  i65T i66 j iuЀ @@4z @@4ς=K=Yk?o7Wk=44@7=4!4G=4 4 c4CG=7=4?"6? K=4@4bZK=7>4@44"H@K?9K=@4bBK=7?4@4"8@K?K=@4b2K?K=44@7=4 `@@@#4K<@O=@@!ˀKK=р :K=44`@7>4`!@K=7=@4x"p@@4ˀK<@@!ˀK<@@! ˀK<@@!ˀeK<@@ ˀ=K<@@ ˀK<@@!JˀK<@4@@4ˀK<@4@@4@@4@@4@@4@@44@4ˀK<@4ˀK<@4@K=7=7>@4wUK@ k?!@4K?!74@7+aH744@4yHk@`!P4P4? K! k7( ^k7H_6`  KРk(Р^kH6 KЀk(Ѐ^kH6 K`k(`^kH6 K@k(@^kH6K>K?K?K? @O?k?o7?(a4>hdhehfhg hh(hi0hj8hk@hlHhmPhnXho`hphhqphrx+7Dk?1KI4%?!hyI<4hxK`4hgKH4@h`hhHj &h`+`4' @ 4H4)4 lHz@@ 0@HzKZ@hz?@H`&5z@@%@Hz@5y%I} CItJ 4?pk@KH6YȀ`J446Y@4&@@@44k?J 45@7?17JK7>`4?  J 57?@4? 2 4f H5K`J47Ixߠ@5Ixp J<KA 6?@'k?H5 K`J:747?15@4ɜhIbxQEk?J56:J4TB 6 HH6x747?15@4ɜIbx1F*k?J56:J46 5 HKx747?15@4ɜIbxIwHu44J j@Hl@ bk?1@4I|x4 44 4Iup JKKۭ@K(4 K?17k?15Ibx5¿wIupAp(0GIHk? 7?14@5 445@4'RIsK?1HyJr jOHhyIk`:5zHuJhuH7hHvWHzHmHn4 Hb?HrxHqpHphHo`HnXHmPHlHHk@Hj8Hi0Hh(Hg HfHeHd4~@O?ˀeHb?ˀUHb?M7?k?45k?7?1@6ɜIbxJ *k?45@7?174@8`BJJt  K?17P5k?14ZBk?J47?1K 6b@4 @5ɜIbx 44: @4&UIbx4J_ :J *k?45@7?174Z/"k?J47?1K 45@ ɜIbx#47 @4`UIbx"`46z @4Mk?;Ibx K?17/5k?1JHO K?165k?1J u 4`k?74 J7?1 5@4ɜIbx7 J:5 HJJVx747?15@4ɜmIbx 44 7?14k?@5ɜIbx 54 56: Hk?HVx747?15@4 ɜ}Ibx K?16r5Ek?1!45 @4Mk?ˀ]Hb?k?o7hd? he?hf?hg?!hh?)hi?1hj?9hk?Ahl?Ihm?QB7Ehj?q7K?K?F~4 ` >k?k?74@7cH4 H"r4`4@@ @@4"@@HHl?q K 5  745Z5@4"5 @ W hw?q h?qK?K?~@ ^k?k?75KHJ`5y57@4Hؗ K2@K 5)"@2@h)85kH@5z5 ( ( `5)"@?5kH=4 K5Z44@48 4~Hb>Hm?QHl?IHk?AHj?9Hi?1Hh?)Hg?!Hf?He?Hd? @O?ˀ4~ˀ}4~k?o7hd>he>hf>hg>hh>hi>hj>hk>hl>hm>hn>ho>hp>7Dhv?I76K?K?~4`  k?k?Hj>74 @7IWhw?qIXhx?yIZhz?I]h}?4@4d "`4 4k?q4 ` j @5Ho?I6  7446@4$*5 @ W hw?I h?IK?K?~@  ^k?k?74HK`59575)5@5:Fp5F JBʅB#@0H@0I(@0 5HK(H5  ( 5?5)5JH= j !4 4 ` K@Hm?I5 -7445@4"5 @ W hw?I h?IK?K?~@ ~^k?k?74HK`5957 5)I@5: 55hHX  ( 5?5)5JF 444@4 ˀ4~׀44~Hb>YHp>Ho>Hn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>HI(HJ(u(ˀ54~H|>ς4~k?ok>k>k>k>k>k>k>k>k>k>k>k>47Ck?9KJ44IOi84KZKSj`@Hup  `@HzKL44 PI@5`i@4`HkIf D HyK!!44z@4gHwJ44J@7j@4wHlI@4&@HbHU44wHSJ7H?5Jz@ H jt@  HK@7&*HxK!44z@4eHoI44wJo@5jx@4HjIZ@4%HaH644wH=J6h?  K@ ( k@5HoI@6%HK4zjgHaH*@i@7H|K i'XHi Z 4zI.i`@ G HkIa 7?9h'hHn ; g Iip4zHvJ4@k ˀK>Y?I@?H( _ R@h(IK A(6FiIHA(9F IHIHuJK?9h)HkK?9G Iii'HtJh@HK( #:#XHiHtpHn "4I "k PHfHtp @'*44?@4zGˀK>Y! @4 (@H@4?@HupHj "4 " !5Z@@ 4@5Y IL iDIW @H4INI AX(8EXiGI_HPIJIMI AW(7EBILI_HI IJ@>5Z>]HHtpˀ8K>Yˀ(K>YˀK>Y׀4K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>ˀK>YK4k4H!@4  @5: (4I)@5:?@Hm #845@@"5:@5"I ʀ Hwp  2__? 4_2H @0I/0@0 @0h I !2H80I.00h00h8I0Hup  rI0 _( HW h I0H(  h(I0 . iI 4Htp 97I_@I@H h45Z @4A(445Z @4@ H@ I@ Y  h@IKT IK3 `I<5<]I)Htp45: @46⚅@45: @4FILI 44+` 4:#44@4w ˀK>YHvJ4I iHyK3j`xHxKkHuJ5h'Hk?ok>k>k>k>k>k>@7CHvJ74K?H Hx Hwk?  HaH'_ ;F hHa7?1k?H64z4jH}K(@k?(HiI)4zK?1i5K?1Hy @HxHh; I i&7?Y4z@4(RHgH4zK?YiH|K?Y K@kH(HfH44z@I9hgHga44P@4 (@H@4?@Hi !25:@@ 4@59 I? HJK  *CֿHKHKW4P4J 6j 4wI"HZ 4FI3@Jz &RI) >5:4~]HHga44P@4 (@H@4?@Hi !:5:@@!4@59 I6 @HK?K  *Cր HKHJ4P4K 6k 4wI?K 4I4@J $I) >5:4~UHHuJ44z@H9Xd:`He4H@4 (@H@4?@HK4H4@4w#_uHHK( rKK94@4zc`@H|K(4H4@4w4H#*Hip4 $#HvJD"J@4@@4zHzK]44k@4zcHK44@4w4"H}p !BHvJ HthHHuH(4_JJ_hPH@ h@@`h@H h(HsJwH y JHbH8 8A@J84@4za44w4`@44`!4K>YK>K>K>K>K>K>@O>ˀK>YˀK>YˀK>YˀK>YˀuK>YˀeK>YˀUK>YˀEK>Yˀ5K>Yˀ%K>Y@4z4(\ "HwJ4(@@4zHtYˀ}K>Y@4ˀ]K>YˀMK>Yˀ=K>YK]K6x4@J?J?  J?J?  yJ?J? a J?J?  AJ?J? V <J? 5  53   J  J(J0  J8J@  yJHJP a JXJ`  AJhJp V <JxJ 5 @6k?ok?77$448@4zH4 |H K8  `4 aH0 :+`4: Y8_4p w 0w@  rw24 xH8 zH@h}(X4 4 v 4 y 4 b 4x u 4X z 48 } 4 s4 0 tH +`4? h `H4  "J @4 xJ 4@^ wH J Ҡ^ 8+`4!7 " `H K<0(HJ sH K<0H ht HҠh`0Ҡhv0K?YK?@O?k?ok>k>k>k>k>k>k>KW7DJKE Z K=k>4z@J@2F`!44@4x!(44 KX & 7?a ] 4@5K?aAZT 5)( ZK?iAV VK?qE\ו ӓe\K?y^ __aSK?K? BiB K? ߉> _K>4@4 44y4@4  @@44K>YK>K>K>K>K>K>K>@O>ˀK>Y @@4ς}K>Yk?oK_ 07C@4z4hw@4z@4zK?Y@O?k?oK_7CK8 K?Y4@O?K` @4 ˀK?Y@@ k?ˀK?YHwJ`4@7HKP4@4z@ ˀxK?YHzKY`44w@K?HK` 8K? 8k8K?Y@O?k?o@7C0ϟH7 K?Y@O?k?ok?KXp4  C6 0 KC` XK$ H0*Hw@ @4z "Hc`?@+`4#4|K?YK?@O?KCK<` HӄHsЈ @4z?4|Hc`?@+`]4#k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?YK_7C4K0KG00@4z Ha I H&8@5 754@4 J @52D ZH|KH4@4z@*445@4w  @@44K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?   4h4+`4*+`4+4 H!A5ҿ 0 h0 4h0 4h0 4h0 4h0 4hh0 4Hh0 4 (h00 h00h0E7 h8I<  I" h A4ҟ * j‡ RA7Hh@4 hH`hHHYh@hA8|H|hA7|怪"r  ZA3A<Hӂ@ h ??@0h 0hA6 h 0h A3`?H_H`?hA!@@57? !@H KY@H!H?h4`5)((@7?!5-`4f&00N8E$EHni0 @4ςmK>H׿?h4z@59h K0H -hH_h4z@59h K0H hH50@4 2HH hK- H5@@4>4`Hhk?ok?7C@7$0ϟHxHt`J0z_P7_? 7?4?_6``R  6`7` 7`77`  4 H|K?YK?@O?k?o7C@4`0K?Y@O?k?ok?7Hk?  2# HxK?@79PK?Y#@7Y`@K?"HxK?@6p#HxK?@7K?YH K0+` 04$#K?@4y#HwK?7@4K?YK?@O?C?04C70H4@k?/,/-ok<)k<1k<9kk=7>K;k<+`@4,k=K;+`4-k= +`4("`6t. . !@5Ak Kk=K=k>QKB?, Y  k=AB0I61B=61$Ӳ !*6T? 4B7$ % @B"6R?$Z \ x@B"61B3 XW  6?9 $pz Ӝ?@I B74# <?>@46W??4U@ ٖT–7P47?@Z  Z4_6R?`r @@֚ 4S@s  \@ל  ]] 4 RZp @@I7 B784_ *4? K>Y w4J!B4c K=96k=944@444@7>K=)k=K< K=!@K:K=9K;K4c K=!J(K=!@KZHK=!j(874k9 `4`K= K=A 4t4 4ҏ4hs7? "Ha44SHhs "H4 \h| "Hr4 _Aha!Hwhw7<V w'AE0@00N0'II \  66xhu0@8@E07<0N0$1 1 Y 8ֵ     hv Hz7Tpht7<_Ht'YE0@00N0'@@ Z B_BZ   huH} vB *Ϡ *@K<0K< K<45Z @4%zI_@5I5B8K>Qk=B84@K< kIU r4l64`K>Q% q4?˚k=9K=!JK=1J! K> H6P 7 |k?ok? k?k?k?!k?)K?x7#7EK6J7!@6 @4!(7HKX44Hy@ 7  454@4 k?44k?45@4h|xHt ςpK>?@4 k?9ˀ8K>ς(K>ˀK>׀4K>K?)K?!K?K?K? @O?HsJuk?1Hzh@?-HxςK>k?K?147k?@4w@K?1Hb @4K?9 hahk?oK? ǿH7#44@4y0ϟHwx64K?Y@O?k?ok?677#4@60ϟHbxHwh 4X?P7? 6 4?_7?`Z  6 45 6 4 6w 4  H|xK?YK?@O?k?o7#@4(h|ؓ h`K?Y@O?K_KX 2KKx K48j84@ˀ@k?ok?k?K_67$K 7HK8 z@4 @@4 B4@4Hz\H}K 2׀4K?YK?K?@O?HJy@4HuJK JX ς}K?Yk?ok?KW7C7$J ZHK:X B4@4HHK@ *׀4K?YK?@O?HsJy@4ςK?Yk?ok?k?k?KT7C7%J7 @6Hz@4HxHsJ Hz4K_C cHuJC=פ =HbHD HeHK?K?YK?K?K?@O?ˀK?Yk?ok?k?k?KU7D7#J7 @6H@4HHJ H4JwB% 9HJK?CX cHH" CK?YK?K?K?@O?ˀK?Y@kY0k?ok? k?7C,!@k?!@7RT64ր7 $4 @4zHb \HaH?" 4 DHt J U4HKK7]kHeHHsJtK?!@6842!"@7RU64֠ $74 @4zHa <H|K 4DHs JwHzKWJ7jHxKHuJK?!@64K>K?K? @O?ˀK>ˀK>k?ok? k?k?k?!7%7C76@4H!7 P@@47@4z !7@4 P@@47@4z !H7@4 P@@47@4z  7@4K> P@@47@4z  7@4Hk(4K>K?!K?K?K? @O?ˀK>ˀK>ˀK>ˀK>ˀK>k?oK?k?` k?K: K?Hw K=K?4@  `@K?K?4@4x *4K?Y@O?ςK?YˀK?Yk?ok? k?7C7%k?)KX 06@4z4h}@4z@4 ZH H@HK_ 44zK@  2׀4K>K?K? @O?K>k?!4w4@K?)K?! |(4K>k?7@@K?Y@7?@4k?o `4z4y@4 +`H677+`@4:@44z @4)K?Y4@O?k?o+`@k?4#Hy 2@K? B4cHy ?@4~K?Y@O?@k?oK_ 7CK A+`47 @+`48 @Hw@ +`49?  ZHs0b J4Ht@@ӚӜK?Y@O? j@KHt4444u4~e4~k?ok?7#7@7: ӟ4? 8@Hz KW0Hx  Hs Hs K?YK?@O?k?ok>k>k>k>k>7#7@k>Ht( @7?i 7Hs(! Hy(44@K>H( !z!H44P ! K>4@ a*K>44P@7?I @H7: K? 4K>@ `K>44P@7?I rH7 K??4Hx(4@ @4ς0K>Y @@44K>YK>K>K>K>K>@O>k?ok>k>k>k>k>k>K7#4@k>Hz( @7?i 7Hx($H}0@ ڈ 7Hy0$@Hy(K>4@4Hb( $BHi@K>4@ & D@Hy0K>4@4Hh0 ׊#Ha( #p44 P #0@K>4@ cjK>44P@7?Q#:H}pK?Y  w K>4@7?b@K>44@7?)"K?)K>@7 "7K?)K>@4K?)"RH K? 6? K?4!K>4@ aK>44P@7?Q!@HypK?Y &  _ K>4@6?aRK>44@7?)!"K?)K>@49  7K?)K>@4K?) H K? 6? K?>m4Hz(5H@ @4 @@4ςPK>Y @@4 @@44K>YK>K>K>K>K>K>@O>k?ok> 7CKD44 7?q@4w b4K=K> @O>H4@4zc4ςhw4 \ ˀK=4?4@4z@ ˀUK=#77?q@4  ς h`7>44x@4w4x| ˀK=#7?]70@4 @@4ˀuK=+`h 47?I@4k>+`H< @@4ˀK=@4zK>  447>Q@4w4 ˀK=G>U4 2 @@4ˀMK=4 4z@7>Q ˀK=HK> 479@4z@ ˀK= H  @4z  ˀ}K=44z@7>Qu@4K>K?1K?)K?!K?K?K? @O?ˀK>k?o7C@KZ RHtBҴ"` 6 K?Y Z T\@O?HyC87?7?5 3 \  K?Y A<  !W \@O?k?/,ok=k=!k=)k=1k=9k=Ak=Ik=Qk=Yk=ak=ik=qk=yk=k=7>Yk=4k=k=Jk7>Yk 4@k=k=4444 7K=(K>k= @k= 7K=(@@K=و 7K=(X@@K=K=4@4K=4@4K=4@4K>K<6  4?K=!  k=@7  7K=Ɉ'X@@K=ш 7K=ш'"K=K*4l &4#7. +`4-IB`B INI IJ@5Z&@IOIA4% H00 k= 7?a5Z@6K?a$ 0K?i $J $zK= 0)0IU0J06lAa a:K?A z]K?a׶  }K?iAy7 "As@ =` Ry ay@ arJ :7J V Tր ғ^asK?q r6 `Es} esK?y bK?K? _i i`(a`0@ih8i`HK=7i|@  7=K=K= K=&00N8D&D Z 8 6ujHIz@7=K= &00N8D&D 9 K= 7Iz@K=K=  JuJ@J`576V75J@5@J7 ,  RB4B@L : 5 RR6R@ L@? 5kP5:6`IPJ62x I 7IJ 5@:IB`K=K=44@K= K=K=44@K=< rK=K=44P@K=\ 8@K=K=4z@4K=у ˆ!!!ˆ!ڈ`!4KU@@4>=@@4>%@@4`>4@4z4k?ok= k=7$7CKZ@7= @@4ˀXK44>k>k?k?k? HЀ Xk?!K` *KK?!6vJ0k?!Kȋ?@k?9K?! 4k?147>ik?)7>q4zk=)k?Ak?Ik?Q@k?Y0ˀk?qK>q4$k?iK>iB k?K=)E k?a7?1k?yJ?@k?J?3k?J? k?J? k=1k? k? k? ek? k? Ak? <k? k?k?J Tk?J(3k?J0 k?J8 7>yk?J@ k?JH 6k?"@6HxK07>"6@@k=!@4xK=!7>@7@@K=!7>@7G=7># @79PK=17>#@7`7>B?4@B?B?B?4U B?B?T`0b?B?ӓ 0b?B?Փ0b?B?א@0b?B?ِ 0b?B?ۓ0b?B?ߒ0b?0b?0b?`0b?0b? 0b?0@0 000 0 0 `00 00@0 00000`00 0 0 @0 00B 0B"0B$0B&`0B(0B* 0b B,0b"B.0b,B0@0b$B20b2B6 0b6B80b8B: 0b&B<0b(0b*0b.`0b00b:0b<44xg>B?ݓ@0b?@0@0@0B4@0b46x7>y@4w(ˀ447>@4w4<(ˀBk?K>i4z7>@K>q04K ? @ @ @ (@ 8@ H@ X@ h@ x@ @ @ @ @ @   P P P (P 8P HP XP hP xP P P P P P P P P P P (P 8P HP XP hP xP P P P P P P P P P P ( 8 H X h xx x         8 P h  ( @ X p  0 H ` x  8 P ` p  0 @ P X ` p x   ( 0 8 @ P ` p             ( 8 H X ` h x           ( 8 H X h x           ( 8 H X h x         (((8@8@8HPXPXH`p    P!XPX  P!XPXPXHHH (08@HX`hppppxhttt(t0t8tHtXdhdpddgdgsbNNWWX!$$ X!$, X!@8 X!4X4D!X! P/ X!$((\: X!LhE X!d$$tP X!88[ X!H@Hf X!HHq X!P|X vv(hX!6 X!P8PV3X!$$ X!,<< X!hX!DX!X!4#X! L L!X!  \($X! 4 D44? X! , x,@L X! $ LW6X!hxhXX!`dX!`pjX!X|(XX!P00X!tt+X! 8 t8X!!,8 8X!!d( ( X!!@! @X!!@!L@X!" T!T X!"`,!, X!""  X!%d$6X!,4,h4 ,X!/.1X!2T2<T$XX!:90qaX!@?< X!A@HX!CBT#X!D@D @`X!DD`l0X!E0E00xLX!EE`ZX!FtF,tuFX!K JX!K,K@,X!KKl.X!L L8   X!LLX X!UpUp "X!VHVxH X!W@V X!W<Wp< X!X,0W0 X!X\W X!Y|X| X!YY, X!ZTY8 /X![ZD A X![ |Z|P LX!\L\L\ j,X!]]Th X!^T]t X!_^ X!_4^ X!_<\^\ $X!_T_T X!__l !X!`h`8h >X!a d`d L"X!bb n=X!e e  GX!g8g$8 X!hh\ X!ihHhH iX!oo0 <X!uu( X!v`DuD( >(~\L$@O4 >(R@O@$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$DATA$$BSS$;^`;*7  Ș#3% %%%%%%%%%%%%%$%%!% %%%#%"%'%.%+%-%*%(%)%,%/%0%1%2%3%J%N%M%L%K%O%e%g%f%u%v%w%z%x%y%{%}%~%%|%%%})#" ##"# # ## # ##"# ### ######" ##"##Ƞ%Ƞ476666 6 6 3 ș38>  8=2<3; v2A9?v  v9? v2Avv49? "v2A   7F& 7%PP2H6P ȠQ7R=8S"(6U 8V9W6X7F7Y7Z9[ 8V9W6D8\6X7F7Y7Z 9]6^J6D6U1c6_pa4b1c09WȠj8V5h 8\8T1i5h9I7R7R Y ș6l6_73   6l6_Lpr%7R8spa4b4  "8\p5Ӡ6l6_7m91:9@v2Av9?vv 8V1: 9@9+ 9C9B9?3 ! v2A v 8V6l6_6X 9v2A6l 7Y9+8V6X 9v2A7Y"6X9v2A7Y  .8V 9 6n 6o878Vș6l 6_7m7D3p96n9 3q 8t 68V6l6_7m9 6l6_7m9 8V6l 6$ 6 1iE8\p4pr6U8\ 38V91c 6k66 1i6U8\8V9W 66_prӵ 66U8\8V9W1cppt6X7 1c7 8 6"7Rș87ԙәp29P@p51:8\P4PPPp8762<pr p()78\1c6U 96p6633;!v6A6U8V9W97R 1c9 9#7R   6l6_7R 8s  7R 8s 7R 7R6X 7R8 7Y 7R6X7F7Y  8V9W 6k66_ 8V98Sș8pv1Ap63P<P7 pppr6666^6U9W 8V  1c  6^6U9W8V 7R1c  9W8V ș81ip86^9W88V7F8 p636X6X 00"6U 6^8\  Ƞp6 3G60)6Xv2A7Y!91c071i/8Hș7ʙ855әә991c  6_ # #"### ## ##"## ## # ## #" # ##  # #" # #"# # #"##\# $ ## ## # ##%''''''''''''''''''''d'''P'''''''''''''''''''''''''''''''''''''G''''''''''''`'p'9% % $W@` A0 A@' ATC Ad[ x       C   Q   x ,  <  L  \   l  |    4  @  H  \  v,  |X  A   0   (  8  H  X  h  x    (  v` Q; d d x     ( 8  H X4 hD x\  w4GX   x   x  w U {  P @ Q,H UT Uh7 |S U  U _  G0 U  A{ U  8P H X h x D   xl Q ,8D0 U`AY0 UBY !  A&! W@T   4 D THdx  x   w A"  #! $!O A %! P '" 8' L' Q X($ p(& ()l ((L ()t () (*@ (& (* (+ (+ (+ (+ 0(,, @( P x \ yd Q h),k U *.  +2? W@  ,9  /B ,  -? P 8.@ \.  p0D#  1Dc  2E3  4F/ A 3Ec 4 4 (4 4 |8 A X5J  l6KC T 7Ko 7 7 A 8L; U 9L[ 9 9 9 09 @9 ` |@ U :U  A ;V{ U <V A =Ws U >W U?W AD@X0 @hCZ0 QDZD0 UE\  UF]W UG] QH^ U(I^ ADJ^\JlJJJ K_ L_oLL PM`; QN` Q$Ob DPeXPdP QpQg' Rh_ USh  |P S UTo3T(T4T@T LUu+ AlVu0W@VVVVVVVV0V@VXVtVVVVVV,VXVVVVVVHVlVVVVVV<VdVVVVsom.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.DS$som sign_extendlow_sign_extend sign_unextlow_sign_unext re_assemble_3re_assemble_12re_assemble_14re_assemble_16re_assemble_17re_assemble_21re_assemble_22hppa_field_adjust $00000002 $00000003 $00000004 $00000005 $00000006 $00000007 $00000008 $00000009 $0000000A $0000000B $0000000C$L0C$45 _bfd_abortbfd_hppa_insn2fmt $0000000E $0000000F $00000010 $00000011 $00000012 $00000013 $00000014 $00000015 $00000016$L1hppa_rebuild_insn $0000001C $0000001D $0000001E $0000001F $00000020 $00000021 $00000022 $00000023 $00000024 $00000025 $00000026 $00000027 $00000028$L3 reloc_queueC$57C$58C$59hppa_som_relocsom_initialize_reloc_queuesom_reloc_queue_insertsom_reloc_queue_fixsom_reloc_queue_findmemcmptry_prev_fixupsom_reloc_skip $$dyncallsom_reloc_addendsom_reloc_calllog2hppa_som_gen_reloc_type bfd_allocsom_bfd_reloc_type_lookup bfd_assertsom_object_setup $000000A1 $000000A2 $000000A3 $000000A4 $000000A5 $000000A6 som_mkobject$L12 bfd_zallocbfd_default_set_arch_machsetup_sections bfd_mallocbfd_seekbfd_readstrlenstrcpybfd_make_section_anywaybfd_som_set_section_attributesmemset!bfd_som_set_subsection_attributesbfd_tellsom_is_subspacecompare_subspaces L$plab_startqsortfree som_object_p $000000EC $000000ED $000000EE bfd_get_error bfd_set_error$L16som_prep_headers som_is_spacesom_is_containersom_count_spacessom_count_subspaces compare_symssom_prep_for_fixupsbfd_abs_sectionmemcpysom_write_fixups $00000159 $0000015A $0000015C $0000015D $0000015E $0000015F $00000160 $00000161 $00000162 $00000163 $00000164 $00000165 $00000166 bfd_write$L31$L32som_write_space_stringssom_write_symbol_stringssom_begin_writingM$44som_finish_writing som_build_and_write_symbol_table bfd_get_machsom_compute_checksumsom_bfd_derive_misc_symbol_infobfd_und_sectionsom_write_object_contentssom_slurp_string_tablesom_get_symtab_upper_boundsom_slurp_symbol_tablebfd_section_from_som_symbolbfd_com_sectionstrcmpstrncmpS$98DD$som_slurp_symbol_tablesom_get_symtabsom_make_empty_symbolsom_print_symbolfprintfbfd_print_symbol_vandfsom_bfd_is_local_label_namesom_set_reloc_info __SB_masks_isupper_islower_isdigitbfd_get_section_contentsS$103DD$som_set_reloc_infosom_slurp_reloc_tablesom_get_reloc_upper_boundsom_canonicalize_relocsom_new_section_hook som_bfd_copy_private_symbol_data!som_bfd_copy_private_section_datasom_bfd_copy_private_bfd_databfd_som_set_symbol_typebfd_som_attach_aux_hdrstrncpybfd_som_attach_compilation_unitsom_get_section_contentssom_set_section_contentssom_set_arch_machsom_find_nearest_linesom_sizeof_headers dcgettext_bfd_error_handler__iobfflushsom_section_typesom_decode_symclassbfd_ind_sectiontouppersom_get_symbol_infosom_bfd_count_ar_symbolssom_bfd_fill_in_ar_symbolssom_slurp_armaperrnostrtolsom_bfd_prep_for_ar_writesom_bfd_ar_symbol_hashsom_bfd_ar_write_symbol_stuff%S$130DD$som_bfd_ar_write_symbol_stuff$$remUsom_write_armapstatsprintfgetuidgetgidsom_bfd_free_cached_infosom_bfd_link_split_sectionsom_vec bfd_getb64bfd_getb_signed_64 bfd_putb64 bfd_getb32bfd_getb_signed_32 bfd_putb32 bfd_getb16bfd_getb_signed_16 bfd_putb16_bfd_dummy_targetbfd_generic_archive_p bfd_false_bfd_generic_mkarchive_bfd_write_archive_contents+_bfd_generic_get_section_contents_in_windowbfd_true%_bfd_nocore_core_file_failing_command$_bfd_nocore_core_file_failing_signal*_bfd_nocore_core_file_matches_executable_p_bfd_slurp_extended_name_table/_bfd_archive_coff_construct_extended_name_tablebfd_bsd_truncate_arname_bfd_generic_read_ar_hdr$bfd_generic_openr_next_archived_file_bfd_generic_get_elt_at_indexbfd_generic_stat_arch_eltbfd_nullvoidptr_bfd_generic_read_minisymbols!_bfd_generic_minisymbol_to_symbol*bfd_generic_get_relocated_section_contentsbfd_generic_relax_section#_bfd_generic_link_hash_table_create_bfd_generic_link_add_symbols_bfd_generic_final_linkbfd_generic_gc_sections_bfd_n1cpu-hppa.o/ 996061559 0 3 100644 1200 ` 1h@h((@h1$G!hppahppa1.0hppa2.0hppa2.0whppa1.1  (@@0 `  X! X &0,>(@8 $TEXT$ $PRIVATE$$CODE$$LIT$$DATA$;^w;(##%''% ,@0<X0p@ cpu-hppa.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. DS$cpu-hppabfd_default_compatiblebfd_default_scan bfd_hppa_archC$34hpux-core.o/ 996061564 0 3 100644 4480 ` 1 8@H  8 # \' @@ \G!k?ok? k?76k?!7:@k?)K?!@7 8744K>K?K? @O?K?)@4K?!@4 7Ƞ4h K>h0K?!@hHhK>5h`k?o7C@40 K?Y@O?k?o k4 k4k4k4!k4)k41k49k4Ak4Ik4Qk4Yk4a7C@48h|4"44K3K4aK4YK4QK4IK4AK49K41K4)K4!K4K4K4 @O4k?K44 4k?K5@4z$H@K54@4z47444 @4wCK4?Ok?_"?7k? ( 8 @ (0"B7?!rE74? @k?K544k?@4z"k?Hb57>k?HX@@K57>4@4z"HK544z@K504574+`4&4 44 4 4 4 4 @!ˀK3K54@4z74K575 4@4wK5=_74Hw675q@4%74K5754@4wK5<744@4z<74HsK>uK>HvHK='K5k?K544k?@4z=HˀK3ˀ K3ˀK3ˀK3ِP@2+`#@H6Hy7Z7H|K_@7K_@K@4k?7#47p@4K?Y@7?.reg/%d%s appears to be a core file, but contains unknown sections. It may have been created on an incompatible version of HP-UX. As a result, some information may be unavailable. hpux-core.c.reg.reg.datahpux-core X! X!(((,X!P8+FX!h  Dq X!t  P| X!\ X!((hX 0t>(t@$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$;^{;)67 7767 7\98 9 \8\8 \ __v2ȍ30##% '''''''''''''''''''' '!'"'' U,DP`l   @ 0(4 L \  A  0@((8Hp8hpux-core.c /opt/bintmp/binutils-2.11.2/bfd ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.make_bfd_asectionstrlen bfd_allocstrcpybfd_make_section_anywaybfd_tellhpux_core_make_empty_symbol bfd_zallochpux_core_core_file_pbfd_readbfd_seekstrncpyM$39C$40sprintf_bfd_error_handler $$dyncall#hpux_core_core_file_failing_command"hpux_core_core_file_failing_signal(hpux_core_core_file_matches_executable_p swap_abort _bfd_abort hpux_core_vec_bfd_dummy_target bfd_falsebfd_true!_bfd_generic_get_section_contents+_bfd_generic_get_section_contents_in_windowbfd_voidbfd_nullvoidptrbfd_generic_stat_arch_elt_bfd_n1bfd_default_set_arch_mach!_bfd_generic_set_section_contentsbfd_0binutils/binutils-RUN/opt/binutils/lib/libbfd.la010064400000000000003000000012700732753176500205170ustar000300000000000000# libbfd.la - a libtool library file # Generated by ltmain.sh - GNU libtool 1.4a (1.641.2.122 2000/09/30 05:27:52) # # Please DO NOT delete this file! # It is necessary for linking the library. # The name that we can dlopen(3). dlname='' # Names of this library. library_names='libbfd-2.11.2.sl libbfd-2.11.2.sl libbfd.sl' # The name of the static archive. old_library='libbfd.a' # Libraries that this one depends upon. dependency_libs='' # Version information for libbfd. current=0 age=0 revision=0 # Is this an already installed library? installed=yes # Files to dlopen/dlpreopen dlopen='' dlpreopen='' # Directory that this library needs to be installed in: libdir='/opt/binutils/lib' binutils/binutils-RUN/opt/binutils/lib/libiberty.a010064400000000000003000005224340732753204000211030ustar000300000000000000! / 996061311 0 0 0 13500 ` @LO$$( ٔx8(&0$x$x(@%8&(%!!$%#" 'H'#` @#X(`'p'#!Xh&&XHp$(h&"p$#8(`& h08` &"!"H'X%h0 #((8" `p$P' @!P !Hp5<=l GKtwx4t04H@(|HX  0'0.@37PG,X$kTq,u~ d<0Hx@t ,0 # ugv0 rgv0 $ugv0 0ale0 DChse0 U\oat0 Ah ple0 | 3ple0  ple0 A 'pme0 Qpme0A@irs0 eng04B@ule0 T;DCpv30 Al yeq0 Uyng0 Agyar0 Aytr0 A ynd0 Q yarP0 Q sytrx0 A$  ytr0 Q@ +yrt0 AXynd0 Apytr0 A/ypy0 yar0 Ayze0 yse0 yte0 Oyew0 Ayit0 A(dch0 Q4nch0 Q@ ept0 ULgal0d@ppt0p@prr0|@ _ed0@$pnd0@(prg0 U' ely0 U eng0  ewd0  eme0 ; tns0  + tts0  # tze0 P0 tse 0 @DG tot0 @X  tlt0 Ql  tot0 U o tsh0 A 3 tnd0 Q G tsh0 O tty0  tte0 U3 tte0 U tte0 @ ter0 @ terG8 hue0 H eit0 PXglle0 Ptlle0@lxt0@0lxt0@`lxt0@lxt 0@lxtH0@*lrd0H@ lle0l@Plig0@lle0@lig0 Q der0 P7des0 A/ dam0 PCdck0 A kdtx0 A4C dtx0 H dtxP0 @\bck0 tK bee0 Akooc0 bte0 oed0 @ bee0 @? oee0 Ao_p0 @onk0 U(o_10 U@oinGT ock0d @bre0 @ber0 @ant0 Qaon0 ate0  aew0 Qwit0 U ete0 @ ser0 (@ ser"0 <@ sle0 P P ors0  dpes0 A p prs0 A kpts0 Q Cpch0 A por!00 A ;por0 A pup0 @ ;pve0 Q ,[prt0 D3pte0 Q \pew0  p tno0  'tno0   rax0 @ ?sal0   tno%0  tno%@0   tal0  K iax0  ait0 eit$(G xup 0 A roc0 A (coc0  4moc0 @7med0 Tmme0 Q tmup0  sup0   sor0 U  stf0 A !kps0 "nnv0 Q "env0 Q # atf buildargvfreeargvdupargvmake_temp_filechoose_temp_baseconcatcplus_demanglecplus_demangle_name_to_stylecplus_demangle_set_stylecplus_mangle_opnamecplus_demangle_opnamelibiberty_demanglersset_cplus_marker_for_demanglingcurrent_demangling_stylecplus_demangle_v3 dyn_string_eqdyn_string_substringdyn_string_append_chardyn_string_append_cstrdyn_string_appenddyn_string_insert_chardyn_string_insert_cstrdyn_string_prepend_cstrdyn_string_insertdyn_string_prependdyn_string_copy_cstrdyn_string_copydyn_string_cleardyn_string_resizedyn_string_releasedyn_string_deletedyn_string_newdyn_string_initfdmatchfnmatchgetopt_getopt_internaloptoptopterr__getopt_initializedoptindoptarggetopt_long_only getopt_longgetpwd get_run_timehtab_collisions htab_elements htab_size htab_traversehtab_clear_slothtab_remove_elthtab_find_slothtab_find_slot_with_hash htab_findhtab_find_with_hash htab_empty htab_deletehtab_try_create htab_createhtab_eq_pointerhtab_hash_pointer _hex_valuehex_initfloatformat_from_doublefloatformat_to_doublefloatformat_arm_extfloatformat_m88110_extfloatformat_i960_extfloatformat_m68881_extfloatformat_i387_ext*floatformat_ieee_double_littlebyte_bigwordfloatformat_ieee_double_littlefloatformat_ieee_double_bigfloatformat_ieee_single_littlefloatformat_ieee_single_big md5_buffermd5_process_bytes md5_streammd5_process_blockmd5_finish_ctx md5_read_ctx md5_init_ctxobjalloc_free_block objalloc_free_objalloc_allocobjalloc_create_obstack_memory_used obstack_free _obstack_free_obstack_allocated_p_obstack_newchunk_obstack_begin_1_obstack_begin_obstackobstack_exit_failureobstack_alloc_failed_handlerpartition_printpartition_unionpartition_delete partition_newpwaitpexecute _sch_toupper _sch_tolower _sch_istable sort_pointersspacessplay_tree_compare_pointerssplay_tree_compare_intssplay_tree_foreachsplay_tree_successorsplay_tree_predecessorsplay_tree_lookupsplay_tree_removesplay_tree_insertsplay_tree_deletesplay_tree_new strtoerrnostrerrno errno_maxpsignal strtosignostrsigno strsignal signo_maxxatexitxexit_xexit_cleanupxreallocxcallocxmallocxmalloc_failedxmalloc_set_program_namexmemdupxstrdup xstrerrorasprintfmkstempsunsetenvsetenv vasprintfargv.o/ 996061264 0 3 100644 2036 ` 14@4|@4 XKXXG!k?ok?k?@!87CH} 47  @?77@ 7Hy 4 e @@7@   7@ e 4 e ? e  4K?YK?K?@O?Ȁ4Ȁ4@4Ȁ4k?ok?@ P7CHz *4d@@ @?4@4zK?YK?@O?k?o7hd>he>hf>hg>hh>hi>hj>hk>hl>hm>hn>7D444 44 #4@47K?K?3~`4`  ~k?k?4 @4 h}>4 N4D@ ( "4@ (0׀ 54?`b @4@ 4  I @5! 7@Y H>47 z(2  0@ !Z7@87 ( (7Y4 ?U6@Hz>  !4  @_ z( *4@ w(0ϋ=@ 5! @55 4  : Ƞ77 : }7U7M> @-4@5454~Hb>YHn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>X! X!TLL,X! 8,$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$;^P:1- 667 11 667!610 ,8D0 P`l0 x#argv.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.dupargvmallocstrlenfreeargvstrcpyfree buildargvreallocstrdupchoose-temp.o/ 996061265 0 3 100644 2520 ` 1 @(hG!-k?o P7C 4@4z 4K?Y4|@O?yK?Yk?ok? k?k?k?! `@4z4@77@4z7@47@4z 7@44z0@7+`4:@7+`4:@72G4gP@44c`77@4z @774@7 24? 4^  4 @4y@4@4 :4K>K?!K?K?K? @O?@@4k?ok? k?k?k?!k?)k?17C @44@77@47@47@4 7@440@7+`4: @7+`4:@72I4P@5:`!x744`@44  @6759@7 :4?  4^  ^?  @4` 5@4y5@4 7@7 5K>K?1K?)K?!K?K?K? @O?@4zȜ}4`@7]@@@]5TMPDIRTMPTEMP/var/tmp/.ccXXXXXX/usr/tmp/usr/tmp/tmp/tmpX!@@ X!<@<,CX!|8TLX %<D(>(@P >( @ \ $TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$LIT$$DATA$ $SHORTDATA$$;^Q9IB7ȅ67ԅԅPPQQ667 6 0 ȅ67ԅԅPPQQ667 7 76 60 #"# ##!"! 4@ H@  A\d0 pC 0  choose-temp.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.DS$choose-tempSD$choose-temptryaccesschoose_temp_baseC$21getenvstrlenxmallocstrcpymktempabortmake_temp_filestrcatmkstempscloseconcat.o/ 996061265 0 3 100644 984 ` 1@x(L4P4G!k?ok?k?7?1k?1k?)k?!!0k?944@@ K?9 7B *7?6`Hw bB *7`?64c?`Hw?@K?YK?K?@O?@4eԠH>7@4?ԠH@? u4X! $TEXT$ $PRIVATE$$CODE$  ;^Q7-P5 6"60 U0<Hconcat.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.concatstrlenxmalloccplus-dem.o/ 996061280 0 3 100644 42744 ` 1~x@ptpC{4{4D~x~U d~G!'k?ok?7#k?@7:k?@w@K? X7K?4@4y 2@@4?744K?YK?@O?+`@`:7KYC7+`4? WǷ@44?@7?Ƿ#7.& U KYC87?'00N9F8G'I  J79YC3 X6?Ǹ_M w @7? ]ǽ2KA4<\C XǸ_@4?@7?k?oK_4C7Cx 7 b@Y+`46 _ǿ@@4zHC4] 2ϟ@K?Y4``J4r@:6?7 aK?Y@O?ϟK?YϟK?Yk?74_ 24 4X 2ςK?Yׄ4K?Y@7?@@K?Yk?7N:N!JJ ‡FF BbB B@ "@@K?Y@7?#7`"6 `#7 p#@7\ # u7< #]7 "`E6| "-6 0k?7@@@7K?Y@7?k?ok> k>k>k>!k>)k>1k>9k>A7E7#@7 `744@7>k>@4 4@ r@4ދ= @4S% :@+`48 \ǜ@ AǁCJ`R4ވ B@4H *@+`4:@ҙ bj 4 4@4":@+`4:@ҹ" 4 k?y7?y7>@7>!4 p@4zK>K> 8@4z@7>̂7>ь` 44 @4 +`44 4?4*4  E@ E (@ E 5y@4$5(?@7>+`444?4)4 E@ % (@ % 5Y@4#4?@7>@@4K=K>AK>9K>1K>)K>!K>K>K> @O>@ @+`444(4 E@  (@  4@59!4?@7>4 ‰W>7>@ >7>+`444(4 E@  (@  4@59!"4?@ 7>4k?y7?y7>@7>=7> @4Y p@4zK>K> :@4z@7>̂e7> 49 @4z+`44 @4ẑ 7>#7 @4z+`43e @4ẑ7>4 @4z+`4+ e @4z4@4ẑM7>"6 @4z+`4= @4ẑ7>k?ok? k?k?k?!k?)k?1k?97'4@k?A+`7444( 4* G@  | B G 7 (@  K?A@4x j4?@4K>K?9K?1K?)K?!K?K?K? @O?+`48 +`47J 07\6 (@?6@4+`@h<k?o+`k?4#Hw :Hy@K? :4cH?Hy4K?Y@O?H|k?ok>7#4k>4@7>k>#7>  "+`H7  #Zk>K>^?*@K> p7K>?@Z"K>@4yȜ84K>@7>7@7>4K>YK>@O>k?oK?7Cr Z:7? 87='Hz'8G'F@ |K?Y@O?k?ok? k?k?k?!k?) 7Ck?4 4 @k? 44c 4@4#4x#4 @4z! @@4z0 _ w 67B7 @ R4@4 Z@_ 8"@?7044K>K?)K?!K?K?K? @O?C48"b|4_77?7?@45? b +`K?4? VǶ5?@J w  TǴ26?` @ w  Yǹ_6?@2 w  "6? x ' (4 w 0H64`4@| S4 y X@ w 6  <]e7 w  Z Y? w }7 5?4\ 7\ w  w < w 6 u < w 4@4z77?7?@4@y4x: (K?4@4y44 4@4x4k?ok? k?k?k?!44k>k>KEXk@XKFPKD`KCpK>kPK>k@pK>k xK>!C`!@7?QK>K_^7>@7?Q7 (@K>7>@7?Q7 @@K>C "K>7>@7?Q7K>KP 2#7 @7?QK>jPKX 2"6 @@7?QK>@jXKxB *#7 @7?QK>jxK>7?Q@4K>hPK>k%XK>kD`K>kpK>K?!K?K?K? @O?k?o@7CHz@ @@@Hz@ @@@K?Y@O?k?ok?k?k?7C@7$44z@4HH @H@@4H0!jH Ax4H8" H(B4H"H B4H@#RK?YK?K?K?@O?@  |H@ 7@4Ha% \4HsHe  @4H@e_m@H0@ u |H@ % 7@4H 4HtH  @4H _wHH8@  |H E @@7@4Hx  <4HuH % @4H(_e@EH@ -h|H@ 7@4Hz E 4HvH  @4H_wHH@4h|@7Hz@HeK?Yk?ok?@7CHz@ @@@ `h`HHw H`X4HHw  @@HwH4_@@Hzh`Hz@ (@@@@Hzh`K?YK?@O?k?7@k?@K?K?Y@7?k?ok?k?7#@7 4@4z84#7`4@4zHd4K?YK?K?@O?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yK27D7%B_744444)4 +`4,0k>4+ k>4*k>4.+`k>!54*!4 4?47W?u4? w ǚ6\ C(b _ AǡRH6V B((@ _ VǶ_@k?444@4x (7H Y4@6YH^4 rk?444@4xH7^4 6S  06Qh`@@Hp Thp 0HH7 Hy@ 82H6 @? ?@HC0 7  bhh44@4x 06Q (7H ?4@69H@ ^_HC (4 244@7?Y P7Hǡ K>@K>@7?Y4z@7?Y 46B H4^ޟ4^_ @444@4x$7H^_HC#7 7?A4@47@7?Ak?@7?)k?@7?A 0H447?A@7?) (7H "4@69Hǹ@K>@K>@7?A4z@7?AHXB5@7?)4z@7?)HX7?hXHP HX*4z@7?)HP6?hP@7?)@7?A 4H@ @9 @@7?qH52 44@7?qK?qK?y] 75 @7?q4z@7?q@7?q P@H^rk?44k?4@4xHPH4ZҠ_4 H7H^r44@4x47 ! bHƿ@4^_ @444@4x74 !*HB_@67W? :H^"44@4x7 H H` #7 @4zHp@ ZHoHp "6 @4z@Hp7@4z5<K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O> %@k?ok? k?k?k?!k?)k?1k?97& k?A74 @77?i@44 !x4K?i A`44x4 7 7 K?A4_4x!7K?i@ 4@4zHC?m@7 4 @4z`K?iK?A4@7? 74z@7?@7?K?i4_4 HsBz?4| 4 @4z4@4z4K>K?9K?1K?)K?!K?K?K? @O?@7??GHsK?ik?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Y77#k?i 4k?a47@k?qHz7_ 4C4(04+`4(4)4 4K?aK?i4y@K?q 7HwB( H}Cf!44K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O??4@Hz474 L@ (7 Hy@5x :5? L@>H}UK?a4 K?i4@4 , @K?iK?i4@4Hx  yK?i4 @4Ht6 uk?ok>k>k>k>K747#k>B!j4!4!r444!4#K>7@4Hy7: z@4z7 "607?Q@4K>@7?Q@ * "HC7 0 g44K>YK>K>K>K>@O>4y@4ܟ44k?K>4@4yܟe44? jB J K>4@4Hx7 } 4̂5@>%@@4z@k?ok?K!7#4k?@?? "4y@4 K?Y4ڋ_ :#K?7@4Hu6 vHtB+`4$ YǹX@HyK?@4Ha45 uB Sdz_HyH|C4\ "`K?6y@@4Hv6 yC? XǸX@HyK?@4H|7 tB ]ǽ_HyHuB4ʊ #K?7P@4Ht6 xC WǷRHyK?@4Hv6 sBb ZǺ_Hy4K?YK?@O?k?ok? k?k?k?!6K77$k?1B47E!46 @4 87H H`@4 4|!4ڊ :#7K?1@4H4 "6`K?14@4@4@`4|!r`4|H " @K?14|K?1@4h4|>@K?14@4|(4|\ @ g?aK?17?a@4K?14@44| @4>@#@7YpK?1@4 `4|# K?179@4(4| *K?14@4|4| !4? B4k?K?144@4|4|@477R 2#K?17@4H@4k?9H7@4K?9 F @H (k?A"K?16`@4K?A 0K?1@K?A@K?A@@K?9@K?9H  4|K>K?!K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>K>77)K87 97CK>6444 $4 @4z7I?C40#7 ,@5:$7Hy @HzLD@5:$H$ @4 $Hx @5z"4z@597@7?1'r'44z595@5'7 II @6Hx <6Hw @IHu 4@5@5K? 5kxd4J>7?17 ?4z59@4&7@5:_m7@I:WK? 5 @4I94@5 p@@5Ha+ \5Hv @I9Hu I4 u /@5:Ak? @I:K? aHpǰ8 !I:5@404  @I9K? @4 @I9K? @5zI5K?  ? "6@47? @5:!"5@7?1YK>K>K>K>K>K>K>K>K>K>K>K>K>@O> zK? @ h|K? 4haK? `2Hs  7K? @K? a4 4 4 ! 5@4I?C;@7 74z59@7?1=74@7?1=@K?9K?1 Y@5Hs k 5H} @K?1H} o 7?1 @@@K? 7?q@7O4z @@54 *"6`@4`@HBz?4|] "6 @4"6@@4 0]@HH ? 8484z@4 5k?ok? k?k?k?!K_7G7$K>76^"`6y@4  b7 }@4z""H   C4X!@H^_ 4@4 P 4@4 ( 4@4 H4" b@4z!BH   @C4 7ς z4@4 ` 7 f@4z H   C4 4K>K?!K?K?K? @O?ˀK>7ς }ˀK>ˀK>7ςm yk?ok? k?k?k?!k?)k?1k?9KH7#7EK976h 8 & 4#7?Ik?7?A4@4%@@7?YHyK?A *@4Hh_ HH hh!5@4K?I4 4 7?Y@@K?IC7#R!47?I@7?Y$*4 t44y@7?Y 4@7?YHsB 8 4@4@7?YHCR" 777! *44y@7?Y?/44@@4@7?YHC70 w8K>7k?I7?I@7?Y"z847:@4x @Hy <@ @@4(HyHy4@4Hy4  h@7?YHh HH hh 4@4444 4 44y@7?Y>4@%47k?I47?I@7?y 5@7?Y7?Y@7?y5 @7?YK?IC j7k?I7?I@7?Y :4@7?Y5@4K?Iu7?Y@@K?IH4"?h5@@4Hj@ Hz4@4 HwB4V bBB J+`4:@ "40@4@HjHh7hh4Hy@4Hj F  K>K?9K?1K?)K?!K?K?K? @O?k?ok? k?7#4k?!7:@k?)77ȠJ@Hz@0@K?!K?)4y@444K>K?K? @O?k?ok? 7C7?k?4@k?@4zk?!K?4z@7?!@HxPK?HsXrHh K? 'k?K?@7?H}X8@HyP76?hvPk?K? $848@4zK?K? ? 848K?!@4zHb+`@߿49@@_49P@K?K?@7?4@7?4K>K? @O?#K?@7HzX7U?huXk?ok>k>k>k>k>B67#k>K%7D4"H^޿^_"6P@5"h@@7>K>@7>44@7>7>@4A!z44K>4y@5K>4@4y! 7 e@K>K>@7>4@7>5C @C :7C b?7C?7 ("7C ?77?A@>4@7>@7>4K>YK>K>K>K>K>@O>4K>44y@5Ÿ}4k?ok? k?k?k?!7#7DK:@k?14b"Hz6`@4  2#Hz7p@4 !@Hy7: z4hx#@+`43 VǶH:4(*ȠHPHƟ@ ^_j @Hz4Y@4":H}7 |4hP@Hzb Hz4@4!2HtB+`4:Y@@!HCC!bC4 R7 v4K?1hX4@4y!P44 7 u4K?1hP4@4y 4H^ _@ Hz4@4=HHs6a a4hXHf44@47 7C?7 4? 2#7@4@ 7? K?!K?K?K? @O??4EHPk?ok>k>k>k>k>k>k>k>k>k>k>K?47#k>C7D4 X4C+`4:Y@@ HC#@HC C :C4 + "C4 C"4 7 BC4 *C+`4:@ҙ"HC h@C!ә@5Ѐ 2+`4)Hz@59$7 Hz4@4'hHz4`@4 *HC4҃'4̂'44K>YK>K>K>K>K>K>K>K>K>K>K>@O>@5y7HyK>@5Hw  }7@5y":Ƞ4Ha49 y@4& 7Ƞ47 sHX6hXHC: 7 jJ A_7 iA?5:!+`4(p4)`+`4*+`4+4 4 J ( k?K>44@4yȼeHzk?K>44k?@4yȼHz _ XǸݭ@@4zHz@7}HyHz@5y4 ZH=@H`߿95@K>Hy7: zHzC_>m@ `@4y 4Hy78 x4 C R4 4 k?K>44@4yȼ:k?K>44k?@4y7!rȠ-4@4z@7@Hz@ Ƞ4@@Hz5@4 HC46 CC r@5: P@K>@50HbF  z@59@HHyK>@4Hh   H>u@7 yH+`߿49K>_49@@@HzHyK>7@7H}  b7W w@4z97Ƞ44@7?!K>@7?!K>@4@4@HzHz \ % a7 nA+` 84'4 (4' R4 4 zk?K>44@4yȼjk?K>44k?@4yȼ(@K>4@4y7 "HtB Ƞ4K>ᐠ @44k?ok? k?k?7F6k?!7#@6Hy77@4 H@4 87K?!@4@4 @HyK?!@4@4Hw  xK>K?K?K? @O?k?ok? k?k?k?! 7CKZk?14p@4" 4H}7k?C 47?@@!K? k?C C 7k?K?Bv?7?Hx7 wB@ 44z@@!7@Hz`HyK?1@4Hw  C H@CF 0@K?1@4Ht6 gHuB ?4zK?1@4(4Ƞ4Ԡ44K>K?!K?K?K? @O?k?ok>k>k>k>k>k>k>k>k>k>67D7&@7k>4 4 4 0@HPӀ_HXӇӀ_'@7?9@7?QHB4H#6 @4 H |@r44K>YK>K>K>K>K>K>K>K>K>K>@O>H @7?9 c5I?+`4-k>4:k>4 4 5,@7?QHCW 4 7 HCw"k?44k?47?9@7?Q#7K?9< @7?9"4 @ZJ@4"744@7?9PK?944@7?Q"877?9@7?QK?9K?A ? 848@4 `2Hǵ K>@K>@7?9}5)?K?9 @4 7Ƞ4B4?67?0 Ƞ4 ` g?1@7?1HC74 7 H7 <}@4=H7 @4 H }'HȠ-@4K?9K?A ? 848K>@4 H+`߿49_49 @7?9HX! 59@7?97?9@7?QK> "4z@7?9p@HbHfF :H+`Ѐ߿490Ѐ_49@@7?94z@7?9@7?Q@7?94KA@7+`4? S`_ˀ7?5KT6WB ]ǽK=46B S \6? dz_60V0=4@k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7D7&k>@7?1@7? @K>+`4"`k>4-Pk>+`!@44444)5J!`4 4 44T4LHB?7? 4? Q 4*?HHC6?QB4 w)4 )4)K>4@47`04@? @K>K? K? R#@7Y @K>K>@7? @7? @@7? )`04 4|6 HǴ@5y@@7? `04?6 5y`@7? `046 K? K? H@C ( *5y@7? 5y @7? 5y@7? HCM *444@7? 7HC 7 5y@7? 6 7>@4 K>H@@"4=WK? hK>H 7?!Mk?!6 K? K?_ H@C ( *5y@7? 5y @7? 44@7?  (@HC (0 Ƞ@&J;U@7E 6 045y @7? HCS 84HǼ K>@K>@7? HC? ? ]ǽ@@4 k>@HK>@ Ƞ@H@7? HK> X 4 4! 7?Y4_47?Y@7? 5y@7? @HC4 4 4? *@H6 7H7 4CS!Ƞ5@ k?@7?qk?444@7?q8e7K?qK?y 8@7? @7?q5y Bk?444@7? >=7Ƞ-@"44@7?  HC Ƞ@7 HӠߒ 0/K? K?_ 5y @7? @6:7@7? 6 HbK? K?Q 5y @7? HB@:7@7? H6% k?K>44@4ȼU@7 7>@4 K>H(vGHȠxK>7 @4 87H H`@4 4K>@@@7? 44|K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>H " @K>@K>@4̢K? k?ok>k>k>k>k>k>k>k>k>k>k>k>7G7&k?977?A44@44 !@4 4 4 44HC ( 8""#B#Hh@HHz_ 5Y @4zHB@Ӛ7@4zH6 4@4c?%@H4H   47?9@4K?94@4HhHo 4 @4z4z@44K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>4k?4k?44@7?A74z@7?A?47 HyHt 5Y @4z5Y@4z7 HxHsx 5Y @4z5Y@4zb7 HwH} 5Y @4z5Y@4z@4< HC:@4? 4< @47 HuHi5 "6 @4z"`6y@4z47 HtHh #7 @4z#@7Y @4z47 H|Hk| # 79 @4z#7@@4z%47 HaHl, "6 @4z#7P@4z47 HvHjV !5 @4z!5`@4z547 HuHf !`5y @4z!@5Yp@4z̨47 HtHe ! 59 @4z!5@4z̪E47 HyHv  4 @4z 4@4z̪47 HzH|\  4 @4z @4Y@4z̬U47 HsHbS  49 @4z#7@4z̬47 H}Ha= "6 @4z"6@4z̬e47 Bt+`4? X_ȀH4 4C.67?!7" @X 8p47?!HB  6yH6` C9 ?HHA 4Ƞ47?!  H6E @HH@47@7?q44@7?q @K?qK?y ? 8484@5H}Hb] !5 @4z4z@7?q@4@7?qwȀu@k?ok? k?k?K747#k?!B 4 6 a@7404 *4 K?!@4Hb4_ +`C4% _ǿ@׀4K>K?K?K? @O?4 ˀK>"K?!@6Hf4ςu ǿx@+`4&HzC_4`@K?!Hy78 xC Sdz_@ #K?!@7 ςK>k?ok? k?K?7#4k?!C7D *4K>K?K? @O?7 s@4z`7ˀK>#@7Y`@K?!@4k?)Hy7@4K?) E @H 8k?1K?!@7@K?1(H}HyK?!@4H}  t@K?)ςK>k?ok? k?KW4Z7Ck?!B z+``?K?!@49Hv6 aHuB+`4$ _ǿ@:ˀK>4V?Hu6 |ǿx@+`4%HzC_4`@K?!Hy78 xC Sdz_@4K>K?K? @O?k?ok? k?k?k?!k?)44HC!7 @4A8h|@"HC!Z7 444z7CK(7%7@7H_-@Hy7? ph}ˀK>@4h|@7Hx4z@4 ˀ(K>@44K>K?)K?!K?K?K? @O?ˀK>Hz@?@@@-HxHy@4H 4z@5ς5K>k?ok? k?7CKZ7@ k?!Hx@HH`b *4htH@40 | WhwHHz@ |@4K?!77@4 `H@7hy@H} K>K?K? @O?k?ok? k?K_077Ck?!KX @b *4 hs0@4(0 | Whw0Hz@ |@4K?!77@4 H 7hy Hz _ K>K?K? @O?k?o7CKZ(H8@b *4 h}8@4(0 | Yhy8Hz@ |H|(7h(Hx  K?Y@O?k?ok? k?k?7D7k?!6@7K?!77@4f H K>K?K?K? @O?k?ok?KW 7C@jH6?hd   *@@Hw HHw _6?Hw(@jH6?hd(  *@@H  HHw(_6?K?YK?@O?k?ok?KW@7C@jH6?hd@  *@@H HHw@_6?K?YK?@O?k?ok? k?k?k?!k?)k?1k?9k?AKG7C7$k?Q4X4!`5y@7HA !@K?Q@5YHC4(0 4ʊ HvcZ4! 4 4 ("B7 C *7?@4 ˀK>k?H@ ^_Hy@4c@4k?CH^ޟ ^_K?7?k?K?cHs@czHx`K?4A?Ak?HyK?:  0k?Hs@K?Q@597?4z@7?a"H}@K?Q@7?a@7?aHt_-4K?7? k?H "HuK?Q@594z4@7?a" HtK?Q@7?a@7?a4HC(0 <@Hx\@HC4ʈ" b7 HwB # K?Q@79#K?Q@70Hz#K?Q@7 4K>K?AK?9K?1K?)K?!K?K?K? @O?ˀK>7?@4<7HˀmK>ˀ]K>ˀMK>ˀ=K>k?ok? k?KD7Ck@H7hwHe@h`k?!Hz@ @@@hdHy78?hxK?!heK>K?K? @O?k?ok? k?k?k?!k?)k?17%K977D6 7@4z4@4zHz@4 Hs:@4 "444@4wH^ޟ ^_J Hz@4@&`@Hz@4P&HeH `bC4ދ JC49 2C+`4:@!@HbHz B *`Z 4 @4 2HhA +`4:@9#HC4%8@C%"C4ފ C4$"8$C+`48 UǕC ZǚĨ@C"Z+`444' D@ 0@Hb 4Y@4%z4?@K>HsH ` 74 @4 +`444(HxHz X E  @6?< *H  7@58#4?}@K>+`444'H|Hh D  @6? *Hy 79@5#R4?}@@K>4‹""C "+`444' D@ 0@Ha 49@4#b4?@K>Hg4 k?7?4@7?i!0@@4z4 p@4z4z@7?i@7?iK>7k?7?4@7?i @@4z#7 p@4z4z@7?i@7?i0K>HP7hP@4zK>K?1K?)K?!K?K?K? @O?HX4EhX@4zK>@4z4 @4z+`4& @4z4@4zK>@4z#7 @4z+`46 @4zK>@4z! 59 @4z+`45 @4zEK>@4z!5 @4z+`44 @4zK>k?ok?7CKZ `7$`@4@@4 |  | dK?YK?@O?HwH _K?Y _k? $  Y@k? |K? 7 aK? | E bk?o7CKZ@ "@@ ` ` `K?Y@O?@@@@K_@_k?ok?7$ 7C@ j@4k?4z@7HzK?@4HwK? hyK?YK?@O?k?ok?K?7$7CK7 Z k?@4zHzH@K?HK? hxK?YK?@O?k?ok?77C Pk?4z@4HzK?@4H hwK?YK?@O?k?o7# @k?@ *@4zK?7@4yK?Y@O?k?77?K9K @ ?K?Y@7?k?ok?77C k?4z@4HyHz7??_2C 7?Hz@K?@4Hz D h}K?YK?@O?k?778k?#7`@7?QK?@7?QK>@7?? nw newdl deletenewdeletevn new []vd delete []as=ne!=eq==ge>=gt>le<=lt<plus+plapl+=minus-miami-=mult*mlamu*=amlconvertnegatetrunc_mod%mdamd%=trunc_div/dvadv/=truth_andif&&aatruth_orif||ootruth_not!ntpostincrement++pppostdecrement--mmbit_ior|oraor|=bit_xor^eraer^=bit_and&adaad&=bit_not~cocall()clalshift<<lsals<<=arshift>>rsars>>=component->ptrfindirectmethod_call->()addrarray[]vccompound, cmcond?:cnmax>?mxmin*szsizeof autoAutomatic selection based on executablegnuGNU (g++) style demanglinglucidLucid (lcc) style demanglingarmARM style demanglinghpHP (aCC) style demanglingedgEDG style demanglinggnu-v3GNU (g++) V3 ABI-style demanglingjavaJava style demanglinggnatGNAT style demanglingconstvolatile__restrictconst volatileconst __restrictvolatile __restrictconst volatile __restrictoperator operatorassign_type_ada____<%s>global constructors keyed to global destructors keyed to import stub for statictemplate <class> class()%d.e'falsetrue0JArray1Z__pt____tm____ps____S,_GLOBAL_{anonymous}___imp____imp___std____sti___ virtual table0123456789Qt__thunk_virtual function thunk (delta:%d) for __t__vtbl__::[]unsignedsigned__complexvoidlong longlongintshortboolcharwchar_tlong doubledoublefloat%xint%u_t-2147483648U...__ct__dtT%dX` (@@Hpx.::.::.::.::.:: type_info node type_info function.::.::.::.:: (08@HX`hpx ( 08@8HPXhphx(0(8HPHX`h`px (080@HP`h`p`x  (08@HP$.$AAX!|| X! | ,X!8$X b@ a D;X!\PJX!tLL\_X!@ho)X!`$$tX!  X!$;X!p@@ZX!T0TlX! X! \ 8\X!  2X!  ,)X!4D D X!x` `>X!XZX!$$tX!d(dX! DDX!P(0.X!P4^2X!t$t@0X!L(X!(X_X!!\!\d GX!&&`p (X!((| vX!,|t+t ~X!,H,pH 4X!.8- 9X!//x oX!44@ nX!::\ X!;p;p 9%X!=< ^iX!@@X X!Ad@ X!HHG X!N8Nd8 I)X!POr*X!QP$X!QXQlX0'X!SDR<X!SSxHX!TpT$pT X!UlTl`X!UUl-X!V `U`x=X!VVKHX!YxYxX!ZYX!_^OX!_4_44cX!__hq X!_ _x | X!`h_hX!`l`_`X!`T`LTX!a @`@X!a`,`,X!a|a |X!b8a8 >(k@,K>(pd@8L $TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$LIT$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$DATA$ $SHORTDATA$  ;^R:1-678QQ[[ %7%=%>%;%?%B%9%<%8%:%;%A%@%g%j%o%l%n%m%h%i%k%o%h%s%t%%%%t%z%{%~%%x%w%}%y%%u%|%v##"## ###"###"###"# ##" ##"  ## # #" #" #" ## " ###"#####"##" # "###"##"##!#### ###"# # ##"###### #######"##"### ##&#"##### ##"##"###"## [[6 0 0ȉ66  68[[ QQ78QQ87818PP6PP1 PP PP 8781PPPPPPPP 6PPP8PPXX VVXX7 8VV67 7!17#ȉ8 7$6"4"[[?7%8&1'8(8)8*ȉ2+8,1-1.10816261'23151. 1141141ȉ36 pG[C[9D3E 6 8F3E 82H2I 158J 811'9K3E2H2I2+2311'82H2I1 9K 8J 152H6 ȉ2H7M8231  ȉ36 PPP9O68 362Hȉ366 8&2H9N9D36 6  9Nȉ36[[  6 ȉ366 2H2R8P366 8Q 9D628S72H1. 6T6 2Hȉ819O6281231 8L6 62H3662816 68362H7M12R622H8238111'2H 4U ȉ76   9V1'36ȉ2H1X823 8Z1 7[7361'2H8Y8237[18QQ736 6 64W1'6T8\2I 3]4UpG2+2I1Չȉ71'2382/4_8*1X232/101 4_6ȉ8 [[ QQ78( 7` [[6 2H64W[[ 7a79^ 2H6  QQ7QQӉQQ7c87bQ36Q7!pG[[Q 9D9K6 67cQ2HӉ9D9K6 68 72H7c36 pG66 8&2H1.6pG9D9K8 2H628172H1.36 ȉ8 6 63e 2+2H  6T 1'6 2HpG1X9K6 4d8233]2H6 6f4UpG2H232I1[[ 1'pG[p[Ӊ8r2H231 2+ 9O7M8q 6 63e2I2+ 61'9K3e1X9D8q2H6 2+69D7M 6 12H2R 1'ȉ2+68S688&2H9K23[[+66T1'8\ 4U2H231ȉ2H[[ ӉQQQӉ6 ȉ2H628171.36 QQ2HQ[[ QQQ 6 1' 62823 1X3E627#81  627#81 627# 6281  1.  1.  ȉ2HӉ 7M 6 ։8231 ։։ӉӉ 7M  8J1  362 4Wȉ7Ӊ QQ78QQ[[PP6 PPPP PP 81X2H23181X2H231 PPPPPPPP627# 1.6281 28128163e3e2 81ȉ8&2H%  ##"##%  ! 0A@0 DB@ AXht0B@0 0A@ e    a <_ `x C 0 Q Q'@ 7_7   0 A4 '0 L 0 l 3 0 A   A  A / T ; $0 <8_k QL"4C Q\!/{ Qp @=` Q+ 1U @   @;_ 0[ P2U Pd<`O x    0 \   P   (8 8a UD%< P\-R Qp,s A@x @:_ @>` Q3V U! Q A&@[ US U0+ QT' Qp @@a /T' T0T U&c T(  9_{ Q)Ng Q@*O A`+P Q|+ P.S{ U - T5Y! A$; " " T #:_ P 4?a H% T'A d'Bt t'B 'B 'CL 'C 'D  'FT 'F` b Q 4Y Q (G $(N\ 4(J` D(Jh T(J d(J t(K (KX (K (K (L  (LH (L (L (L (M (M $(Ih 4c @( Q L,Qo @ X6^cplus-dem.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. DS$cplus-dem SD$cplus-demmystrstrstrlenstrchrstrncmpcurrent_demangling_styleset_cplus_marker_for_demanglinglibiberty_demanglersC$26 consume_count _sch_istableS$27DD$consume_countconsume_count_with_underscorescode_for_qualifierabortqualifier_stringdemangle_qualifiercplus_demangle_opnamememsetdo_typestrcatstrncat string_deletememcmpsquangle_mop_upcplus_mangle_opnamecplus_demangle_set_stylecplus_demangle_name_to_stylestrcmpcplus_demanglecplus_demangle_v3 ada_demangleinternal_cplus_demangle grow_vectxreallocstrstrstrcpysprintf string_init gnu_specialdemangle_prefixdemangle_signaturestring_prependmop_upforget_B_and_K_typesfreework_stuff_copy_to_fromdelete_work_stuffmemcpyxmallocstring_appendsdelete_non_B_K_work_stuff forget_typesstring_appendn $000000A0 $000000A1 $000000A2 $000000A3 $000000A4 $000000A5 $000000A6 $000000A7 $000000A8 $000000A9 $000000AA $000000AB$L14demangle_qualified remember_typedemangle_classM$25 string_appendstring_prepends demangle_argsdemangle_templatedemangle_template_template_parm get_countdemangle_expressiondemangle_template_value_parmdemangle_integral_valuedemangle_real_valuestring_append_template_idxstrncpyregister_Btyperemember_Btypearm_ptdemangle_arm_hp_template string_cleardo_hpacc_template_const_valuedo_hpacc_template_literalsnarf_numeric_literaldemangle_class_nameremember_Ktypeiterate_demangle_functiondemangle_function_namestrspn arm_specialstrcspnstrpbrkrecursively_demanglestring_prependnatoi $00000261 $00000262 $00000263 $00000264 $00000265 $00000266 $00000267 $00000268 $00000269$L57demangle_nested_argsdemangle_fund_type $000002B9 $000002BA $000002BB $000002BC $000002BD $000002BE $000002BF $000002C0 $000002C1 $000002C2 $000002C3 $000002C4 $000002C5 $000002C6 $000002C7 $000002C8 $000002C9$L65sscanfdo_arg string_needcp-demangle.o/ 996061289 0 3 100644 33908 ` 1_t@RR?\\_o|y`jx `G!k?/,/-/.ok?97C4@"(k?@"K?@4Z"Bcr@x4"6.`7?a \ &00N8E&E_7?aa"#B7T. . 7?aK? ''001n0N 1A 'I9 @@7`!7?a$'('(08G'0G0N9E'8E0 8_7?a4K>K?9O?1/0./0-@/0,7:@4` +`H<ˀK>+`mH<+`UH<k?ok?@4(70`"K?@4z04K?Y4|@O?k?o@ @KC `?4zK?Y@O?k?ok?7DKZ7#K]KS } `@K_77? ҕu @4@ P4HK_4xKV@  P4ˀ(K?Y+`H<?HK?YK?@O?+`H<?@k?o7C@4 7+` H<Hwk 4 K?Y@O?K\K @_K_@KK_@K_K @kK_KK  P4@ K6? \0@4@KWJJ@  k?ok? k?7DH7k?!4@k?)!@7HK4KK?) @K?!!@H H? JA@ _h H(7@ h( HH(6 h4H( @Dԃ DK>K?K? @O?+`H<@4+`H<H(4h 7@4+`MH< `BKW7`2KZ( Y CӳK@ˀ@k?7@4 0K?Y@7?k?o7CKZ@ @@@4zK?Y@O?K_ KW0Y j Y@k 0K\K ??@@4@K_0?@kY0k?ok?7CKZ0Y 07$K_@h0Hz0D?@K?YK?@O?@K\0k?ok?7D@4@ 0744|K?YK?@O? d44h d ` `@h`0 h|8`}4|Hw @ ڋ?Mh|(@Hz8`54|k?ok?7CKZ0@ @KD?4Hx7?`2H( @4?@@Hz(@Hz@Hz8@4zK?YK?@O?k?oK_7#C 7ˀ`k]+`H3 ""@60+`h<+`H9#H<K?Y@O?k?74@k? BK?@4 @@K?04K?Y@7?k?o@7Ck?Hw4HzC_JJ 8  k?i4 r@4z "@K>@4z 4z@K?4K>@O?7?a@4z?@H|C?4z4?w4zK?a??47?i@4z?M@%4zk?ok? k?7D@7#k?!H44@_ Pk?I4 b4"4@4y"K>@4"x `HC@0C4!(@H76hK_KW"6P@ "47?I@4!4H@94  0@K?!4@4!X@@4!:K?I04 }4@4y?GHK> `7?I@4 @HC<4 p@K?!4@4 P@@4 2K?Iz04 z@ `4K>K?K? @O?+`H<?@7?Ik?ok? k?7Ck?!@4"7Hd@4䃟 4? 4_!B@40!74z@4HzKW4@KT@  z4HzK_4KS@  !:H@4z@4X4+`H%?wHzH@4z@4 rK?!@4z P74z@47044+`H%4K>K?K? @O?+` H%k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>7C@7$k?aHt+`4k?B4&44`4 4 4 4 !444p4r@4z"B HsBu "HK?@4z!HtB@!:_(k?a HQ@* ?H@R @ (K!" HzK_5KY@ ?  ˀJG!@4z!"K?a04 4K>7?a4z@4 ‚K>HtuHs 4<`H?@pK>YO?@@4z?u@0K>Y@0#@ 7K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>k?7KB4`@_ @4r`@@ bhK>4 4! 8?@@04K>@7?4Š44_g44Ƌ :K_C0C4074@7??E@54#70k?o7C47?@4 @K? # p7<Hx8@4z H@HzK_KWHx8@  44K>@O?+`H<?@4k?ok? 7#k?4k?@k?! 07+`H<K>K? @O?K?K?4@K?!HK?@4 |@4ˀ}K>k?ok? k?k?k?!k?)k?177D k?A4H!" JHC4܋: *7hK?A@4Z!"4`4H444 rHCH @" @H h 7hC@K?A?H+`H<"6K>K?1K?)K?!K?K?K? @O?+`H<ˀK>k?ok? k?7D77%@74z@4!z@ZHC!r7hC9@4z!RH+`H6 4:@k?!@HdK?!74@7 r C4\ 4 4Hw 2C4 #7`@4z4K>K?K? @O?+`H< @4\+`H<k?ok? k?KW67kVB6+`kBB47D47и"H64`xB24rb"HKA#7`KS@ a "4@40 `K>ق#2@#Bӽc24 7?A \$A00N8E$IE IR\7Ӆ ] HB3Bց ?-֝ ӵ?@ Hg?HKA"6K_@ !4HKVKYH@ 6 !4Hˀ a4 8 J"6].+`H<=@K>HK\"6`K]@  `44@@0 `K>K?K? @O?+`H<?@}4+`H<?@EH+`H<?]@UHg? @-4\ k?ok?k?7D@44 @7+`H%4K?YK?K?@O?444@4y+`H!!@HK_"6KY@ ? +`0H% HKW4xKT@  4HKS4K\@  (@@4z4Ƞ4+`H%4z@@?@M4+`H%?4z-Hk?ok? k?7C@44 7+`H%4K>K?K? @O?H%!@4?484444z@4+`H??@HzKW 48 KT@ +`0H%?-@HzK]4K\@ >+`4HzK_4XKS@  @44@4z ȼ=4@4 k?!+`H%444z@7+`H8 @HzKVKDK?!@  4HzKC4KW@  (@@K?!4Ƞ4+`H%K?!@@?@4+`H%?K?!-Hzk?oK_4C h7C4Ћ7 7hz@4z z4z@4 RXK?Y7h}@4z "4z@404K?Y@O?"`6| k?ok> k>K_47CC"7hz4@4z%7HzKY#7 PK]@ %47>i@4z%H7H4+`H=,7hsHz#KTKE @7 ,R44z@@$7@4z$7@4zk>!@4#@7444z@44@4z 7@4z7#@Hz"`K_6x 0KS@  "4HzKYK]K>!@ +ȠK>!47+7hCҕ6?{4?#@7U H%"@4"4+`H%"H4zH%"j4zH%"J@4zH%"*4zH%" 04z+`H%!4z+`H%!4zH%!4zH%!z4zH%!Zx4zH%!:4zH%!`4z@K>!+`H%+`H%=GHzK>!@@+`H4=@HzKV4@KU@ =w+`4HzKU4KT@ @444K=K>K> @O>+`H%?457>i7hbHz KUK_ @48 <@44z@@?7 47hdHz @KVKW 4X @@}7m4Hz7hw#KBK] @7 ;+`44z@@=747hxHz"KDKS d @6 ;?+`44z@@=M7=4Hz7he K\KX  @4 :+`44z@@<747hHz KAKY ! @4 @:M@44z@@<7 4Hz7h| KAKX  @4 `9@44z@@;74@4z;]7HzKT4 K_@ 9o+`44z@@:747hvHz K\KW @4 8+`44z@@:U74@4z:-7HzKS4 KE@ 8+`44z@@9747haHz KBKY " @4 8+`44z@@9%7@4z97HzK]4 KD@ 7+`44z@@874+`H%8o44z+`uH%#%7 @"` 6e k?ok?K_47CC!7hvB?4bc4fC@HzK\KAHx8@< #`4H7hy+`H8CЗ"6?HzKW#7 `K]@ #4HzK]+`4!KT $ @ "4HzKU4KV@ "ˀ44#7huBӟ4`b4dBHzKU4KBU @@"x4HzKVK\Hx8@ "h4Hd4hx+`H7@_ 7?HzK_"6 KY@ ? "4HzKY+`4"KS D @ y !4HzKT4KU@ !44K?YK?@O? 4 +`H<?@}H+`H<?}@Hz+`H<?M@Hz+`H<?@ 4 @4\ p+`H<>@eHz+`H<>@uHd+`H<>u@Hz+`H<>E@Hz+`H<>@4 `4| k?ok? k?k?k?!KW47Ck?1B7%"44?!4_#:4%4! @4z 87HyK34K=  44K>K?!K?K?K? @O?H'?4HH'?4 HH'?g44z4z@4?%7?44H'#@HH4X   @4?@46h|4z_e4>]7HzH@4T>o+`4H4 4K?1@4z=746ha4z_4=7HzH@4L=+`4H45 6hv@4z= 7@4z<7@4zHzC_4 (7K?14z_44 "4z@4@@4z p7@4z P@HzK_4@KU@  +`H'HaH4H?  <@#HzH@7 k>k>@7Ck>!Hx4z4C@k>k>)4``з4r@4 4"j7>@4z"(74@407@4z"k>14z@4HzK_4KU@ $H9@4z@44HzKY4@KBY @@$44?@4z_4z#7K>1@4zK>K>!@4z#P7(4zHzKT"6 0K_@ $4H|7h_4z"7??K>4z4‚@J4`:4䀶 *@4z"P7Ȁ(4z6?4? 4 +`H&#@7F 4@4z>74@4z!7Hb@Z4U>@K>K>!@4z!(7@4z>M74He@@0@` 4r@ 4!7>@4z x7Ha@94 *@4z=}70444z@K>)44K=K>K>K> @O>H&?4HvH&?4p4z+`H&H9@4z@4?74 Hz+`H&?4%4?@4z>7H|4;@Ȁ4zK>!7>@4z>m7ȀE4z+`H&>G4=H|HzKS#7 PKF@ >+`4Hv6hf_4z=7@He4hw@4z=]7HzK]4@KE@ =+`44z_-@<7# 7& pk?oKW7CB4X x4‚@ 4@ @4\ K?Y@O?H< @K?Y@O?6h|@4z04K?Y@O?+`4=  " K?Y4<@O?HzK_KY@ ? ?+`4HsK?Y6tˀhtk?ok? k?k?k?!k?)k?1KT7C7$B4 4@4H4 44p@4!Hs6aha@?!* j HaH6? !4@@4!+`pH<Ha:H7? !4@@4!+`H<@4K>K?1K?)K?!K?K?K? @O?H^w4H7? >O44@@4>/4p+`=H<+`%H<44@4=Hs+`H<44@4=Hs+`H<k?o7Ck?@4!HtB4: z+`H= H@HzK_#7KW@  p4Hs6uhuK?@4z R4z@404(K?Y+`H<?HsK?Y@O?k?ok? k?k?k?!k?)k?1k?9k?Ak?I7DKZ(4?KAKF7% @4P!4 HC"*4"+`4'4! 4 @!@4 4 @4!@@4Ka7I7? U!4@@50H75|K>K?IK?AK?9K?1K?)K?!K?K?K? @O?+`H+`?5|]H|e5|IH 5@  H!"7hHC 4c> @HKB4RKH  @@!J4 !j!@m5K4 8@HH@5>@H@5`?H5|`:HK_58K]@  :4 4@@>}7u5|H`?4M5|+`H+`>@5|` ! `05+05|k?7@@04K?Y@7?k?ok?k?k?7%7D@44!4HC]Ӻ4 pӿ4`A4ra @4!7444@4y7! !r!""`#"044K?YK?K?K?@O?H&?@@H&?u@8H@4 @@4 x@@474@4ܞ@ܞ4+`H&ܞ4ܞ4@4>u7 X@HK_"6pKS@   +`H&HH=H? 6?= HKY4KE@ =+`4`>@HKW4xKBW @@=+`4HK\4KS@ |  @+``K? @O?HzK_KY@ ?  4ˀK>+`H<?@uK>k?ok? k?k?k?!k?)k?1@7C4 7+`H<K>K?1K?)K?!K?K?K? @O?!@HzKW4KT@ "*ˀ4zH|8k?A@4 h|8+`H<4@4z>@4x@4z>@+`4& 444z@@>}@@4z>]@@4zHzK_77K]@  44@59HuB>@4|@4z=@Hb4AhaK?A@Hz8he84z@4ˀMK>H>4z%K>H?4K>k?ok? k?+`H47CK_ C4€@j4`Z+`H%6?? 4!4ăD!4҃"4؂"HzKU4PK]@ #44z@@" 7HzKT4RKY@ 4 #r44@@#xk?)+`H%H% 4H% h4H%@K?!!:Ƞ84 4p7hb@_4` p@HzKS# 78KW@ ?+`4Hu6Ƞxhv4b? RHzK]#7K_@ >+`ȠHu `4e4K>K?K? @O?7h|@4k?!444z@7 P7HzK_KVK?!@  Ƞ +`H%4 d8 HzKWИKU@ =g+`@K?!e4+`H%>454z+`H%>_4m4444z@7 7HzKAKBK?)A @@ (@@K?)4Ƞ4+`H%@K?)?@e4k?oK_4C!7C4 Z7hC4 j7h}@4z b(K?Y@4z04K?Y@O?@4z?@4z@4?@47hs@4z?e@4z@4?=@-4k?ok? K_47CC 4"@4z!744@4z"7?94@4z"p@@4zk?K?9B`@HzK_4PKV@ +`0H$"@_4z7!@HzK]4RKY@ = !4HzKYKWK?@ # @@K?p44>W4@4z2D44K>K? @O?H$?484zH$?4K?9H$?44z4=4?C4Ȝ%4Ȝ4+`H$>U@@K?>4HzKT4PKU@ >+`44z_@>]7HzKS4RKT@ >o+`4K?9&=4HzKU 4K]@ >/+`44z_-@=7HzK_4RKC@  "Ȁ=4+`=H$+`H$=44k?o7C@4拀 4@4z @@4z p@HzK_#7KW@  @44z@@04K?Y@O?+`H<?@4zk?oK_4C 7C@4z BHK?Y@4z "4z@404K?Y@O?47 Z7hsBz4?m@@4z?@]4z"e6 k?ok>k>7$7C@4!He@4 Z4?k?K?4Y4z@4'h7# 7<4`` 4r@4b:4B*47?4H@4z?5@K>YK>K>@O>H<?@4H<?@4H<?u@@4H<?M@P4+`H<?@4+`H<>@4H<>@X4@H<>@h4H<>u@4H<>M@4+`H<>@Hd7??4?#@7_ `4HzKU#7KA@5 ?M@ˀXHdHzKT 4KU@ =W+`44 40HzKS 4PKT@ =+`44 p4Hz+`H? KVKW 8 @4<+`44*@4Ѓ<+`44 Hz+`H8 KAKY @ ! @4`YHzK\KW@  844z@404K>Y+`H<?4zK>Yk?o7C@4!@@4z!b4@4z!@@HzKY"6K]@ !4HC4V HzK_"6@KS@   44H|7ha@4z JPK>7?@4z "4z@404K>@O?+`H<?@H+`H<?@4k?oK_4C"7C7ha+`H4 BHzKW#7`KV@ "@4HuB4`?@4r_`47?i4@4z!+`H= "K?iHy@6!+`H<!`@HzK]4KC@}  rˀ 4+`H3`?}@HzK_4bKU@ ! ˀ=+`+`H< K>و z+`H6 bHzKS#7pKBS @@ ˀ+`H<04K>@O?+`H<?@Hu+`H<?@ +`k?ok?7C@k?AB@4!*@w4!@4z 7+` H$@4z 7@4z4@4z `7@4zk?K?@7 +`pH$@K?@4zH4K?@4y +`H$@44K?YK?@O?k?7"k?6@4 P4K?Y@7?H? @@K?ˀK?Y@4k?K?@7?+`@K?]K?Y+`#4:@@7@@K?Y???UUUUU\Allocation failed.Expected ?std::Unexpected end of name in .::Unexpected character in .Unexpected character in .Zero length in .Internal error.Unexpected end of name in ._GLOBAL_(anonymous namespace)aN&=aS=aa&&ad&ancl()cm,co~dV/=da delete[]de*dl deletedv/eO^=eo^eq==ge>=gt>ix[]lS<<=le<=ls<<lt<mI-=mL*=mi-mlmm--na new[]ne!=ngnt!nw newoR|=oo||or|pL+=pl+pm->*pp++pspt->qu?rM%=rS>>=rm%rs>>sz sizeofoperator operatorUnknown code in . [nv: [v:Unrecognized .guard variable for vtable for VTT for typeinfo for typeinfo fn for typeinfo name for java Class for non-virtual thunk to virtual thunkcovariant return thunkconstruction vtable for -in-Unrecognized .Error.in-chargenot-in-chargeallocatingin-charge deletingUnrecognized constructor.[Unrecognized destructor. [::*Non-pointer or -reference function type.complex imaginary Unexpected character in .signed charboolchardoublelong doublefloat__float128unsigned charintunsignedlongunsigned long__int128unsigned __int128shortunsigned shortvoidwchar_tlong longunsigned long long...Unrecognized code.Non-alphabetic code.restrictvolatileconst [extern "C"] , Missing function return type.Missing function parameter. () Template parameter outside of template.Template parameter number out of bounds.ibi iii ll ii i Unimplemented.falsetrueUnrecognized bool constant.:(stdstd::allocatorallocatorstd::basic_stringbasic_stringstd::stringstringstd::basic_string, std::allocator >std::istreamistreamstd::basic_istream >basic_istreamstd::ostreamostreamstd::basic_ostream >basic_ostreamstd::iostreamiostreamstd::basic_iostream >basic_iostreamUnrecognized .Substitution number out of range.string literal [# [#0]_ZMemory allocation failed. HPX`hpx (08@HPX`hpx (08@HPX`hpx ((8@PXhx <<X!xx 'X E` D ,'QX!HxH8xX!@((DX!hPX!DD\X!Th X!d  t X!p   X!| X!44 X!D X!X&X!0t0+X!$009X!T00GX!((X X!$,$c X!Pp X!D`D{X!$ X!,X!<(X!<dd4X!H H@X!hLX!<X2X! L LdG6X!  hp}1X! ||X!\X!p||X! l X!x%2X!\\W@X!l((7X!VX!|$X! AX!( @ZX!",! _X!%%4 X!*8) (X!+*$ 9X!,,,0 !X!-`|,|< IX!/$/\$H NX!04/4T \JX!241` *X!3$2l IX!44hx dX!77l }X!88< PX!;x: #X!<; X!<`<0` -X!A@ 0X!B(ADX!CCLR3X!DD@/>(O@>(R @ f>(P@ $TEXT$ $PRIVATE$$CODE$$LIT$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$DATA$ $SHORTDATA$ $SHORTBSS$$;^a:-=b 7ȅ QQQQQQ%E%O%I%H%K%J%G%F%N%L%M%T%W%[%V%\%U%Z%Y%X%]%U%T%h%j%k%o%m%n%l%i# #*(# "#@###  #"#####"#"## ##"# ##!## ##### # # ####"(# # "##"# # "## ########"!######"#P#####"## # #"#F #:# # #9# ##2###!##"###671 8 QQQQ6QQ 69 7QQ1QQQQ 61 1  1661111 1  QQ$6%QQQQQ7#6'6 6(7*27) 6 7+6,Ƞ$8-7. 8607/  QQ7# 6718 8221QQ737#QQQQ6Q $7.88-60 7/Q6, 64 6685Ƞ$ӵ97Ƞ$8882QQ6QQ998:17QQ$QQ1;7< 7RR$6=8> 7?QQQQ PP$8-64(AQQ6@ QQQQQQ6QQ99RR$8-QQ828 1QQQQ6QQQ199RR$8-QQ82Q8 17#6QQ99RR828 1QQQQ 6B7#6CȠ$ӵ 7#Ƞ$8-7)RR6 6@66997#6@$8-82 PQ1QQQQQQQQQQQQQQQQQQQRR8 QQQ$8-6@QQQQ6B7#Q6'Q6C7#Q6'Q6DQQQQQӵ82RR$8-PP8 RRPPQQQQQQQQQQQQQQQQQQӵ6@QQQ7RQ1 8 Q8 Q6 6@6 7R68 QQ$8-Q821QQQ7S 66 7^667182218 28Ƞ$8-6_`QQ7R6a 8607/2QQQQ21QQ7^ 8QQQ$8-Q 648 Qӵ Ƞ$Q64PP8-Q Ƞ$7b7QQQQ QQQQQQQQ7#RR$8-7*QQ 8 Q$6 6@67QQQ 18 $82Q8-6@QQQ7)7# 699QQ6 6c67#QQ6@$8-QQ 8 Q82QQQ16 7# 977Ƞ$82QQ5QQ$8-6QQ7#7 Q$6 6d68227 12QQRRQQ 8 6@6QQQQQ1$8-QQ9982QQ8 Q1QQQQQQ6'6@6e7#6c 6f6 8568 QQ 8216gQQQQQQ Q$8-Q QQQQ7#6@Ƞ$8-6'QQ6a6e7#6&Ƞ$ӵ7# 8Ƞ$ 97QQQQQQQQQQQQQQp8-QQRRQQRR7?QQRRQQRRQQ827#QQ7#6'Ƞ$8-7q7)QQQQRR$8- 97RR7RR8 RRRQQRR$8-QQQQQQR6=6!QQ6 1"6&67sQQ11"7?QQȠ$8>Q167rQ6upv$7w0x%$"%$ 4<@ H=@ \>@ Ap D {  A< X h x @ @     G Q [ ( D \  Qh w   @ A/ @S @c 8 X l? A F # k & A? A-, A4  P8@h A  A7<3 12 A+* A k $_ Q@" \' Ux Q!{ U o!!! !! 4)%7 HD l# $ % & & &( &x & & &\ (& 8&@ H& X&  hD Qt(! A// A,,/ )) )% )'$ )'0 )'L )' )( 0)&| @)) P))T A `./_  *) E  01 +  48?  37o  24k  ,6;  H5: h7@, x7= 7>  7>X 7> 7> 7?t 7? F A 9A A :CO :0  4;DC L; d; p; |;cp-demangle.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.DS$cp-demangleSD$cp-demangleSB$cp-demangleint_to_dyn_stringdyn_string_append_charS$22DD$int_to_dyn_stringstring_list_newmallocdyn_string_initstring_list_deletefreeresult_add_separated_chardyn_string_insert_char result_push result_popresult_get_caretresult_set_caretresult_shift_caretresult_previous_char_is_spacesubstitution_startsubstitution_adddyn_string_newdyn_string_substringdyn_string_deletereallocsubstitution_gettemplate_arg_list_newtemplate_arg_list_deletetemplate_arg_list_add_argtemplate_arg_list_get_argpush_template_arg_listpop_to_template_arg_listcurrent_template_arg_listdemangling_newdemangling_delete demangle_charC$21strdupdemangle_mangled_namedemangle_encodingdemangle_special_name demangle_namedemangle_bare_function_typedemangle_nested_namedemangle_local_namedyn_string_insert_cstrdemangle_unqualified_namedemangle_substitutiondemangle_template_argsdemangle_CV_qualifiersdyn_string_insertdemangle_prefixdemangle_source_namedemangle_operator_namedemangle_ctor_dtor_namedemangle_numberdemangle_identifierdemangle_number_literallystrtoldyn_string_cleardyn_string_resizestrlenstrncmpdyn_string_copy_cstr demangle_typeS$56DD$demangle_operator_namedemangle_nv_offsetdemangle_v_offsetdemangle_call_offset $0000016B $0000016C $0000016D $0000016E $0000016F $00000170 $00000171 $00000172 $00000173 $00000174 $00000175$L104demangle_type_ptrdemangle_array_typedemangle_function_type $00000276 $00000277 $00000278 $00000279 $0000027A $0000027B $0000027C $0000027D $0000027E $0000027Fdemangle_class_enum_typedemangle_builtin_type$L150demangle_template_paramdyn_string_append_cstrdemangle_expressiondemangle_template_argdemangle_literaldemangle_expr_primarydemangle_scope_expression $0000043E $0000043F $00000440 $00000441 $00000442 $00000443 $00000444 $00000445$L257demangle_discriminator cp_demangledyn_string_copycplus_demangle_v3dyn_string_release__iobfprintfabortdyn-string.o/ 996061290 0 3 100644 4992 ` 1 @  ( 40P G!k?ok?7$ 047C@4 d74  `K?YK?@O?k?7k?@4k?K?@7K?YK?@7?k?o7C@KZ@4zK?Y@O?k?7K_k?@@K?YK?@7?k?oK_777C`7 Y7@  y@Hz |K?Y4|@O?K_@@k?ok?7CY H7$H@4z B4K?YK?@O?@@HHz@HHς k?ok?7C7:@k?74z@7 "4K?YK?@O?Hz@K?ς dk?778@4K?Y@7?k?778@4K?Y@7?k?ok?k?7C7X @7%HH  @4z *ˀK?Y@@HHwA`@ "_P4_?HvH 7   _6?` H|H w <  6?7?HtH    U7?77?HzH  z X HsH S y  4HwH @HHHt 4hsK?YK?K?@O?k?ok? k?7C7%k?!@7Hu7 @4z0ˀHwA2 }P7?Hb W   B  9_6?` Hsw   VHt6?   !7?H}   Hs6? D z   \=7W?HvK?! @4H| ha4K>K?K? @O?k?ok?k?KU7$7C7@60ˀzHwA2 }P7?Hb W 6 B  9_6?` Hsw 6 VHt6?7  !7?H} 6 Hs6?7Tz   \=7W?Hv  4Ha4"hbK?YK?K?@O?k?ok?K_7$7CK9@ ?  "4K?YK?@O?HwHx @HHHs S 4h}k?ok?7C7:@k?Hx7  @4z "4K?YK?@O?HHw @K?Hy $ ςhzk?ok?KT7$7C@60ˀbHwHy 4Hs6Hz _ H}7huK?YK?@O?k?ok?k?k?77C7&` H x` @@4z@40ˀ4?AZY?P7??HHz  W  Y \_6?` HH}  t 6? HHv 7?  " E 7X?HHa:   } 7?HH|  Hs d 4 dK?YK?K?K?@O?k?7K_K7 4K?Y@7?KZ@K904K?YX!LL X!4L4,X!((8X!(((D/X!PLLP=X!\K X!d,dhVX!XXtlX!h  X!  X!H(HX!pX! X!hhX!xllX!ldlX!P44X!@@#$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$;^j96 6711 770 7 6 77 88 70 48 6 7.8 7777 6 77 7 0 7;70 A4H0 TO0 h0 0 A0 0 A/0 A,0 A80 QP +0 Ah  0 Q s 0 Q 0 A 0 A0 Ag0 U0 A4Hdyn-string.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.dyn_string_initxmallocdyn_string_newdyn_string_deletefreedyn_string_releasedyn_string_resizexreallocdyn_string_cleardyn_string_copyabortstrcpydyn_string_copy_cstrstrlendyn_string_prependdyn_string_insertdyn_string_prepend_cstrdyn_string_insert_cstrstrncpydyn_string_insert_chardyn_string_appenddyn_string_append_cstrdyn_string_append_chardyn_string_substring dyn_string_eqstrcmpfdmatch.o/ 996061291 0 3 100644 788 ` 1p@ HH(pDG!!k?7k=@7> JK=@7>ш *K>K>ы K> K>ك7 4K=Y@7=ςK=YX!XX $TEXT$ $PRIVATE$$CODE$  ;^j7-P6(7 0 A0<fdmatch.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.fdmatchfstatfnmatch.o/ 996061291 0 3 100644 1728 ` 1 @t( L0tL0G!k?ok? k?k?k?!k?)CB77$#7W+`48444Z44^4\` _#Z J4~V#4T%zc@ V#"ςpK>@%`߿ ($%ˆ @?%B60B4 6046B64A`_ (@B6` @%4%Bc6 `$] jB ZB`_ (6B6 $` B6cĒ B6 ( r4~4^4T @!#ˆ @#B6 ( E84!4ˀK>قb :@$*B@6 86b?@ ZςK>@ @Bc6 c@ ""B4@<]6@#jǃ 4^#b4K>K?)K?!K?K?K? @O?@!b`!b`߿ (7$ "`/B@??BςUK>6?k?1`_ (@B@+`49`&  @+`4'4 `  *4xK?1__ 4 4@?@ςUK>ςEK>ς5K>ς%K>ǣ_B@4\<5@ *`'B@?4^<BςK>ςK>ˀK>ς}K>ςmK>ς]K>ςMK>ς=K>7@*c  @7%{@b:4AςK>ˀK>ˀK>X! $TEXT$ $PRIVATE$$CODE$  ;^k:L QQQQQQG0 Q0<fnmatch.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.fnmatch _sch_tolowergetopt.o/ 996061292 0 3 100644 6004 ` 1dt@$l d*0DG!CW 07\ *7C?@4@k?ok?k?+`4?H7H8 +`H9 h x W W  araX4 P6? D X Ҥ `6 e4c_7`@ V   ֠ 476 m7 ` aH4P6? X ҃7 @67 D_4B`@ X  v 7ր 4\6 m7 7@ } H5K5kK k K?YK?K?@O?k?ok?+`4$h +`H9+`h74:@h h@4Z 4bHh4V b(h0h0h4|K?YK?@O?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>K>+`4'h +`H?7Hk?K>7$7k? 6 4%+`H4 R4 0h45@47+`4h<+`H? 4#C!0@HHm hhHn hh Ho%Hb HwW%% @@4H 8h hhhH& B4ZU&B&6 (4 0Z4 hv #*H 4 ZB :K?"B @4"HmA4 44 84 ?4z "5A ?5I:4!51Hy@ - BHJ:@ !Z@0 6*61 J:@?}6*h 6 hhjAW 24z "5JAW ?5JI:*4 Hy@ * BHwI:@ *"`05+5) I:@?}5 6 46* #:@#K?@&H B &HrB_@4&rHa49hy4@+j@5YHC@0H4,@0h'4 t&C4= C4vS'zC-"C,@C,hH6 h (h H@z C4Z C J7`8h C?7C ?7h:H" @6:WHH6hHw Hx ( 8@4hhH Hw (h̟(4Hm0̟7h 4h+`H( BH+` @ H4:@4Y@@@HzHd h}+`h H44~hH6hA!0IW 5@h+`H- !"7? C+`l 84:@#HIW@7P@@IWk? 49CH@@HzHb hs+`ICh#4~ "@7h h@HzHeK? h}K? I_ID  44+`H: :7?+` H"4:@@6@HzHx hx+`IZh:@0tt4~@4+`H1 H +`4:@C 2"HHw@6`H+`Hrk?"6CH@+`h H7h+`4% he(4~+`H' zHq+` 84:@!H5@5W0+`!H5 @5W+`h*p4~C4 44 04 hH7h_hjH57+`H0 8@+`"H4:@6`@5W+`h*@ 8t4~h4545+ +`H& :H+`"` H4:@@6y@HzHa hu4~H6Yh "AS I 5Ih+`H% 8@+`# HIw4:@@79@HzHx hi4~ 0@HA*7h h@HzHd hsK? K? @ -IId  44K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>+`H/ :7?+` H#4:@@7@HzHn hl@0tt4~4h`4hh` "hH6hH +`H9 8@+`!H4:@5`@5W+`h*@ 8 t4 ~h`d7h hk?74k?@k?K?Y@7?--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument POSIXLY_CORRECT?X!00 X!0, X! 8'"X!,  DIX! L$ $PX  p \D>(@h!>(@t)>(P@0$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$ $SHORTDATA$ $SHORTBSS$  ;^k:L PPPRReRPPPPPPRRYPY6 PPPPPPQQRRSSR8SSPPRPPPPPPP1RPPRR PR7PP8P6 RQP PPRPPPPRRQRRPRRPR7 RRRPP1PPPRPRQTTR``96PPPUURRRRQTT``ԌPPPUURQPPP TT``ԌPPPUUTTR``PԌUPUURRYYPTTP``UUUQRRPRTT``UU TTR``ӌPPPRRQTT``ԌPPPRRQPPPTT``ՌPPPPQPQRRRTT``UUPRQ9 ##,#%Y#&# #-## 0@00@@(0L@$0X@ 0t@0@ A 3 Q# @0 U   $00 Q< getopt.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. SB$getoptoptargoptind__getopt_initializedopterroptoptmy_indexexchange_getopt_initializeM$17getenv_getopt_internalC$18strcmpstrncmpstrlen__iobfprintfgetoptgetopt1.o/ 996061293 0 3 100644 896 ` 1@dd4lG!k?7K?k?@k?K?Y@7?k?7K?4k?@k?K?Y@7?X!$$ X!($(,$TEXT$ $PRIVATE$$CODE$$CODE$  ;^m:L990 U0@0 UX'getopt1.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. getopt_long_getopt_internalgetopt_long_onlygetpwd.o/ 996061293 0 3 100644 1456 ` 1@P` CG!Gk?ok=k=k=k=+`H#`!@+`H?+`h?!4$"@6 7@w4^w z7>@4z Z"6@7= 2K=K>ɋ @K=K>= 4@477@4 4DH@4z R E@477@4?H(+`h+`4h'+`h#4|K=YK=K=K=K=@O=PWD.X!88 8X 8 ,8 >(@8>(P@D$TEXT$ $PRIVATE$$CODE$$LIT$$DATA$ $SHORTBSS$  ;^m8X(PPPPRR67 67R1RPRPPPP"# 0@0 @L X8dp|getpwd.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. SB$getpwdgetpwderrnoC$22getenvstatxmallocgetcwdfreegetruntime.o/ 996061294 0 3 100644 820 ` 14@4\\(TG! k?74@7?K?K?Y : K? K? z 4 S 5עK>8    @7?X!ll $TEXT$ $PRIVATE$$CODE$$;^n9{Er70 4Hgetruntime.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. get_run_time getrusagehashtab.o/ 996061295 0 3 100644 5696 ` 1@@   p p(,!oG!-k?7+`474? p7X RS6svRT6Ҝ K: X?77? KK?YK@7?k?+`#4:@@7K?@k?K?@\ :84@k?ok? k?k?k?!7#7@674@4P74@4h 74    hHK>K?!K?K?K? @O?k?ok? k?k?k?!7#7@674@4P H744K>K?!K?K?K? @O?4@4 8 h 4   ehH@4ȠM4k?ok?K_7C zHw 6?``@H @ @0Hv7H4?@@Hz@4zK?YK?@O?k?ok?KW7C rHx 7?`ZH @ @0Hv7H4?@H Hz4@ K?YK?@O?k?7KT 7S766?Jw6766h7k?k?@k?K?K?K?K?Jw @  K ? ek?K?Y@7?k?ok? k?k?k?!K] 7CKD Z@ h| HxH @7@4  |0H0ˀK>@4 |H0h`0Hw( 4hy(H 0:Hv477@4z4ſ@@44K>K?!K?K?K? @O?k?ok? k?k?k?!7CKZ87]k?1Hd 74h}8k?9Hy7= 2HvK?147 @K?94?7H@7hx@ Hw4 B?H@HvK?147?m@4K>K?!K?K?K? @O?k?o7CKVk?7:7K?7@4zK?Y@O?k?ok? k?k?k?!k?)67Ck?1 @k?9Hs Hz( s ] @4z jHg K?94?4Hx8K?9747hy87@40Ha6hv(0% 4K>K?)K?!K?K?K? @O?B 0 H@ 7hw@刀6H @?@?Hu(54HvK?17?]@H| k?o7CKVk?7:k?7K?K?7@4zK?Y@O?k?ok?7C@4K@ H7Hv 74 Hw06hx0K?YK?@O?k?ok?K_7C7$?2Hw @H @@Hv H74 Hz07]h}0K?YK?@O?k?ok?KCk?K_  k?H 0*K?K?4z7 4c@K?YK?@O?@K\ K_(KW0@ 7K_8 0H@7?k?iK_@7?7?ak?k?.k?a/000n@7?Cannot find prime bigger than %lu  =???X! X!, X! 8( X!,D3X!0PFX!Txx\_X!xLxhsX!DtX!\X!DX!<0<X!<l<X!(DDX!lXX X!xDxX!<dd/X! > X!(I X!P8PT X  +,a>( 4|@|i>( @k$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$ $SHORTDATA$  ;^n:%VPPPVV80 67 67 1v11v1800  67 7 v671 0 v7v v6860v7v698v1  0 v1 v7 *#'' 0@0@@ X0l@ A  0 U0 U30   00 @OP A\ | _0 Q G0 A 30 U o0 Q 0 @ 0 @G0 P0 0#0 @+0 T; hhashtab.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. DS$hashtabhtab_hash_pointer hash_pointerhtab_eq_pointer eq_pointerhigher_prime_number__iobC$20fprintfabort htab_createxcallochtab_try_createcallocfree htab_delete $$dyncall htab_emptymemsetfind_empty_slot_for_expand$$remU htab_expandhtab_find_with_hash htab_findhtab_find_slot_with_hashhtab_find_slothtab_remove_elthtab_clear_slot htab_traverse htab_size htab_elementshtab_collisionsS$38$htab_collisionshex.o/ 996061295 0 3 100644 1048 ` 1p@p00@pHG!|+`4?44_7+`4?h4666x77Y7!4=74 4447+`474474 b6b:b8b<b>b@@6 X! >(p@,>(R@8$TEXT$ $PRIVATE$$CODE$$DATA$$BSS$;^o7-P6QQ QQQQ0 ,G<hex.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.hex_init _hex_valuefloatformat.o/ 996061296 0 3 100644 4136 ` 1 |(@ (  d | < H G!VK?  ` 6?] 6?u@6H7] 6?u@?67?@ X  @}@@t@: <\s@Z \\6 07?g @k?/,opk>k>k>k>k>k>k>KS 7D7k>H7:0H k?H@HH@H804 7H0 84*H( HH"!4@4@7?!k?1 X4 @k?H4K>H E@ Fk?9-04 G @0_e1 4k?HK>H@H"6 . 1N ,` K>YK>K>K>K>K>K>K>O>@/0,#7 /Q@4M0H K?  K? 6x?t4=?t@ ] Bu6?t@t@ ל Uu76x?K?tt@ ] Bu6?t@t@ ל Uu?U77? ]  R@t@ן7?x@  vUUx@V7 0Z7Z?_ @k?/,/-o`k>k>k>k>k>7C7?1k>@4HhK>@47?!,0 0$ 0 0$ H k?4Hd0k?K>HyHx@Hwk?4@Hyk?HxK>@Hw8K>YK>K>K>K>K>O>/0-@/0,0 0$ j4k?Hy k?K>4 Hx@Hw,,0N,,@7?AHb k?0H K?AHu( 7?k?K>HyHx@HwHe@~Hf8"6 . 4@1NHw@X4@0,K?)k?!k?),0 0. HxH (@蘀y@蘀k?Hy4 k?K>  @Hx^@]K>Y?Afloatformat_ieee_single_bigfloatformat_ieee_single_littlefloatformat_ieee_double_bigfloatformat_ieee_double_littlefloatformat_i387_extfloatformat_m68881_extfloatformat_i960_extfloatformat_m88110_extfloatformat_arm_ext`? @P?@`? @`? @P?@@  4`@  4`@  4@     X! X!Hpp, "X p$8.!X!,8,DO X! d P[,>(@\$TEXT$ $PRIVATE$$CODE$$CODE$$LIT$$CODE$$CODE$$DATA$$;^p941(9 ;wȍ"##JF 884 ȑ;w  % 04@0T@0x@P0@ 0@0@0@0$@`0@@00\@ t U0 P p T;0 Pg (4@floatformat.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.floatformat_ieee_single_bigfloatformat_ieee_single_littlefloatformat_ieee_double_bigfloatformat_ieee_double_little*floatformat_ieee_double_littlebyte_bigwordfloatformat_i387_extfloatformat_m68881_extfloatformat_i960_extfloatformat_m88110_extfloatformat_arm_extC$17 get_fieldfloatformat_to_doubleS$19$floatformat_to_doubleldexp put_fieldfloatformat_from_doubleS$21$floatformat_from_doublememcpymemsetfrexpmd5.o/ 996061299 0 3 100644 5848 ` 1@|8 G!Pk@(#L7k@ "m6w_"69W"6(XY@k@0KX87<K_?KW7KZ@:k?ok? k?k?KE07C"k?!KD  4d8kB Hf(4pph( 6@4Hy  c Ha(7Hu d ҡ\\74@4xK?!@4zK>K?K?K? @O?k?o"kkk7C7@k7(4 4 4@744@4w Š ? ?}@D_e@ςPKY 44@7K@74KYKKK@Ok?7k>7>ak> @k>K>K> @7>aK>@7>aK=@7>k?ok? k?k?k?!k?)k?1K077E 7$44g8 4@4H0 hw0 4b5 459@4xk?A ' @4K?Ahy0 4D:444@4x Є "4z84@4hd0K>K?1K?)K?!K?K?K? @O?k?ok< k<k<k 1Yk(KKKKK>P"6k<">M66.k<"6!k4.8k=#7=k=" U6k="ʝ6! k="6: k=#'K;79 sk="]6T3k="4659k="ȕ6,k=!鎅5k>!؈d5?/k> !Es5Nk>!5rk>!{5d3k>!!F5E$k>)! 5&(k>1!@5;k>9 4A 4 k>I a4(k>Q 4#Ck>Y |4l=k>a X4M$kk>i ?EZ#Mq4.%wk>q7'#k>yKGk> } KFk> 3 K\k> KQk>K< D  K<   & K<9   ) i 6  yK +  6  1 u k  4 5 KQ(k> \ K 6 KV0k>KP8k>  KM@k?4K<q  K< 9 ) gK<   5 v , 4 ь  %  *K<  *KQHk? KAPk?| u   4  Y  KVXk? KN`k?!I Q K<O  Y J fK<    A K T ѭ  $  )K<   V   KKhk?) 4KVpk?1  9KBxk?9   ьK<  a 4  K>y  Kt E  r  ֌ 1ь LK? l  a   K<M    K=K=   K? 1K>m bK=!  # Y  K> R   K=)  K=  K=6 R K?9K>    \K=1    c i )  #    K?p bK=9 Q C d    B     )   , K? * K>Jl IHK?1 h jK>  KK=AK=I M RK?) R  N  *  L ѭ    .K=Q H  0 K=Y  K=i      Q   K=a1l 0P  / - B  R  . R   M  C j K> O J N   L K?! K K=q P  1  K=y / J    , R lK=    L  N Վ| R   K=  2  / ь Q .   T K= O   K=  M  0 M ѭ R  , 5 K= 0   p    V K= P  Ր kU R N K=  +  Q  O  K=    $  Q  - R   K=    K=| N    '  Q  L ь QK= . K=    0  / 1  ,    P  ѭ K= 0   \   N Mѭ| M   - J K= N  L R LK=   L 1   K=  0 2 R QQ LP  ' K>   G K> Q , K n k 1 ' P  ) K> 2  M  r  N   K>  ) 0L K>! ` P  * K>)   GI % H   K>1 ,  HI ' D  / K>9   O   + % K>Aь   Q $ F K>I j    fL  K>Q / h R 1 &  I & Y K>Y   K>a   (U " I  1  ,J H v  F K>iѭ  OD K>q  K>y9 0   9R O    0 MT    L K>7Z    LE y K;KK?)K?!K?K?K? @O?X!hh X!h,X!@H@8'X!hhD7$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$  ;^s926 16 1100 0DP0 A\k0 pK0 @objalloc.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.objalloc_createmallocfree_objalloc_alloc objalloc_freeobjalloc_free_blockabortobstack.o/ 996061301 0 3 100644 3672 ` 1 X@     G!k?ok?7CK?04hw87?@xPh}0 04h@ y`xP Hv8HzH7Ȝ7:77 d+`H67Hs4 z d  z4 hy @uP֠ Ҵր `tPK?YK?@O?k?ok?7CK?04hw87?@xPhs0K? 04hw@h}H y`xP Hv877Ȝ7:77 d+`H67Ht4 z  z4 hy @vP ֠ `uPK?YK?@O?k?ok? k?k?k?!KW7CKX@vP  K_З KE6gHv8 X7HzH47܁a P7?4HzW   6?_`@  6H} 66Ha66w 6 Hb T Ha 3 u7Hg4G"B@uP5B0@H @tPHv@HzH47@eP477 +`H67 f  h} H|070}4П7?A5P6?4H| 7 6?__`  Hb W 6?6?"H|7?7W? 4Hs} =Hg 'u79? 47@eP4   yԠ `ePK>K?!K?K?K? @O?K_ J? K82K "@K7K(4@k?ok?k?7$KY ! 7C K=@xPK%(Hv@HzH7 @wP7:7@wP`wP (4$w@xPK:D_@xP J d dK3hs yK?YK?K?@O??K?Y@@K?Yk?ok?k?7$KY ! 7C K=@xPK%(Hv@HzH7 @wP7:7@wP`wP (4$w@xPK:D_@xP J d dK3hs yK?YK?K?@O??K?Y@@K?YK_ (4K K? @k?7+`#49@@7+`@H:K?Y@7?memory exhausted   X! X!L,X! ``84$X!<<DX X!<PcX!\|X!L$$h X!p44tX (>(@>(P@>(@$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$ $SHORTBSS$ $SHORTDATA$  ;^t:Lv7v6PPv0v7v6PPv0v71v2v6PPv00v1v2v10 v2v10 ^^7R1R#'00 @ T0h @G 0 U 0 U0 @0 A0 @?0 @$0 8 T(`lxobstack.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.obstack_alloc_failed_handlerprint_and_abortobstack_exit_failure_obstack_obstack_begin $$dyncall_obstack_begin_1_obstack_newchunk_obstack_allocated_p _obstack_freeabort obstack_free_obstack_memory_usedC$26__iobfputsexitpartition.o/ 996061301 0 3 100644 2784 ` 1 @Hp<t<G!k?o7]? S7C @6 `A4P4?77744  Y T  79_6` 9 C 9 A 4Z0 kY?766V6 U67"S 7 W A4A7 V447kU(XXXk] kX057Z`K?Y@O?k?7@@K?Y@7?7_ 9 Z  U ! @ 9 S  A JuJ"778 A7  W J T Z H8K] kXJ 9 U K?JK@K_K7@ @4? h4@k?/,opk>k>k>k>k>k>k>KC7D4z@k?!747@4x@ K?!7@4`D(4+`H9k?)+`4?k?48k?#@7W. 4 # A B K4 b4?P5?? Y %  9 Z HJ7>b6&a00N8D&iD_uia 6 9 U %  ( K7>'D80N0'& Z  J'D80N0'& s ] e  J'D80N0'&6  S  J'D80N0' ~- K?)44@59K?!@4P `X4 K? ?@K? K?!@5JI@K?!@4R4|=@K?!@4@4K>YK>K>K>K>K>K>K>O>@/0,?UUUUU\%d %dX! X!,X!8 X!L$$D) X!pP62X 4\h>(< @hi $TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$  ;^u9IB681+( 687YY[[[b4  8 1 #'0 0D0 Ph0 Qt A0 @ @  @ partition.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. partition_newxmallocpartition_deletefreepartition_union elem_comparepartition_printmemsetfputc L$plab_startqsortM$20fprintfS$19DD$partition_printpexecute.o/ 996061302 0 3 100644 2352 ` 1 0@4$$lL@G!5k?ok? k?k?k?!k?)k?1k?9K>k?AK>k?IK>ǿk?Q+`H%+aH%+`h +`@H&@7?q`"K?qK?y+`h?+`47P  `4 ?5\K>K?9K?1K?)K?!K?K?K? @O?+`h 444 ?@@` 7@5"_ H *_!+`48` _ ` *@4@4@4 0@@4@4@4+`H: @@@K?AK?I4 `7+`4$@K?Q4y@4+`H9K?A@4+`@H:4y4@7@4?@5\ @4=g5\@4E5\k?7@7:K?Y@7?%s: : %s installation problem, cannot exec `%s'pipeforkX! bX!,bX   8p>(<@@D>(@@P>(P@H`$TEXT$ $PRIVATE$$CODE$$CODE$$LIT$$DATA$ $SHORTDATA$ $SHORTBSS$  ;^v:1-TTTTQQQQ6QQWW QQ56 WW6 6 QQv7 ]]8PP`6`16 6##&##''% 0@@ @@H0 UP` l@8 @    0 Q,8pexecute.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. SD$pexecute SB$pexecutepexecuteexecvp L$plab_startexecvpipeM$20forksleepclosedup $$dyncall__iobC$21fprintferrno xstrerrorexitpwaitwaitsafe-ctype.o/ 996061303 0 3 100644 1820 ` 1L@4LtplpG!  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000X! >(@,$TEXT$ $PRIVATE$$CODE$$DATA$$;^w:<.04@0H@0\@safe-ctype.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. _sch_istable _sch_tolower _sch_touppersort.o/ 996061303 0 3 100644 1088 ` 1|@@,TT(|TG!sk?o k7 k7k7k7!k7)k71k79k7A7C 4V 7+ ] 75 7 7 6֓  k?q&047477a77i7?a44@4 4 c K  885C K768(85K9 78@6?R4?  Jz7T?Jt6?  Y44>7k?qK6K7AK79K71K7)K7!K7K7K7 @O7X!dd $TEXT$ $PRIVATE$$CODE$;^w9{Er !850 P,@Lsort.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. sort_pointersabortmemsetspaces.o/ 996061304 0 3 100644 1040 ` 1@\D`<#`<G!Ak?ok?+`H87C`4$H @@@4z h  *4@7?H?7?h @HH ? wK?YK?@O?ˀK?YX! #>(@,>(P@8$TEXT$ $PRIVATE$$CODE$$DATA$ $SHORTBSS$  ;^x7-P6PPP16PPPPP 0@0 @LXspaces.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. SB$spacesspacesfreemallocsplay-tree.o/ 996061305 0 3 100644 4000 ` 1 \@ h \   G!k?ok?7# 7DHy_4Hy_4H @Hz7H @Hz7@4zK?YK?@O?k?ok? k?k?K77Fk?!`!x6HHyK?!70Z`x4x :k?K?!4_-4H!7!@K>H Jx KK:W Js @KK=!x!HtH aHbKK wHx "Hy H eH} H b J6KHx w@J<KHz w4|K>K?K?K? @O?HuH |HaKaK fuk?7K_7X k?4@7K?Y@7?k?ok?k?k?7&H4z4_4 4447 P@H444z7&7C7 ?U64K?YK?K?K?@O?k?ok?k?7C7$7@4 7K?YK?K?@O?k?oKY@7C@4zK?Y@O?k?ok?k?k?7C7%@7H 04HvK477H @4 H (`K |K?YK?K?K?@O?Hv K7HH|K]k?ok?7C@k?H!HvKK?7 @HKk?Hv KK7@Hz Z dK? RH 7K?7K? K? zK?YK?@O?k?o7C@k?H *HvKK?7 4K?Y@O?H|k?oKX7C k?4K?Y@O?@4zHwJK?Hv77_H|K?}@K?oK?Y7K?7=K?Yk?oKX7C k?4K?Y@O?@4zHwJK?Hv77H|K?}@K?oK?Y7K?7=K?Yk?77?KY7@7K?Y@7?:@ @4? :h4@: @4? :4@X!xx X!x,X!0$08(X!TD6X!dLLPEX!(0(\SX!XhdX!8tX!lLLX!8X!<X!(@(X!h X! $TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$;^x9v1v1 v7P 9v76 212v76v1 2v7 v112v7 2v7 2v79 @4 T d Up{ @' UW0 Q0 30 Q[0 @;0 A,0 AD ;0 A` 0 Q| C0 A k0 A splay-tree.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.splay_tree_delete_helper $$dyncallfreesplay_tree_splay_helpersplay_tree_splaysplay_tree_foreach_helpersplay_tree_newxmallocsplay_tree_deletesplay_tree_insertsplay_tree_removesplay_tree_lookupsplay_tree_predecessorsplay_tree_successorsplay_tree_foreachsplay_tree_compare_intssplay_tree_compare_pointersstrerror.o/ 996061305 0 3 100644 4492 ` 1 l@ , t lt  G!k?7+`H< x@+`4?K P@+`H7 H7W ?7+`h7+`H5 @+`H6 @k?+`h< 7K?@4+`4?K @@+`H= w?7K?Y@7?k?7+`H8 P@+`H?+`H7 X7K?Y6?@7?@@+`k?o+`H8 7_`@+`H9`@+`H7   8@+`4#"6 7@4zK?Y4|@O?@k?K?5@`K?Yk?ok?k?k?7D@ 4+`H9 4%+`H8`P4&H  @4 H4c_@H C844|K?YK?K?K?@O?@@-+`EPERMENOENTESRCHEINTREIOENXIOE2BIGENOEXECEBADFECHILDEWOULDBLOCKEAGAINENOMEMEACCESEFAULTENOTBLKEBUSYEEXISTEXDEVENODEVENOTDIREISDIREINVALENFILEEMFILEENOTTYETXTBSYEFBIGENOSPCESPIPEEROFSEMLINKEPIPEEDOMERANGEENOMSGEIDRMECHRNGEL2NSYNCEL3HLTEL3RSTELNRNGEUNATCHENOCSIEL2HLTEDEADLKENOLCKENOSTRENODATAETIMEENOSRENONETENOPKGEREMOTEENOLINKEADVESRMNTECOMMEPROTOEMULTIHOPEDOTDOTEBADMSGENAMETOOLONGEOVERFLOWEILSEQENOSYSELOOPENOTEMPTYEUSERSENOTSOCKEDESTADDRREQEMSGSIZEEPROTOTYPEENOPROTOOPTEPROTONOSUPPORTESOCKTNOSUPPORTEOPNOTSUPPEPFNOSUPPORTEAFNOSUPPORTEADDRINUSEEADDRNOTAVAILENETDOWNENETUNREACHENETRESETECONNABORTEDECONNRESETENOBUFSEISCONNENOTCONNESHUTDOWNETOOMANYREFSETIMEDOUTECONNREFUSEDEHOSTDOWNEHOSTUNREACHEALREADYEINPROGRESSESTALEError %d (08 @ HP ` h px !"# $(%0&8'H(P)X*`+h,p-x.634527G9:;<=@BCH/(08@DPXhx(8HXhpxFX! -X!TPP,-X!$8G"X!4Di!X ;XP>(@\>( (@h>(R@ x>(P@@$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$ $SHORTDATA$$BSS$ $SHORTBSS$  ;^y92RRPPRRRRSSRR6SS8PPSSSSRRXX0RSSRRSSQQ8 0SSRRS7 RR0R##" #" # ##### #### #### ### # #"* #  ##" # # ## # ##"##%  0@ @@  P@ `@@ p0 0 ' X0 strerror.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. DS$strerror BS$strerror SD$strerror SB$strerrorinit_error_tablesmallocmemset errno_maxsys_nerrstrerrnoC$17sprintf strtoerrnostrcmpstrsignal.o/ 996061306 0 3 100644 4644 ` 1 $@ ` ` `  ,m4 ,G!k?o+`H= @+`47J@ X@+`H?6  H7@?6+`h?+`H8 4#+`H7 @k?h| x7K?@4+`47J :6 Hy 8 ?6Hy @+`H? @k?h| 7K?@4+`4?K+`H! Hha7Hv @?7K?Y@O?k?7+`H8 @@+`H?+`H7 X7K?Y6?@7?k?ok?+`H7 7C@@``@+`H8@@+`H?   8@+`4$#74x@44K?YK?@O?Ȁ4k?ok?+`H7 7C@@``@+`H8@@+`H?   8@+`4$@#74x@44K?YK?@O?Ȁ4k?ok?k?k?7D@ 4+`H9 4%@@+`H8`P4&H  @4 H4c_@H C844|K?YK?K?K?@O?k?o+`H7k? 7C@@` @+`H8`@+`H9+`# #K?4:@@7K?Y@O?+`#K?4:@@7K?YSIGHUPHangupSIGINTInterruptSIGQUITQuitSIGILLIllegal instructionSIGTRAPTrace/breakpoint trapSIGIOTIOT trapSIGABRTAbortedSIGEMTEmulation trapSIGFPEArithmetic exceptionSIGKILLKilledSIGBUSBus errorSIGSEGVSegmentation faultSIGSYSBad system callSIGPIPEBroken pipeSIGALRMAlarm clockSIGTERMTerminatedSIGUSR1User defined signal 1SIGUSR2User defined signal 2SIGCLDChild status changedSIGCHLDSIGPWRPower fail/restartSIGWINCHWindow size changedSIGURGUrgent I/O conditionSIGIOI/O possibleSIGPOLLPollable event occurredSIGSTOPStopped (signal)SIGTSTPStopped (user)SIGCONTContinuedSIGTTINStopped (tty input)SIGTTOUStopped (tty output)SIGVTALRMVirtual timer expiredSIGPROFProfiling timer expiredSIGXCPUCPU time limit exceededSIGXFSZFile size limit exceededSIGLOSTResource lostSignal %d%s: unknown signal %s: %s (08@X`x   ( 8@PXhp08PXhp(@H!`h"X!HH ?X!DHD,?X! 8V#X!Dy#X!$PX!<\*X Hbh>(@tk>( \@l>(R@@>(P@ $TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$ $SHORTDATA$$BSS$ $SHORTBSS$  ;^z92RRPPRRRRSSRR6S8PPSSRRSPPRRSSSS0RRSSSS0SSSSQQ8 SS0RRSSQQ8 SS0RRS7 RRSS0SSSS__9__8# # ##"#### ###"######"### 8###"# ##`# #"%  0@ D @ X@ l @ 0 K0  0 0 0 @? ,strsignal.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. DS$strsignal BS$strsignal SD$strsignal SB$strsignalinit_signal_tablesmallocmemset signo_max strsignalC$17sprintfstrsigno strtosignostrcmppsignal__iobfprintfxatexit.o/ 996061307 0 3 100644 1436 ` 1@\L9G!ek?o+`H6+`0H4+`0h4+`H<7CK4@z@:@4 z+`H=h<K6k7  4K?Y7@O?K?Yk?ok?k?+`H#` bHx7?@2d 7 7_4?Hc`?@K?YK?K?@O?X! "X!dd,">(x@85>(|@D7>(R@T$TEXT$ $PRIVATE$$CODE$$CODE$$DATA$ $SHORTDATA$$BSS$  ;^{7-P6SSUUSSQQ6QQQ QQv0 '% 0@ @@0 P\ p @ xatexit.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. BS$xatexit SD$xatexitxatexit_xexit_cleanupxatexit_cleanup L$plab_startmalloc $$dyncallxexit.o/ 996061307 0 3 100644 936 ` 1@ttDDdG!k?7+`H6 k?7@K?K?Y@7?X!44 >(@,>(P@8$TEXT$ $PRIVATE$$CODE$$DATA$ $SHORTBSS$;^{9PPv01G,0 @ L\xexit.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01._xexit_cleanupxexit $$dyncallexitxmalloc.o/ 996061308 0 3 100644 2240 ` 1@00pG!k?7+`H? h:@4+`h<K?Y@7?k?o+`H3 07C@4+`H:( \@4+`4= k?+`H8+`k?C4:@+` 47# 2@47@79@4K>@O?k?ok?7C@04@4z 7@4z4K?YK?@O?k?ok? k?7#7D@ ` 444@4y H77?A''8G'F@4K>K?K? @O?k?ok?7# 04 @4zȜ@@4y7 @@4z4K?YK?@O? %s%sCannot allocate %lu bytes after allocating %lu bytes : X!44 X!4,+X!HDD8AX!x xDRX!\\PcX `<D\w>(@ h>(@t$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$DATA$ $SHORTDATA$  ;^{:%VQPPP6PPPP6PPTTPPUUWWW91 6 1 7 16 71#:###% 0@0 @`0 l7  @0 0 A0 Axmalloc.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. SD$xmallocxmalloc_set_program_namesbrkxmalloc_failedenviron__iobC$11M$10fprintfxexitxmallocmallocxcalloccallocxreallocreallocxmemdup.o/ 996061308 0 3 100644 796 ` 1X@00(X|P|G!*k?7k?4k?@7k?K?7@K?K?YK?@7?X!@@ $TEXT$ $PRIVATE$$CODE$  ;^|92780 Q0<Hxmemdup.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.xmemdupxcallocmemcpyxstrdup.o/ 996061308 0 3 100644 828 ` 1X<@00(X|\|G!(k?7@k?7@k?k?K?7@K?K?YK?@7?X!@@ $TEXT$ $PRIVATE$$CODE$  ;^|8X6680 0<HTxstrdup.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.xstrdupstrlenxmallocmemcpyxstrerror.o/ 996061309 0 3 100644 1072 ` 10@$LT4x4G!k?o@k? 87+`4#K?#7@4zK?Y4|@O?undocumented error #%dX!DD X H,>(@8>(R@,D$TEXT$ $PRIVATE$$CODE$$LIT$$DATA$$BSS$  ;^}7-P66PP8# 0@0 DT dHpxstrerror.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. BS$xstrerror xstrerrorstrerrorC$12sprintfasprintf.o/ 996061309 0 3 100644 756 ` 1L@$$(LpLpG!4k?77]k?)7?7?1k?!k?9@k?1K?Y@7?X!44 $TEXT$ $PRIVATE$$CODE$  ;^}7-P580 U0@asprintf.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.asprintf vasprintfmkstemps.o/ 996061310 0 3 100644 1932 ` 1@hPPP :G!k?/,/-o`k>k>k>k>7C@7$4 db7?  44 @4$4@7?aK?iK?a @ +`H'  G h<#7/ ' @"~4%4F6g64$@K0@ H0@1` 9`@01,N 7>1 N4 9AD'D400@8@00@0 2N 8G'W0@1lN9!F'F0@018@0 2N0@1LN 8G'X:F'F0@0 1a8@01LN0@8G'X1 N :F'F0@0 1!8@01lN   1 N ]  :F8G'F0@0 'X1A3  1,N4z9E8G'D   8G'E t    @  `2H7<¤\h `4?K>YK>K>K>K>O>/0-@/0,abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789?!B>XXXXXXX! 2X WX,2>(h@8>(P@D$TEXT$ $PRIVATE$$CODE$$LIT$$DATA$ $SHORTBSS$  ;^}9{E6Ȅ875PPPPP`8PP V# 0@0 A@ Pd p| mkstemps.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. SB$mkstempsmkstemps C$16$mkstempsstrlenC$19strncmp gettimeofdaygetpidopenS$15DD$mkstempssetenv.o/ 996061311 0 3 100644 1908 ` 1\t@$l  P\ _G!k?ok? k?k?k?!k?)74k?14@k?9K?9@7+`H? x7K `74zK?1@4 H  4H@?4+`H? @H!@+`H: _804@ ܀4@ 7""4@  <"+`H9+`H8 @ @4 K?1@4 d 4zT K?9 @4x4 +`h&+`h& @47 ] @@@ HK?1@4H$ 4zHK?9 @4x4K>K?)K?!K?K?K? @O?ϟK>@4+`4ϟh(ϟ}K>k?ok? k?@k?!+`H$H@ 74zK?!@4x @@H  "4?74H@?}@K>K?K? @O?X! JX!,J>($@8>(P@D$TEXT$ $PRIVATE$$CODE$$CODE$$DATA$ $SHORTBSS$  ;^~9 6SS8SSPP76SSPP8 SSPP6 1XX6SS8 0@0 Q@LXdp|0 setenv.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. SB$setenvsetenvstrlenenvironstrncmpreallocmallocfreeerrnomemcpyunsetenvvasprintf.o/ 996061311 0 3 100644 2348 ` 14 ,@4|@4X$XG!k?ok? k?k?k?!k?)k?1k?9k?Ak?I7D7#k?7@7:7?74@4K?C! 4&4J!4 T4 \7k?C!*B5 ҙ@5 BK?6k?5B@y?@K?CL,!H@K?7?k?7Yk?@KK?C K?7?֠k?K?4Vk?K?C>7@5z "74K>K?IK?AK?9K?1K?)K?!K?K?K? @O?7?@4K?C J 7k?CA) JK?7? k?7Sk?@K:|(K?7?@4 K?C5 y@5 BK?6k?5C@ӹ?@K?Aӵ6?w4? 5kk?77?k?9k?)7?)@k?1K?Y@7?-+ #0hlLX! ;X P,;CX!$,,8~$TEXT$ $PRIVATE$$CODE$$LIT$$CODE$  ;^9 68Ȍ7  6 6 8 68%%%%% #8 Q0 D TD dX tp   0 Qvasprintf.c /opt/bintmp/binutils-2.11.2/libiberty ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. int_vasprintf $00000010 $00000011 $00000012 $00000013 $00000014strlenmemcpyC$17strchrabsstrtoul$L0mallocvsprintf vasprintfbinutils/binutils-RUN/opt/binutils/lib/libopcodes.a010064400000000000003000001603540732753177200212530ustar000300000000000000! / 996061609 0 0 0 5028 ` @LOLRh@$P 0 Aess0 P$kess0 @@#ess0 P\ ery0 Upury0 7ige0  ier0 A"rpageneric_symbol_at_addressgeneric_strcat_addressgeneric_print_address perror_memorybuffer_read_memorydisassembler_usage disassemblerprint_insn_hppadis-buf.o/ 996061574 0 3 100644 2128 ` 1dP@dd0 G!k?7J7T73766&J76J 7?Y'A8G'IFPI 5 :J @6zK?Y4@7?K?Y4 @7?k?ok?K7D7k?#7 Xk?7@4 HzK?747PK?Y7@@4 HzK?7K?7K?YK?@O?k?o7##7X7@7?a"HvHz67?a7K>@O?k?ok? 7 @7##7X7@7?a@4zk?@7?aK? "4z@7?a8K>@4z 4z@7?aK>K? @O?@4opcodesUnknown error %d Address 0x%x is out of bounds. %08lx0x%sX! X!,X!H H82X!hDLX!xPk X EP\v$TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$;^;0 8Ȅ8v8vȄ8v8Ȅ86 7 8 #%##0 U,D P0 P\ p| 0 @#0 Pk0 Adis-buf.c /opt/bintmp/binutils-2.11.2/opcodes ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01.buffer_read_memorymemcpy$$divU perror_memoryC$29 dcgettext $$dyncallgeneric_print_addresssprintfgeneric_strcat_addressstrlenstrcatstrncatgeneric_symbol_at_addressdisassemble.o/ 996061577 0 3 100644 1020 ` 1@||@dG!(k?7@@4* +`H<@4K?Y@7?@X!44 X!4, >(@8$TEXT$ $PRIVATE$$CODE$$CODE$$DATA$$;^;6SS'0 4H\ p@0 7./disassemble.c /opt/bintmp/binutils-2.11.2/opcodes ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. disassembler bfd_get_archprint_insn_hppa L$plab_startdisassembler_usagehppa-dis.o/ 996061607 0 3 100644 49156 ` 1@{{P%qDG!×=}@!6?  @ =}@YW@ 7w@7?@ k?o79?y@WW@!K?Y \@O?4 ] k: @ 7\44 U S ?]֚v@ \ע ]3M@ 7\ע ]z1  X@ \?{ W A4 V W4 \v@ \ւ׿5 T ]4 WtҸ W4y X w]ה Yz @ y\ւ׿ T ]{ WU W4y X w]Ҝ Yzv@ y\k?o4?"`6} : K?Y`K?Ycc4wa4 784y#pk7< ׀ HC44 4u B @@K?Y4|@O?=7?4?#7 `@4@4KYK6 2 4@KWJ 24?@KXK 24@ @4,@4"@4*@4@k?o7 4?#7 7C7:@4` C4@a C ^4Y@@ # C#7 @@ P C@`0 C"6@@ c C#7 @@  C@` C#'76@ p C@` P C#7@  CzK?Y@@K?Y4|@O?k?77_K6 K:+`47  +` 4947K?Y@7?k?77_K6 K:+`47 +` 494 7K?Y@7?k?7K67_H@K: ]# 7797`K?Y# 7+`47 +` 48407K?Y@7?k?7+`K6K?47 77K?Y@7?k?77XK6`8K:"607K?Y@7?#7 7K?YW_BX>@ \k?7Z@4 K?Y@7?k?7Z@4 K?Y@7?@\@\@\@\[k?7Z@4K?Y@7?k?7Z@4K?Y@7?k?7_VW? Z zY׸  Uה Z@4 K?Y@7?k?7 ] VBS> x\<T k AABZZ@4*K?Yל k@7?k?7] JW Yz  yZ@4K?YלB@7?k?7U JYW _׷ k T  Z@4"K?YלB@7?k?7Aס JSX _֘ kY[ֹ  W \Z \Z@4,K?YלB@7?k?ok< k<k<k47 7Hh5474?K;K+`!"74%5?!Q47 424 7 HH  H  Z790?@!@HH5YP4x7ψK; 4@kr" k=Q6:jk=a_Zkk=q5pk<ְ!k>5!k=5t_k> 4 vk>! 6 k>sSk>Q_}k>՝5k>Yov֊kAa[nk>9Bk>1z4k=K<}\tk=u4k=Ys?yk=|4k=i4`ak=q4lk=ywm?k=B4@k<^nkk=4k<4 k=4k> 4@k=4@k<4@k=4@k=4k>I4k<4k>y4@k=9Ki4k= Vk>)4k=k>k=!kak>q7?K=IE4? `K=Q@4 44K=Y@4 4K=Y@4 45@4 44@SK=a6y? 4? 5@4 L4 5@4 4@44 K=Y@44@44HH54@K<7K=i K=Y@4D4@4$4 K=Q@44@44 K=Q@44@44K=K=qK=y SZ@4<4@44K=YK= }Z@44K=QK= Z@44K= Z@4|4K=K= Z@4D4K=K= Z@4 4HH54PK<7K= K=Q@44@44K=Q@4\4@4z7@4$4HH4x>74H@4zH476V744@ӴK=6?@_4? K:HH54`K<7x4K=JK>@HH54pK<74HH54K<744, 4< zK>H0HK<547h4K<54784HH54K<744& 46 zK=H" 0HK<5474K<547X44. 4>O zK> Hb 0HK<5474K<5474HH55K<7x44@K>6?4? ] KH U K!H\ KH2 KH K)HHK< 7@4܂0HH4p74@4z7@4P4@4z7@44@4z7@44@4z7@44@4z7@4p4@4z7@484@4z7@44@4z7@44@4z7@44H(H47P44p7(4C@ 2HH47 4C2HH47 4@-zHH4p7 P4Hp@4zK>1 6V47 4Hp@4zK>1 6V47 4@4z7@4 h4HH47 04HH47 4HH47 4HH4K=7 4HH4x<7 @4HH4 7 4K>9H4>H7 4K>9K>A =A8~HH47 h4HH4K>97 (4K>9K>A X4HH7 4HH4@7 4K>H 4H7 P4K>H 4H7 4z@44zS@44z@44HH40x=7P4K>I LZ@4 4K<@44K>Q Z@44K>Y Z@44K>a Z@4h4HH40x=7(4@4 4~? BK>iHHK< 74K>iH4H 7p4K=H4H 7(4K=H4" (HH@74HH74@4~HT 0H K<7X4 47(4@4z7@44K>  K>q@K<_c@44K>  K>y@K<_B@4P4@4z׀7@44@4z׀7@44HH55K<74"#zK>4:?@4X4 cBHH4058?74 :HH55@K<74 :HH55PK<74 :HH55`K<784 :HH55pK<74 :HH55K<74 :HH55K<7`4 :HH55K<744", HH55K<74Hp@4zK>1 6V47p4HH55K<704HH4@74@X5c7?ψ!K;,CcY<>?!@+&U~FfGHINnOoZMadu|/=0123%e$m}ldicallretcmpibcomibcmpbcombaddbaddibnopcopymtsarlddldwldhldbstdstwsthstbldwmstwmldwxldhxldbxldwaldcwstwastbylddaldcdstdaldwaxldcwxldwsldhsldbsldwasldcwsstwssthsstbsstwasstdbystbysldoldiladdilbblgateblrbvbvebeblemovbmovibcombtcombfcomibtcomibfaddbtaddbfaddibtaddibfbbbvbclrbtspopbtspushnompushbtscmpclrcomclrorxorandandcmuxoruaddcmuaddcmtdcoridcoraddiaddioadditadditoaddaddladdoaddcaddcosubsubosubbsubbosubtsubtodssubisubiocmpiclrcomiclrshladdsh1addsh1addlsh1addosh2addsh2addlsh2addosh3addsh3addlsh3addohaddhavghshlhshladdhshrhshraddhsubmixhmixwpermhshrpdshrpwvshdshdextrdextrwvextruvextrsextruextrsdepddepdidepwdepwizvdepvdepzdepdepzvdepivdepizdepidepibreakrfirfirssmrsmmtsmldsidmtspmtctlmtsarcmmfiamfspmfctlsyncsyncdmaprobeprobeiproberproberiprobewprobewilpalhalcipdtlbpitlbpdtlbepitlbeidtlbaiitlbaidtlbpiitlbppdcfdcficfdceficediagidtlbtiitlbtmtcpumfcputocentocdisshdwgrgrshdwgfwgfrfldwflddfstwfstdfldwxflddxfstwxfstdxfstqxfldwsflddsfstwsfstdsfstqsfaddfsubfmpyfdivfsqrtfabsfremfrndfcpyfcnvfffcnvxffcnvfxfcnvfxtfmpyfaddfmpynfaddfnegfnegabsfcnvfcmpxmpyufmpyaddfmpysubftestfidpmdispmenbspop0spop1spop2spop3coprcldwxclddxcstwxcstdxcldwsclddscstwscstdscldwclddcstwcstdflagsr1rpr3r4r5r6r7r8r9r10r11r12r13r14r15r16r17r18r19r20r21r22r23r24r25r26dpret0ret1spr31fpsrfpe2fpe4fpe6fr4fr5fr6fr7fr8fr9fr10fr11fr12fr13fr14fr15fr16fr17fr18fr19fr20fr21fr22fr23fr24fr25fr26fr27fr28fr29fr30fr31rctrcr1cr2cr3cr4cr5cr6cr7pidr1pidr2ccrsarpidr3pidr4ivaeiemitmrpcsqpcoqiirisrioripsweirrtr0tr1tr2tr3tr4tr5tr6tr7,=,<,<=,<<,<<=,sv,od,tr,<>,>=,>,>>=,>>,nsv,ev,*=,*<,*<=,*<<,*<<=,*sv,*od,*tr,*<>,*>=,*>,*>>=,*>>,*nsv,*ev,nuv,znv,uv,vnz,*nuv,*znv,*uv,*vnz,swz,sbz,shz,sdc,swc,sbc,shc,nwz,nbz,nhz,ndc,nwc,nbc,nhc,*swz,*sbz,*shz,*sdc,*swc,*sbc,*shc,*nwz,*nbz,*nhz,*ndc,*nwc,*nbc,*nhc,m,s,sm,ma,mb,b,m,e,e,m,sgl,dbl,quad,false?,false,?,!<=>,=t,?=,!<>,!?>=,?<,!>=,!?>,?<=,!>,!?<=,?>,!<=,!?<,?>=,!<,!?=,!=,!=t,!?,<=>,true?,true,u,l,r,us,ss,w,tsvfpe%d%sR-%x%x%scfCY?-+nHNZFIuv sr%d%s ,bc ,sl ,co ,o,gate,l,push,pop,m ,i,z,dc%s,c%s,tc,db,b,%d%d%d%d ,n ,n%%r1%%sr0,%%r310%d%%sar,%d%c#%8xl,xj,xn(b)nWn?Qn5,b,w?nn5,b,w?nn5,b,w?nn5,b,w?Nnx,b,w?nnx,b,w?nnx,b,w?nnx,b,w?Wnx,b,w?@nx,b,w?@nx,b,w?Wn5,b,w?@n5,b,w?@n5,b,wx,txcocc@(s,b),tcocc@(b),tcxccx(s,b),tcxccx(b),tcmcc5(s,b),tcmcc5(b),tcq&(b),xcq#(b),xcxccx(s,b),tcxccx(b),tcocc@(s,b),tcocc@(b),tcmcc5(s,b),tcmcc5(b),tce<(b),xceJ(s,b),xceJ(b),xce>(b),xceK(s,b),xceK(b),xl(b),xj(s,b),xj(b),xcxccx(s,b),tcxccx(b),tcocc@(s,b),tcocc@(b),tcmcc5(s,b),tcmcc5(b),tl(b),xj(s,b),xj(b),xcxccx(s,b),tcxccx(b),tcocc@(s,b),tcocc@(b),tcmcc5(s,b),tcmcc5(b),tl(b),xj(s,b),xj(b),xcocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)cqx,&(b)cqx,#(b)cocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)cex,<(b)cex,J(s,b)cex,J(b)cex,>(b)cex,K(s,b)cex,K(b)x,l(b)x,j(s,b)x,j(b)cocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)x,l(b)x,j(s,b)x,j(b)cocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)x,l(b)x,j(s,b)x,j(b)j(s,b),xj(b),xx,j(s,b)x,j(b)cxx(s,b),tcxx(b),tcxx(s,b),tcxx(b),tcxx(s,b),tcxx(b),tcxccx(b),tcmcc5(b),tcxcdx(s,b),tcxcdx(b),tcmcd5(s,b),tcmcd5(b),tcocCx,@(b)cmcCx,V(b)cscCx,V(s,b)cscCx,V(b)cxccx(b),tcmcc5(b),tcxcdx(s,b),tcxcdx(b),tcmcd5(s,b),tcmcd5(b),tcocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)cxx(b),tcxx(s,b),tcxx(b),tcm5(s,b),tcm5(b),tcm5(s,b),tcm5(b),tcm5(s,b),tcm5(b),tcm5(b),tcm5(s,b),tcm5(b),tcmx,V(s,b)cmx,V(b)cmx,V(s,b)cmx,V(b)cmx,V(s,b)cmx,V(b)cmx,V(b)cscCx,V(s,b)cscCx,V(b)csx,V(s,b)csx,V(b)l(b),xj(b),xk,bk,b,Zk,bcpnXLclnXLclnW,bcgnW,bnWnW,bnW,bnx,bnx(b)n(b)cpn(b)Lcln(b)LcPn(b)n(b)clnz(S,b),Yclnz(b),Ynz(S,b)nz(b)nz(S,b)?ynx,b,w?yn5,b,w?tnx,b,w?tnx,b,w?tn5,b,w?tn5,b,w?dnx,b,w?dnx,b,w?dn5,b,w?dn5,b,w?Bnx,!,w?Bnx,B,w?bnx,!,w?bnx,Q,w?bnx,w$x?Sx,b,t?sx,b,t?sx,b,t?Lx,b,t?lx,b,t?Lx,b,t?lx,b,t?Lx,b,t?lx,b,t?Lx,b,t?lx,b,t?Ux,b,t?ux,b,tcT?Ux,b,tcT?ux,b,t?ux,b,t?ux,b,tci?Ub,tci?ub,t?ub,t?ub,tct?ai,b,xcv?ai,b,x?ai,b,x?ai,b,x?ai,b,x?ai,b,xcY?Ax,b,tcy?ax,b,tca?Ax,b,tca?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,tct?Sx,b,tct?sx,b,tcB?Sx,b,tcb?sx,b,tcv?Sx,b,tcv?sx,b,t?sx,b,t?sx,b,t?sx,b,t?sx,b,t?sx,b,t?sx,b,t?sx,b,tcv?si,b,x?si,b,x?si,b,x?Si,b,x?si,b,x?si,b,xca?Ax,.,b,tca?ax,.,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,tcHx,b,tx,b,tx,*,tx,.,b,tcSb,*,tx,.,b,tcHx,b,tchx,b,tchx,b,tc*a,t?Xx,b,!,t?Xx,b,~,t?xx,b,!,t?xx,b,p,t?xx,b,t?xx,b,p,tcS?Xb,!,%,xcS?Xb,q,|,xcS?xb,!,T,xcS?xb,P,T,x?xb,T,x?xb,T,x?xb,P,T,x?xb,P,T,xcz?Xx,!,%,bcz?Xx,~,|,bcz?X5,!,%,bcz?X5,~,|,bcz?xx,!,T,bcz?xx,p,T,bcz?x5,!,T,bcz?x5,p,T,b?xx,T,b?xx,T,b?xx,p,T,b?xx,p,T,b?x5,T,b?x5,T,b?x5,p,T,b?x5,p,T,br,AcrU,tR,tU,tR,tx(s,b),t(b),tx,Sx,^xtS,tcW!,t^,tcw(s,b),x,tcw(b),x,tcw(s,b),R,tcw(b),R,t(s,b),x,t(b),x,t(s,b),R,t(b),R,t(s,b),x,t(b),x,t(s,b),R,t(b),R,tcZx(s,b),tcZx(b),tcZx(s,b),tcZx(b),tx(s,b),tx(b),tcLcZx(s,b)cLcZx(b)cZx(s,b)cZx(b)cLcZx(S,b)cLcZx(b)cZx(S,b)cZx(b)cZx(s,b)cZx(b)cZx(S,b)cZx(b)x,(s,b)x,(b)x,(S,b)x,(b)x,(s,b)x,(b)x,(S,b)x,(b)cZx(s,b)cZx(b)cZx(s,b)cZx(b)cZx(S,b)cZx(b)cZx(s,b)cZx(b)cZx(S,b)cZx(b)Dx,bx,bx,^^,xcZx(s,b)cZx(b)cZx(s,b)cZx(b)cocc@(s,b),fTcocc@(b),fTcxccx(s,b),fTcxccx(b),fTcmcc5(s,b),fTcmcc5(b),fTy(b),fecJy(b),fed(b),fecJd(b),fecocc@(s,b),ftcocc@(b),ftcxccx(s,b),ftcxccx(b),ftcmcc5(s,b),ftcmcc5(b),ftcq&(b),fxcq#(b),fxcocCfT,@(s,b)cocCfT,@(b)cxcCfT,x(s,b)cxcCfT,x(b)cmcCfT,5(s,b)cmcCfT,5(b)fE,y(b)cJfe,y(b)fe,d(b)cJfe,d(b)cocCft,@(s,b)cocCft,@(b)cxcCft,x(s,b)cxcCft,x(b)cmcCft,5(s,b)cmcCft,5(b)cqfx,&(b)cqfx,#(b)cxx(s,b),fTcxx(b),fTcxx(s,b),ftcxx(b),ftcxfT,x(s,b)cxfT,x(b)cxft,x(s,b)cxft,x(b)cxft,x(s,b)cxft,x(b)cm5(s,b),fTcm5(b),fTcm5(s,b),ftcm5(b),ftcmfT,5(s,b)cmfT,5(b)cmft,5(s,b)cmft,5(b)cmft,5(s,b)cmft,5(b)Ffa,fb,fTIfA,fB,fTFfa,fb,fTIfA,fB,fTFfa,fb,fTIfA,fB,fTFfa,fb,fTIfA,fB,fTFfa,fTFfA,fTFfa,fTFfA,fTFfa,fb,fTFfA,fB,fTFfa,fTFfA,fTFfa,fTFfA,fTFGfa,fTFGfA,fTFGfa,fTFGfA,fTFGfa,fTFGfA,fTFGfa,fTFGfA,fTIfA,fB,fC,fTIfA,fB,fC,fTFfa,fTIfA,fTFfa,fTIfA,fT{_fa,fTFGfA,fTF?ffa,fb,hI?ffA,fB,hF?ffa,fbI?ffA,fBfX,fB,fTHfi,fj,fk,fl,fmHfi,fj,fk,fl,fm,=mNv,ONv,oNtv,1Nbv,0Nx,bu,2Nucxx(s,b),tucxx(b),tucxx(s,b),tucxx(b),tucxt,x(s,b)ucxt,x(b)ucxt,x(s,b)ucxt,x(b)ucm5(s,b),tucm5(b),tucm5(s,b),tucm5(b),tucmt,5(s,b)ucmt,5(b)ucmt,5(s,b)ucmt,5(b)ucxx(s,b),tucxx(b),tucm5(s,b),tucm5(b),tucxx(s,b),tucxx(b),tucm5(s,b),tucm5(b),tucxt,x(s,b)ucxt,x(b)ucmt,5(s,b)ucmt,5(b)ucxt,x(s,b)ucxt,x(b)ucmt,5(s,b)ucmt,5(b)r0fr0fr0 ,ma ,mb ,ma ,mb ,mb ,ma ,ma ,mb Disassembler botch. acc rej acc8 rej8 acc6 acc4 acc2 ,%r2 Px`h  x   ` X P (08@ ` h  p  H P X  8  @  ( 0     @ H P X      @ H P X ` h p H x     @ H P X `    H P X `   ( 0 8     8 @ H P X `   x     ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (4(4 00 8@ @(@8 HH HX PhPx X X `` ` hh h p@ x@ `@ 3  30 @ P ` pPP     3 3    LL L \0\@\PH`Hh Hx @  @  `3 `3 @  @ DD D      3   30 @  P @`@h @x 3 3  pp      l l0 l@ |P|`|phh h `3 `3 @  @ dd d  3  3   0 `@`H `X L` Lp lx l   @ @           0  @  P `  p      @ @ @ @ 3 3   ( 0 0 @ 0 P 8 ` 8 p @ @ @ @ H  H  P  X  X  `  `  h @ h @ p 0 p @ x P  @` @p    44   ( (        @        ( 0 8  H  X  `  h  p        ( 0 8`` 8@@ 8@` 0 8@@ @ @@@ P H@ XP@ `X@ h`@ ph xh p x` x@                             (  0  @  P ȴ X а ` ذ h   p                   (  8   @  H    P ( X 0  ` 8@ h @ p @ H P P X `  ` h@ p @ x@              ( 0 8 @ H P X ` p       ( ( 0 8 @ H P(P8XHXX`h `x h h p x                `( `0 `8`@ `H ?P ?X  ` @h `px `H    (? (? 01? 01? 8? 8? @1? @1? H? H?( P1?0 P1?@ X@?H X@?X `?h `?x h? h? p?p?p? p? xxx x @? @? @( @8 @?@ @?H @P @X ?` ?h p x ? ? ? ?   ? ?      @6 @ ( @&0 @ 8  ?@  ?P (?X (?h 0$ 3p0$ 30$ 0$ 0$ 0$ 0\0X0\0X8, 38, 38, 8,0 8,@ 8,P 8P`8Pp@$ 3 @$ 3 @$ @$ @$ @$ @|@x@|@xH, 3 H, 3 H,0 H,@ H,P H,` HppHpP$ P$ X, X, `$ `$ h, h, p< p< x$0 x$@ ,P ,` $p $ , , < < 0 8  0& 8&  0F 8F  0f0 8f @ 0P 8 X 0`` 8` h 0p 8  0 8  0@ 8@  0 8  0 8  0 8  0 8    (0(8 00 08 (80 088 8@0@@8 P@0` @8 p H8G  P X `0$ `0 `0$  h0 p0x0    0 $ $ ,( ,8 $H $X ,h ,x $ $ , , $ $ , , $ $ $( $8 ,H ,X ,h ,x$ $ $ $ , , , , XpPXH ( ##X!$$ X!$, X!@8 X!4X4D!X! P/ X!$((\: X!LhE X!d$$tP X!88[ X!H@Hf X!HHq X!P|X "~!X! = X!D,D ]0X!DpD X!4DD X!xpp X!4h4 X!PP X!l  X!   X!  ( !X!@4 / X!H@ : X!PL E X!XX P X! ` d [X!  p iX! LL| wX!lTT X!8@8 X!DxD X!<PP X!x x  >(2H`@P >(z$@P$g $TEXT$ $PRIVATE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$LIT$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$CODE$$DATA$ $SHORTDATA$  ;^;7  ș#0%%%%%%%%%%%%%%$%%!% %%%#%"%'%.%+%-%*%(%)%,%/%0%1%2%3%L%j%%r%p%%L%i%h%z%y%x%R%_%%%V%g%s%[%L%t%|%}%~%%%%%L%a%v%m%[%Y%T%o%Z%W%c%%f%e%L%O%%N%U%%Q%%\%]%^%_%%`%w%k%n%X%S%P%{%u%b%M%%d%%q%L%l%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% "###"##"##"#####"#####"##"### ##"##"####### #"###"###"## # #"##"###"#### ## #"##"#"#####"###"#"##"##"######"##"######"##"###"## #"###"# #"###"##Ƞ%Ƞ47666 6 6 6 0PPp6v77PPp6v77Ƞ:v87PPp6vPPv77Ƞ:v87v7777 777 7 7@v97v376PP :v87v7v77QQQQQp6 ӠPPPPPP PPPPPPPPPPPPP252; 2829p6v87v6>2<:v876=v vvvv77vvvvvvvvvvvvvvvvvvvvvvvvvvv vvvvv97p6vvv vvv vv vvv vvvvvv v vv vvv v v v vvv77vvv6?2<6@6A6B6C6D6E6G6F:v77vvvv6Hv276Iv2<:v77vvv87vvvvvvvvvvv vvvPvPv vv6E6Fp6v87:vvvvvvvvv6Jv27v:v"####"# # ## # ### # ### # ### # ## # ### # ### # ### ## ## # ###"######" # ####q %# #)1A "U#5 #" ##"# #"### ### # ### ### ####"## #"# #" # #"# #" ##L# ## #"#### " ##"###%:%6%: 0#@ @$@P AP A`' AtC A[        C   Q$  < x L  \  l  |         4  @  H  \  !  A   $ (  8  H  X  h  x       ! Q/ X X l    ( 8 H X h( x8 P  " @s #@ " @ @  ' @k @   , @# TC lK S [ c    C  { !0 A$" 8"!T H" @ X" T h" h x" | "  " " " "( " "( "D "` "| (" 8" H" X" h" x"$ "X " " " "8 "T "p " " " (" 8"  H"8 X"X h" x" " " " " "$ "D "\ "p " " (" 8" H"4 X"X h" x" " " "D "d " " " " "! "!4 (" 8"  H"  X"  h"  x" 0 " \ "  "  "  "  " "0 "L "h " (" 8" H"L X"t h" x" " "T "p " " " " " "  "H (" 8" H" X" h" x"8 "\ " " " "( "| " " " " (" 8"  H" X" h" x"D "l " " " " "@ "p " " " (" 8"H H"x X" h"x""  #\  $  %  'hppa-dis.c /opt/bintmp/binutils-2.11.2/opcodes ccom options = -ESconstlit -DA1.1 -DS1.1 -Oq02,al,ag,cn,lM,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,lb,uj,dp,Fs,bp,wp,Ex,mp,rp,ap,dn,Sg,pt,kt,Em,pc,np! -AeHPC HP92453-01 A.11.01. DS$hppa-dis SD$hppa-dis sign_extendlow_sign_extend sign_unextlow_sign_unext re_assemble_3re_assemble_12re_assemble_14re_assemble_16re_assemble_17re_assemble_21re_assemble_22hppa_field_adjust $00000002 $00000003 $00000004 $00000005 $00000006 $00000007 $00000008 $00000009 $0000000A $0000000B $0000000C$L0abortbfd_hppa_insn2fmt $0000000E $0000000F $00000010 $00000011 $00000012 $00000013 $00000014 $00000015 $00000016$L1hppa_rebuild_insn $0000001C $0000001D $0000001E $0000001F $00000020 $00000021 $00000022 $00000023 $00000024 $00000025 $00000026 $00000027 $00000028$L3fput_regM$37 $$dyncall fput_fp_reg fput_fp_reg_rC$38 fput_creg fput_const extract_3extract_5_loadextract_5_storeextract_5r_storeextract_5R_storeextract_10U_storeextract_5Q_store extract_11 extract_14 extract_16 extract_21 extract_12 extract_17 extract_22print_insn_hppa $00000038 $00000039 $0000003A $0000003B $0000003C $0000003D $0000003E $0000003F $00000040 $00000041 $00000042 $00000043 $00000044 $00000045 $00000046 $00000047 $00000048 $00000049 $0000004A $0000004B $0000004C $0000004D $0000004E $0000004F $00000050 $00000051 $00000052 $00000053 $00000054 $00000055 $00000056 $00000057 $00000058 $00000059 $0000005A $0000005B $0000005C $0000005D $0000005E $0000005F $00000060 $00000061 $00000062 $00000063 $00000064 $00000065 $00000066 $00000067 $00000068 $00000069 $0000006A $0000006B $0000006C $0000006D $0000006E $0000006F $00000070 $00000071 $00000072 $00000073 $00000074 $00000075 $00000076 $00000077 $00000078 $00000079 $0000007A $0000007B $0000007C $0000007D $0000007E $0000007F $00000080 $00000081 $00000082 $00000083 $00000084 $00000085 $00000086 $00000087 $00000096 $00000097 $00000098 $00000099 $0000009A $0000009B $0000009C $0000009D $0000009E $0000009F $000000A0 $000000A1 $000000A2 $000000A3 $000000A4 $000000A5 $000000A6 $000000A7 $000000A8 $000000A9 $000000AA $000000AB $000000AC $000000AD $000000AE $000000AF $000000B0 $000000B1 $000000B2 $000000B3 $000000B4 $000000B5 $000000DC $000000DD $000000DE $000000DF $000000E0 $000000E1 $000000E2 $000000E3 $000000E4 $000000E5 $000000E6 $000000E7 $000000E8 $000000E9 $000000EA $000000EB $000000EC $000000ED $000000EE $000000EF bfd_getb32strchr$L12$L13$L14$L15binutils/binutils-RUN/opt/binutils/lib/libopcodes.la010064400000000000003000000013200732753177200214120ustar000300000000000000# libopcodes.la - a libtool library file # Generated by ltmain.sh - GNU libtool 1.4a (1.641.2.122 2000/09/30 05:27:52) # # Please DO NOT delete this file! # It is necessary for linking the library. # The name that we can dlopen(3). dlname='' # Names of this library. library_names='libopcodes-2.11.2.sl libopcodes-2.11.2.sl libopcodes.sl' # The name of the static archive. old_library='libopcodes.a' # Libraries that this one depends upon. dependency_libs='' # Version information for libopcodes. current=0 age=0 revision=0 # Is this an already installed library? installed=yes # Files to dlopen/dlpreopen dlopen='' dlpreopen='' # Directory that this library needs to be installed in: libdir='/opt/binutils/lib' binutils/binutils-SHLIBS/opt/binutils/lib/libbfd-2.11.2.sl010055500000000000003000011200000732753176500215730ustar000300000000000000@d@0$`Gx(rD@  92453-07B11.17;^`X"%O%OX 5P5PX ( @|>(! (@ (>(+el@el>(x@x>(P@>(R@,pY ?  rD@$TEXT$$UNWIND_START$ $UNWIND_END$$RECOVER_START$ $RECOVER_END$ $PRIVATE$$BSS$$DLT$$PLT$ $SHLIB_DATA$ $SHLIB_INFO$$CODE$$LIT$$DATA$ $SHORTDATA$ $SHORTBSS$ $MILLICODE$$UNWIND$MILLICODE$yMMt Zt%P3p(O 0pyեhůͮU>6jLϥ+&rDA~bR LUG@rZϖ٫rb JȀPr ͨTb . rHS[b" R)8g@gy\TŠ'/ &hŒ]ƀTiס8V {ukD!x W 6u-X\T/k[Q0Xg6O/!x݌Z\ kD(245  H vL/}!xT L',שg g6 uAX!xr!xfl]P6!xy'6./vgrVLΡi0'gmTXDh2'Uޞ>MȘMAHNM¾VLM˙N -ҸqV,'keU)keBeqw'3H}t'L#gW!M\]qS)X2! 0޹?7TY%|3\ipSvZlGtfƑmoLszI\n[ax'ke\#eSZG@=ݩY85}At6򁾁:h:VV| tf)e'Y{׷D`oN 5 I pr63G_x]'_MǰuqBĒM)ሽOrP\G'ڦʛB%@ OJYjJlx D O NW\}-ᱎJ9krcN#n.P+ ߝ}t[F3Æ>*kqݭ'kq k!qO'k!WFlQ?,a,o:fUMz ^ffMʱM6~-bYVAWO7G]*./߱USzl׋5*PpwqMh2}7dÏsSqZg3p'?S29]6B <6tY9]6jLϥ+&rDA~bR LUG@rZϖ٫rb JȀPr ͨTb . rHS[b" 9὎ҸZSzlSzu;qW>S)ePsMǰ6P\Gq f{w|F.qOoNY'qݭYB%,F7j)vWF>>7sz}7dXoHD NW\iN D'\#e3I}.P,o 0TvnN?SxګN#n gTvyV.s#u_x]85}eAmoLE VLr*7T-޹b)rI'k!'ke\ipk!q 'kkeLqObXkK zqݭPuqaxSC"a?9D`\(BW!L#g./~-*q ]*ˆZAAtqV I| wK\9ˢ*Sqpr#lqwh:V\U)Q&jM˙rYjYjn[}t@=ݩ֗LK'_+zvwq@ )MʱM{׷r!qwO:2 'k!'kek!'kkeUM̂zMkrZzƑq! Q?,-ᱎ}tftfM5] ߝHN'3YU5zÛ]X2!ĒM; /ҁI]ldA!o Jlx6SZG OͫSGp-Tt3).G vZ'\L)a9iÑ\zc'Gx*P%z*[DOJserœ02'eqwW[p֏s.X6LlGMȘMT')Y%|r%oMh2SeSeNn.^ߝ6SIݭ'SI 'SeS!IO'S! WFP,,UM̅z ^uf!fMʿM6qž--*./߱T]Szo׳5QpwqMh2 7dÏsSqOK)2G%o9͎eqwg.X;YkVYk\g@לgz\TŠ'/Ŧhő]ƀWi̧8V z\ukGx͊W 6tX\T/k[_09Xg8O/xݏZ\ykG(24; HvL/ xWL'שg g6uAXˡxqxfl-P6xz'6./gqVLΡi0'gmTXDi2U<~>MȖMAHNM¾&KM˗Rz-2qVs,&|SeMU)SeB,eqw3Ik}K#gV!MR]qMS)X2! 0ɥ0?4ԋY%`3\ipSv]lɫGzfmLs J$\n[ox'Se[#eZG@=Ya85zAu6:P:VW_ zf)>e '^ {׶D|n@N 5 I p63Dxx\;_MǾuqBĒ')ሳO \G;ڞʛ^%x OKYk\Jlx D O NW[}-NNn.^ߝ6SIݭ'SI S!IO'S! WFP,,UMz ^uf!fMʿM6qž--*./߱T]Szo׳5QpwqMh2 7dÏsSq)2G%o9͎g.X;YkV';9z$"WD, :EvxA0V^?*JK5IUc=9lns-[L3/2&%"81#<?*tGK`0)!'/H|.3C gG4.7T &>pF@:LB76E2D%$  ;B5SYb(Z-H@@ @ ,@2@,U;sU V@U i@&Ux@U @)U@$@U @( U@U @`U@~0U@U@U @U@#U  @U@U $@+@U/@U =@@ UE@$U U@U d@0U|@U @#0U pU UU0U/U#UA<U],UmќUzOU UDU/UHU=dU0|U (UU0<UClUU)UsjU >U s`U aU L\U 4U<U1<UU U3tU CUc]lU |5 UUU$UUЬUdU2U/UU,LUKPU\\UsU~@UAH4U #@UUJpUAUoU  ׬UglU 8#UCP@Uk\UبUSU ِUUlU 0U8U \U6#UA UYtU>kqU <<U=xU?UiU ;tU=UN?tU<UU ;UU4=U?UW>\UjOHU |hU *U UU'<UtUeτU xU -7U 71U CuTU aU { U XU DU xU UF U *0U U 2U L.U ^lU 8`U 0U U1 8U 0U Ua cU EڀU P0U nU 6UR U DU U vxU /tU EU@ hU ~YU U GU KpU |UM  UQ U U b U u (U H0 U PU `U pxU RU U xUy U 7DU pUq BUwCU4ܠUOFUm UTU U#U\U$UMU U,U@UcUv0`UFU tdU 8UU^ U  UpU .Uq(U DU4U\U!#/ U -<UO`UnnU mU /UTUUU-UٸU tU*HU :UO4UmU)%UUNU P U_)hUJU U]hU0UEEU RUfݰUt<UU UXU4UUUU1|U(U5\URPUikU !UvU DUPU \UcHU @U{/U@,UWUrqU'U%UQdU pUkU UU9clU QUvRU QU gU )U3TUWUcU UlU2Uk@hU Z@xU O@(U IK@0U @@U {@`U o4@hU W@pU j@xU i@U f@xU h@U m @U d@U 8@U #@U \@U e@U @U @U @U @U +@U v@U @U ~ a@U @HU } C@PU @XU @`U @U @U @U P@U 2@U <C@U 9@U H@U W@U 4@U @U @ U  @U ,@0U Q@8U +#@@U # @U @U  @U lgpl pm  L 0! ll4l0 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKL ,2;Vix $/=EUd|JQX]bkpw| "+?FMU\biqx~%+1       Z E|m 7 -  mOsA 3kOE] v   2nRsC    P0k| mc  @WRO-;OKjx {4W #\e)  v aC_o  C   P2C9 H'7Sq">\n!<Vm)GiQ#+A[r     4 X {   " ( , D. H. T X `. d. h. l. p/ t/ x/0 |/@ /p / / / / / 0  0P 0` 0p 0 4( 4@ 4P 4` 4p 4 4 4 4 4 4 $4 (5 ,5( 05@ 45X 85p <5 @5 D5 H5 L5 P6 T6 X60 \6H `6` d6x h6 l6 p6 t6 x6 |7 7  78 7P 7h 7 7 7 7 7 7 8 8( 8@ 8X 8h 8x 8 8 8 8 8 9 9 90 9H 9` 9x 9 9 9 9 : :  :8 :P :h : : : : : $: (; ,;( 0;@ 4;X 8;p <; @; D; H; L; P< T< X<0 \ >( >H >` >x > > > > > ? ? ?0 ?H ?` ?x ? ? ? ? @ @ @0 @H @` @x @ @ @  @ @ A A  A8  AP $Ah (A ,A 0A 4A 8A <A @B DB( HB@ LBX PBp TB XB \B `B dC hC  lC8 pCP tCp xC |C C C C D D8 DX Dp D D D D D E E E0 EH Eh E E E E E F F( F@ FX Fx F F F F G G8 GX Gp  G G G G H  H0 $HP (Hh ,Hx 0H 4H 8H <H @I DI( HI@ LIX PIp TI XI \I `I dI hJ lJ( pJ@ tJX xJx |J J J J J K K( K@ KX Kp K K K K K L L  L8 LX Lx L L L L L M M  M8 MP Mh M M M M M N  N  N@ NX Np N  N $N (N ,N 0O 4O0 8OH <O` @O DO HO LO PO TP XP \P0 `PH dP` hPx lP pP tP xP |P Q Q0 QP Qp Q Q Q Q R R0 RX R R R R S S  S@ S` Sx S S S S T T T0 TH T` Tx T T T T U   U8 UP Uh U U  U $U (U ,V 0V( 4VH 8Vh <V @V DV HV LW PW  TW8 XWP \Wh `W dW hW lW pW tW xX |X0 XP Xp X X X X X Y Y8 YP Yp Y Y Y Y Z Z  Z8 ZP Zh Z Z Z Z [ [  [@ [` [ [ [ [ \ \  \@  \` \ \ \ \  \ $\ (] ,]( 0]@ 4]X 8]p <] @] D] H] L^ P^ T^0 X^H \^` `^x d^ h^ l^ p^ t_ x_  |_8 _P _h _ _ _ _ _ _ ` `( `@ `X `p ` ` ` ` ` a a a0 aH a` ax a a a a a b p 0bp \   bh  0 4 @b` l h  bX  @P D TbX ` lb` x bh  bp  : b b b b b b b b b c c c c  c( (c0 0c8 8c@ Hc L Pc Xc `c d hc l x |      JRZ"#$%&'()#$%&'( )*** ,$(.,,0,480<,@1D1H1LP3T1X1\1`1d1h1l4p5t6x,|,,7,8889,"*2:B?8,8@ABB8jrzFGHIJKLMMM M #<$@%DH&LP'T(X)\#`$d%hl&pt'x(|)***,.,,0,1113111111456,,,7,8889 ,"*2 :$B?(8,,084@8A<B@BD8HLjPrTzFXG\H`IdJhKlLpMtMxM|M#$%&'() #$%& $'((,)0*48*<*@,DH,L,P,T1X,\,`1d1h1lp3t1x1|1111456,,,7,8889,7 ?8,8@ABB8  FG HIJKL M$M(M,M0@p#\$`%dh&lp't(x)|#$%&'()* **, ".,, *0,111 23111111456, ,,7,8 8$8(9,,04 :8 B< J@ RD Z?H8L,P8T@XA\M`Md8hl bp jt rFxG|HIJKLMMMM zp#$%&'()#$%&'( )* ** ,$( .,,0,48 0<,@1D1H1LP 3T1X1\1`1d1h1l4p5t6x,|,,7,8889,BB 77,8,8M8BB8   FGHIJKLMMM M0 0#0<$0@%0D0H&0L0P'0T(0X)0\#0`$0d%0h0l&0p0t'0x(0|)0*00 o0*0,00 .0,0,00 00,00 0 0 0 300 100 0 10104050600 y0z000 *|1}1~191 111 J1 R1 Z1 b1$ j1( r81,10 z814@18A1<1@ 1D 1H 1L 1P 1T F1XG1\H1`I1dJ1h1l L1pM1tM1xM1|M11 1 1 1 1 102 2 @2P 2TP2 2`2 2p2 23 3$3T 3X3 33 33 34$ 4(4X 4\4 4 4 4 4 4 5( 5, 05\ 5` @5 5 P5 5 `5 5 p6, 60 6` 6d 6 6 6 6 6 7 70 74 7d 7h 7 7 7 7!8 8!84 88! 8h 8l!08 8!@8 8!P9 9!`98 9<!p9l 9p!9 9!9 9!: : !:< :@!:p :t!: :!: :"; ;";@ ;D" ;t ;x"0; ;"@; ;"P< <"` >#>L >P#> >#(> >#@> >#P? ? #`?P ?T#p? ?#? ?#? ?#@ @$#@T @X#@ @#@ @#@ @#A$ A($AX A\$A A$ A A$0A A$@B( B,$PB\ B`$`B B$pB B$B B$C, C0$C` Cd$C C$C C$C D$D0 D4$Dd Dh%D D%D D% E E%0E4 E8%@Eh El%PE E%`E E%pF F%F8 F<%Fl Fp%F F%F F%G G %G< G@%Gp Gt%G G&G G&H H& H@ HD&0Ht Hx&@H H&PH H&`I I&pID IH&Ix I|&I I&I I&J J&JH JL&J| J&J J&J J'K K'KL KP' K K'0K K'@K K'XL L 'pLP LT'L L'L L'L L'M M$'MT MX(M M(M M(0M M(HN$ N((`NX N\(xN N(N N(N N(O( O,(O\ O`(O O)O O) O O)8P, P0)PP` Pd)hP P)P P)P Q)Q0 Q4)Qd Qh)Q Q)Q Q*R R*(R4 R8*@Rh Rl*XR R*pR R*S S*S8 S<*Sl Sp*S S*S S*T T *T< T@*Tp Tt+T T+T T+(U U+8U@ UD+HUt Ux+XU U+hU U+xV V+VD VH+Vx V|+V V+V V+W W+WH WL+W| W+W W+W W,X X,XL XP, X X,0X X,@X X,PY Y ,`YP YT,hY Y,pY Y,xY Y,Z Z$,ZT ZX,Z Z,Z Z,Z Z,[$ [(,[X [\,[ [-[ [-[ [-(\( \,-0\\ \`-8\ \-@\ \-P\ \-`], ]0-p]` ]d-] ]-] ]-] ^-^0 ^4-^d ^h-^ ^-^ ^-_ _-_4 _8._h _l._ _. _ _.0` `.@`8 `<.P`l `p.`` `.p` `.a a .a< a@.ap at.a a.a a.b b.b@ bD.bt bx/b b/b b/ c c/0cD cH/@cx c|/Pc c/`c c/pd d/dH dL/d| d/d d/d d/e e/eL eP/e e/e{@e{@e{@e{@e{@e{@e{@e{@e{@e{@e{@e{@e{@f{@f {@f{@f{@f${@f,{@f4{@f<{@fD{@fL{@fT{@f\{Hfd{Hfl{Hft{Hf|{Xf{Xf{Xf{hf{pf{hf{pf{hf{xf{f{f{f{f{xf{f{f{g{g {g{g{g${g,{g4{g<{gD{gL{gT{g\{gd{gl{gt{g|{g{g{g{g{g{g{g{g{g{g{g{g{g{g{g{g{h{h {h{h|h$|h,|h4|h<|hD|hL|hT|h\|hd|hl|ht|h||h|h|h|h|h|h|h|h|h|h|h|h|h|h|h|h|i|i |i|i{i${i,{i4{i<{iD{iL{iT{i\{id{il{it{i|{i{i{i{i|i|i|i|i|i|i|i|i|i|i|i|i|j|j |j|j|j$|j,|j4|j<|jD|jL|jT|j\|jd|jl|jt|j||j|j|j|j{j{j{j{j{j{j{j{j{j{j{j{j{k{k {k{k{k${k,{xk4|k<|kD{kL{kT{k\| kd|(kl|0kt{k|{k|8k|@k|Hk{xk{xk{k{k{k{k{k{k{k|Pk|Xk|`k|hl|pl {l|xl|l$|l,|l4|l<|lD|lL|lT{l\{ld{ll|lt|l|{l|l{l{l{l{l{l{l{l{l{l{l{l{l{l{l{m{m {m{m{m${m,{m4{m<{mD{mL{mT{m\{md{ml{mt{m|{m{m{m{m8m@mPm`mhmpmmmmmmmnnnnn nD}hnH}nTnXn\n`nt}hnx}nnnnn}hn}xnnnnn}hn}pnnooo4 o8 o< o@ oD oH oL oP oT oX o\ o` od oh ol op ot ox *o|*o*oo ,o,o,o,o,o,o,o,o1o1o1oo3o1o1o1o1o1o1oo o o ,o,o,o7o,o8o8o8p9p,pMp Mpp 7p7p,p 8p$,p(8p,Mp08p4Mp8Mp<8p@pDpHpL8pP,pT8pX,p\,p`,pd,phMplMppMptMpx pp p p ph pP p px ,A4!\& 88  t! $ H, ?4 X< (;DHL<BTH\(d<lP!pso .|{u~}oyzyvt90wznmls jk irszuhgv efuwtdwc,18BM7645*tu'()&#$%3? bwvta`_ GLFw^] \ut[Z Y@wAWX VUt wSQ RTw HI ! J "  KPONsMqL -~wN+2uCDO/E<:;>=#$%&'()*,.013456789?@ABFGHIJKLMJKsQPRSxTUVWX#$%&'()*,13456789?@ABFGHIJKLMIHGqFDEteu^]ZY\bc[d_a`#$%&'()*,.013456789?@AMFGHIJKLBCsAq@g~wfiulhjkm#$%&'()*,.013456789BMFGHIJKL>=s?;<twu8:3172645|0%&$#)('-!,+*.  s/r"ptwnuqswvut}x{vr#$%&'()*o,.031456yz|}~98@AFGHIJLM *,13789Mg!4libbfd-2.11.2.slbfd_last_cachereloc_queueerrnoihex_vec_bfd_target_vector_entriesbfd_default_vectorsymbolsrec_vecbfd_abs_symbolbinary_vecbfd_und_sectionsrec_vec_bfd_chunksizebfd_errmsgsbfd_hppa_archChunkbfd_und_symbol_bfd_error_handlerbfd_abs_sectionS3Forcedbfd_com_symboltekhex_vechpux_core_vecsom_vecbfd_com_sectionbfd_ind_symbolbfd_default_arch_structbfd_target_vectorbfd_ind_section_hex_value__iob__SB_masks_bfd_archive_coff_construct_extended_name_tablebfd_openr_next_archived_filebfd_scan_archbfd_0lbfd_0u_bfd_generic_get_elt_at_indexcoff_get_symtab_upper_boundbfd_cache_closebfd_get_machbfd_make_readablecoff_get_symtabbfd_log2bfd_nullvoidptr_bfd_default_link_orderbfd_getl_signed_32_bfd_nocore_core_file_matches_executable_p_bfd_get_gp_valuecoff_write_symbolsbfd_getl_signed_16bfd_hash_allocatebfd_core_file_failing_commandbfd_make_sectionbfd_getl_signed_64bfd_decode_symclassbfd_reloc_type_lookupbfd_closebfd_init_windowbfd_dont_truncate_arname_bfd_dummy_targetbfd_set_default_targetbfd_get_error_handlerbfd_symbol_info_bfd_generic_link_split_section_bfd_final_link_relocatebfd_write_bfd_xcoff_stringtab_init_bfd_stringtab_freebfd_slurp_armap_bfd_stringtab_sizebfd_set_arch_info_bfd_generic_reloc_link_orderbfd_zmallocbfd_0bfd_hash_traverse_bfd_coff_read_internal_relocsbfd_default_scan_bfd_generic_mkarchivebfd_errmsgbfd_put_bitsbfd_fdopenrcoff_find_nearest_linebfd_default_compatible_bfd_generic_read_ar_hdrbfd_get_bits_bfd_strip_section_from_outputbfd_get_arch_infobfd_get_unique_section_name_bfd_write_stab_stringscoff_bfd_make_debug_symbol_bfd_link_hash_table_initbfd_octets_per_bytebfd_perform_relocationbfd_get_error_bfd_coff_free_symbolsbfd_set_section_sizebfd_get_arch_sizebfd_printable_arch_machbfd_cache_initbfd_special_undocumented_gluebfd_cache_lookup_workercoff_print_symbolbfd_print_symbol_vandfbfd_putb16bfd_slurp_bsd_armap_f2bfd_putb32bfd_make_section_anywaybfd_getb16bfd_getb_signed_32bfd_putb64bfd_getb32coff_get_linenobfd_getb_signed_16bfd_set_start_addressbfd_getb64_bfd_link_section_stabsbfd_getb_signed_64bfd_make_writablebfd_make_section_old_waybfd_check_format_matchescoff_symbol_fromcoff_get_symbol_infocoff_sizeof_headersbfd_hash_table_init_nbfd_arch_list_bfd_generic_link_add_one_symbolbfd_flushbfd_realloc_bfd_generic_read_minisymbolsbfd_generic_stat_arch_elt_bfd_generic_link_write_global_symbolcoff_mangle_symbolsbfd_generic_is_local_label_namebfd_hash_replacebfd_scan_vmabfd_arch_bits_per_addressbfd_check_format_bfd_stringtab_initbfd_get_reloc_upper_boundbfd_format_string_bfd_generic_link_add_symbols_collectbfd_stat_bfd_nocore_core_file_failing_signalcoff_count_linenumbersbfd_hash_table_init_bfd_nocore_core_file_failing_commandcoff_make_empty_symbolbfd_generic_get_relocated_section_contentsbfd_perror_bfd_generic_link_add_symbolsbfd_new_link_orderbfd_write_bigendian_4byte_int_bfd_create_empty_archive_element_shell_bfd_add_bfd_to_archive_cache_bfd_archive_bsd_update_armap_timestamp_bfd_generic_minisymbol_to_symbolbfd_set_error_handler_bfd_construct_extended_name_tablebfd_search_for_targetbfd_install_relocation_bfd_get_elt_at_fileposbfd_openrbfd_openwbfd_assertbfd_hash_newfunc_bfd_generic_read_ar_hdr_magbfd_get_gp_sizebfd_default_reloc_type_lookupbfd_som_attach_compilation_unit_bfd_n1bfd_hash_lookupbfd_record_phdr_bfd_set_gp_valuebfd_get_reloc_sizebfd_printable_namebfd_get_archcoff_get_normalized_symtabbfd_tellbfd_link_hash_traverse_bfd_generic_get_section_contents_bfd_generic_set_section_contentsbfd_set_error_program_name_bfd_dwarf2_find_nearest_line_bfd_compute_and_write_armapbfd_find_targetbfd_arch_bits_per_byte_bfd_coff_is_local_label_namebfd_set_gp_size_bfd_generic_link_add_archive_symbolsbfd_close_all_donebfd_get_next_mapentbfd_coff_get_symentbfd_get_relocated_section_contentsbfd_link_add_undefbfd_void_bfd_new_bfd_contained_inbfd_is_undefined_symclassbfd_gnu_truncate_arname_bfd_generic_link_output_symbols_bfd_relocate_contentsbfd_som_set_symbol_typebfd_is_local_labelbfd_putl16bfd_putl32bfd_getl16bfd_putl64bfd_getl32_bfd_write_archive_contentsbfd_true_bfd_generic_get_section_contents_in_windowbfd_seekbfd_getl64bfd_set_symtabbsd_write_armap_bfd_coff_get_external_symbolscoff_get_reloc_upper_boundbfd_falsebfd_som_set_subsection_attributesbfd_som_set_section_attributesbfd_get_section_contentsbfd_set_section_contentsbfd_init_bfd_generic_link_hash_newfunc_bfd_look_for_bfd_in_cache_bfd_abortbfd_set_formatbfd_set_error_bfd_coff_internal_syment_namebfd_target_listbfd_set_archive_headbfd_arch_mach_octets_per_bytebfd_wrapped_link_hash_lookup_bfd_stab_section_offsetbfd_set_file_flagsbfd_createcoff_write_linenumbersbfd_core_file_failing_signalbfd_openstreamrbfd_get_sign_extend_vma_bfd_stringtab_addbfd_link_hash_lookup_bfd_new_bfd_bfd_stringtab_emitbfd_set_relocbfd_coff_get_auxent_bfd_link_hash_newfuncbfd_get_mtimecoff_object_p_bfd_coff_read_string_tablebfd_generic_archive_pbfd_hash_table_freecoff_section_from_bfd_indexbfd_mallocbfd_get_size_bfd_count_link_order_relocsbfd_canonicalize_relocbfd_map_over_sections_bfd_write_section_stabs_bfd_stab_section_find_nearest_line_bfd_generic_verify_endian_matchbfd_alloccoff_renumber_symbolsbfd_generic_relax_sectionbfd_arch_get_compatiblecoff_write_armapbfd_som_attach_aux_hdrbfd_default_set_arch_mach_bfd_archive_bsd_construct_extended_name_tablebfd_coff_set_symbol_classbfd_get_stab_namebfd_zallocbfd_bsd_truncate_arnamebfd_set_section_flagsbfd_lookup_arch_bfd_generic_link_hash_table_createbfd_generic_gc_sectionsbfd_generic_openr_next_archived_filebfd_check_overflowbfd_releasebfd_get_section_by_namecore_file_matches_executable_pbfd_readhppa_som_gen_reloc_typebfd_get_reloc_code_namebfd_open_file_bfd_slurp_extended_name_table_bfd_generic_final_linkmemsetmemcpystatfree_isalnumtimeperroratoiconcattoupper_isprintdcgettextgetgidstrlenfflush_isspace_isxdigitfstatstrtoulgetenvftell_islowerstrcasecmpvfprintfstrncmpstrtolfnmatchgetuidqsorthex_initobjalloc_free_blockfwritefdopenstrncpystrcatchmodfilenoreallocunlinkumaskfprintffclose_isdigitstrncasecmpfseekstrchrstrcmpobjalloc_free_objalloc_allocfcntlstrcpysprintfobjalloc_createstrrchrmemchrfopen_isuppermallocmemcmpxexitfreadxstrerrorstrtab_hash_newfuncstab_link_includes_newfunccmpindexentrygeneric_link_check_archive_element_collectgeneric_link_check_archive_element_no_collectarchive_hash_newfuncsymbolsrec_object_psrec_mkobjectsymbolsrec_write_object_contentssrec_get_section_contentssrec_get_symtab_upper_boundsrec_get_symtabsrec_make_empty_symbolsrec_print_symbolsrec_get_symbol_infosrec_set_arch_machsrec_set_section_contentssrec_sizeof_headerssrec_object_psrec_write_object_contentsbinary_object_pbinary_mkobjectbinary_get_section_contentsbinary_get_symtab_upper_boundbinary_get_symtabbinary_make_empty_symbolbinary_get_symbol_infobinary_set_section_contentsbinary_sizeof_headerstekhex_object_ptekhex_mkobjecttekhex_write_object_contentstekhex_get_section_contentstekhex_get_symtab_upper_boundtekhex_get_symtabtekhex_make_empty_symboltekhex_print_symboltekhex_get_symbol_infotekhex_set_arch_machtekhex_set_section_contentstekhex_sizeof_headersfirst_phaseihex_object_pihex_mkobjectihex_write_object_contentsihex_get_section_contentsihex_make_empty_symbolihex_set_arch_machihex_set_section_contentsihex_sizeof_headerssom_object_psom_mkobjectsom_write_object_contentssom_bfd_free_cached_infosom_new_section_hooksom_get_section_contentssom_bfd_copy_private_bfd_datasom_bfd_copy_private_section_datasom_bfd_copy_private_symbol_datasom_slurp_armapsom_write_armapsom_get_symtab_upper_boundsom_get_symtabsom_make_empty_symbolsom_print_symbolsom_get_symbol_infosom_bfd_is_local_label_namesom_find_nearest_linesom_get_reloc_upper_boundsom_canonicalize_relocsom_bfd_reloc_type_lookupsom_set_arch_machsom_set_section_contentssom_sizeof_headerssom_bfd_link_split_sectioncompare_subspacescompare_symshppa_som_relocswap_aborthpux_core_core_file_phpux_core_core_file_failing_commandhpux_core_core_file_failing_signalhpux_core_core_file_matches_executable_phpux_core_make_empty_symbol_bfd_default_error_handler7!?9" 7]!9ӽ9Y4!:ӽ9Y4T ;|ӽd Y"ӽ9"ӽ@>B! @ Z A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  a@@@ @7]]@]2@@ @] @@ @@ @ @*@ :7!?9" : B*= @ Z ]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]! =]` =@ :7]@ k? k?k?XZ]XZ]XZ]XZ]d@"Z]> ZZ]> ZZ]9 Z8 =@Y :Z @Z@ ZZZ] ZZ @"ZY :ZZ@= ZZZ@= Z ZY :Z]ya: =]: =]  : =@4ZBu ZZZZ ZZ]ya: =]: =]  : = @4ZB ZZZM ZZY :}@4Be]yZZ5@*Z@ya AZ@ya AZ]ya A @Z@] Z]: =] y a: =4Y(ZYY8Z@] Z]: =] y a: =4Y(Z YY8Z]Y Z @*Z@YA AZ@YA AZ]YA A @ ZZmZ` ! ! __.SYMDEF __.SYMDEF/ / /SYM64/ ARFILENAMES/ // ARFILENAMES///%-d%-12ld%ld%-8o%-10ldarchive.c%-10d bfdWarning: writing archive was slow: rewriting timestamp __.SYMDEFReading archive file mod timestampWriting updated armap timestamp%d%-7oV}   1    FpP unknownUNKNOWN!No errorSystem call errorInvalid bfd targetFile in wrong formatInvalid operationMemory exhaustedNo symbolsArchive has no index; run ranlib to add oneNo more archived filesMalformed archiveFile format not recognizedFile format is ambiguousSection has no contentsNonrepresentable section on outputSymbol needs debug section which does not existBad valueFile truncatedFile too big#bfd%s %s: %s %s: BFD: bfd assertion fail %s:%dBFD internal error, aborting at %s line %d in %s BFD internal error, aborting at %s line %d Please report this bug. cache.crr+w+coffgen.cstrange.file.debugbfd%s: bad string table size %lu%scoff %s %s[%3ld](sec %2d)(fl 0x%02x)(ty %3x)(scl %3d) (nx %d) 0x%08lx %s File AUX scnlen 0x%lx nreloc %d nlnno %d checksum 0x%lx assoc %d comdat %dAUX tagndx %ld ttlsiz 0x%lx lnnos %ld next %ldAUX lnno %d size 0x%x tagndx %ld endndx %ld %s : %4d : 0x%lx %-5s %s %s %sinvalidobjectarchivecoreunknownlibbfd.cbfd%s: compiled for a big endian system and target is little endian%s: compiled for a little endian system and target is big endianrr+opncls.c@@uninitialized@@BFD_RELOC_64BFD_RELOC_32BFD_RELOC_26BFD_RELOC_24BFD_RELOC_16BFD_RELOC_14BFD_RELOC_8BFD_RELOC_64_PCRELBFD_RELOC_32_PCRELBFD_RELOC_24_PCRELBFD_RELOC_16_PCRELBFD_RELOC_12_PCRELBFD_RELOC_8_PCRELBFD_RELOC_32_GOT_PCRELBFD_RELOC_16_GOT_PCRELBFD_RELOC_8_GOT_PCRELBFD_RELOC_32_GOTOFFBFD_RELOC_16_GOTOFFBFD_RELOC_LO16_GOTOFFBFD_RELOC_HI16_GOTOFFBFD_RELOC_HI16_S_GOTOFFBFD_RELOC_8_GOTOFFBFD_RELOC_32_PLT_PCRELBFD_RELOC_24_PLT_PCRELBFD_RELOC_16_PLT_PCRELBFD_RELOC_8_PLT_PCRELBFD_RELOC_32_PLTOFFBFD_RELOC_16_PLTOFFBFD_RELOC_LO16_PLTOFFBFD_RELOC_HI16_PLTOFFBFD_RELOC_HI16_S_PLTOFFBFD_RELOC_8_PLTOFFBFD_RELOC_68K_GLOB_DATBFD_RELOC_68K_JMP_SLOTBFD_RELOC_68K_RELATIVEBFD_RELOC_32_BASERELBFD_RELOC_16_BASERELBFD_RELOC_LO16_BASERELBFD_RELOC_HI16_BASERELBFD_RELOC_HI16_S_BASERELBFD_RELOC_8_BASERELBFD_RELOC_RVABFD_RELOC_8_FFnnBFD_RELOC_32_PCREL_S2BFD_RELOC_16_PCREL_S2BFD_RELOC_23_PCREL_S2BFD_RELOC_HI22BFD_RELOC_LO10BFD_RELOC_GPREL16BFD_RELOC_GPREL32BFD_RELOC_I960_CALLJBFD_RELOC_NONEBFD_RELOC_SPARC_WDISP22BFD_RELOC_SPARC22BFD_RELOC_SPARC13BFD_RELOC_SPARC_GOT10BFD_RELOC_SPARC_GOT13BFD_RELOC_SPARC_GOT22BFD_RELOC_SPARC_PC10BFD_RELOC_SPARC_PC22BFD_RELOC_SPARC_WPLT30BFD_RELOC_SPARC_COPYBFD_RELOC_SPARC_GLOB_DATBFD_RELOC_SPARC_JMP_SLOTBFD_RELOC_SPARC_RELATIVEBFD_RELOC_SPARC_UA16BFD_RELOC_SPARC_UA32BFD_RELOC_SPARC_UA64BFD_RELOC_SPARC_BASE13BFD_RELOC_SPARC_BASE22BFD_RELOC_SPARC_10BFD_RELOC_SPARC_11BFD_RELOC_SPARC_OLO10BFD_RELOC_SPARC_HH22BFD_RELOC_SPARC_HM10BFD_RELOC_SPARC_LM22BFD_RELOC_SPARC_PC_HH22BFD_RELOC_SPARC_PC_HM10BFD_RELOC_SPARC_PC_LM22BFD_RELOC_SPARC_WDISP16BFD_RELOC_SPARC_WDISP19BFD_RELOC_SPARC_7BFD_RELOC_SPARC_6BFD_RELOC_SPARC_5BFD_RELOC_SPARC_PLT64BFD_RELOC_SPARC_HIX22BFD_RELOC_SPARC_LOX10BFD_RELOC_SPARC_H44BFD_RELOC_SPARC_M44BFD_RELOC_SPARC_L44BFD_RELOC_SPARC_REGISTERBFD_RELOC_SPARC_REV32BFD_RELOC_ALPHA_GPDISP_HI16BFD_RELOC_ALPHA_GPDISP_LO16BFD_RELOC_ALPHA_GPDISPBFD_RELOC_ALPHA_LITERALBFD_RELOC_ALPHA_ELF_LITERALBFD_RELOC_ALPHA_LITUSEBFD_RELOC_ALPHA_USER_LITERALBFD_RELOC_ALPHA_USER_LITUSE_BASEBFD_RELOC_ALPHA_USER_LITUSE_BYTOFFBFD_RELOC_ALPHA_USER_LITUSE_JSRBFD_RELOC_ALPHA_USER_GPDISPBFD_RELOC_ALPHA_USER_GPRELHIGHBFD_RELOC_ALPHA_USER_GPRELLOWBFD_RELOC_ALPHA_HINTBFD_RELOC_ALPHA_LINKAGEBFD_RELOC_ALPHA_CODEADDRBFD_RELOC_MIPS_JMPBFD_RELOC_MIPS16_JMPBFD_RELOC_MIPS16_GPRELBFD_RELOC_HI16BFD_RELOC_HI16_SBFD_RELOC_LO16BFD_RELOC_PCREL_HI16_SBFD_RELOC_PCREL_LO16BFD_RELOC_MIPS_LITERALBFD_RELOC_MIPS_GOT16BFD_RELOC_MIPS_CALL16BFD_RELOC_MIPS_GOT_HI16BFD_RELOC_MIPS_GOT_LO16BFD_RELOC_MIPS_CALL_HI16BFD_RELOC_MIPS_CALL_LO16BFD_RELOC_MIPS_SUBBFD_RELOC_MIPS_GOT_PAGEBFD_RELOC_MIPS_GOT_OFSTBFD_RELOC_MIPS_GOT_DISPBFD_RELOC_MIPS_SHIFT5BFD_RELOC_MIPS_SHIFT6BFD_RELOC_MIPS_INSERT_ABFD_RELOC_MIPS_INSERT_BBFD_RELOC_MIPS_DELETEBFD_RELOC_MIPS_HIGHESTBFD_RELOC_MIPS_HIGHERBFD_RELOC_MIPS_SCN_DISPBFD_RELOC_MIPS_REL16BFD_RELOC_MIPS_RELGOTBFD_RELOC_MIPS_JALRBFD_RELOC_386_GOT32BFD_RELOC_386_PLT32BFD_RELOC_386_COPYBFD_RELOC_386_GLOB_DATBFD_RELOC_386_JUMP_SLOTBFD_RELOC_386_RELATIVEBFD_RELOC_386_GOTOFFBFD_RELOC_386_GOTPCBFD_RELOC_X86_64_GOT32BFD_RELOC_X86_64_PLT32BFD_RELOC_X86_64_COPYBFD_RELOC_X86_64_GLOB_DATBFD_RELOC_X86_64_JUMP_SLOTBFD_RELOC_X86_64_RELATIVEBFD_RELOC_X86_64_GOTPCRELBFD_RELOC_X86_64_32SBFD_RELOC_NS32K_IMM_8BFD_RELOC_NS32K_IMM_16BFD_RELOC_NS32K_IMM_32BFD_RELOC_NS32K_IMM_8_PCRELBFD_RELOC_NS32K_IMM_16_PCRELBFD_RELOC_NS32K_IMM_32_PCRELBFD_RELOC_NS32K_DISP_8BFD_RELOC_NS32K_DISP_16BFD_RELOC_NS32K_DISP_32BFD_RELOC_NS32K_DISP_8_PCRELBFD_RELOC_NS32K_DISP_16_PCRELBFD_RELOC_NS32K_DISP_32_PCRELBFD_RELOC_PJ_CODE_HI16BFD_RELOC_PJ_CODE_LO16BFD_RELOC_PJ_CODE_DIR16BFD_RELOC_PJ_CODE_DIR32BFD_RELOC_PJ_CODE_REL16BFD_RELOC_PJ_CODE_REL32BFD_RELOC_PPC_B26BFD_RELOC_PPC_BA26BFD_RELOC_PPC_TOC16BFD_RELOC_PPC_B16BFD_RELOC_PPC_B16_BRTAKENBFD_RELOC_PPC_B16_BRNTAKENBFD_RELOC_PPC_BA16BFD_RELOC_PPC_BA16_BRTAKENBFD_RELOC_PPC_BA16_BRNTAKENBFD_RELOC_PPC_COPYBFD_RELOC_PPC_GLOB_DATBFD_RELOC_PPC_JMP_SLOTBFD_RELOC_PPC_RELATIVEBFD_RELOC_PPC_LOCAL24PCBFD_RELOC_PPC_EMB_NADDR32BFD_RELOC_PPC_EMB_NADDR16BFD_RELOC_PPC_EMB_NADDR16_LOBFD_RELOC_PPC_EMB_NADDR16_HIBFD_RELOC_PPC_EMB_NADDR16_HABFD_RELOC_PPC_EMB_SDAI16BFD_RELOC_PPC_EMB_SDA2I16BFD_RELOC_PPC_EMB_SDA2RELBFD_RELOC_PPC_EMB_SDA21BFD_RELOC_PPC_EMB_MRKREFBFD_RELOC_PPC_EMB_RELSEC16BFD_RELOC_PPC_EMB_RELST_LOBFD_RELOC_PPC_EMB_RELST_HIBFD_RELOC_PPC_EMB_RELST_HABFD_RELOC_PPC_EMB_BIT_FLDBFD_RELOC_PPC_EMB_RELSDABFD_RELOC_I370_D12BFD_RELOC_CTORBFD_RELOC_ARM_PCREL_BRANCHBFD_RELOC_ARM_PCREL_BLXBFD_RELOC_THUMB_PCREL_BLXBFD_RELOC_ARM_IMMEDIATEBFD_RELOC_ARM_ADRL_IMMEDIATEBFD_RELOC_ARM_OFFSET_IMMBFD_RELOC_ARM_SHIFT_IMMBFD_RELOC_ARM_SWIBFD_RELOC_ARM_MULTIBFD_RELOC_ARM_CP_OFF_IMMBFD_RELOC_ARM_ADR_IMMBFD_RELOC_ARM_LDR_IMMBFD_RELOC_ARM_LITERALBFD_RELOC_ARM_IN_POOLBFD_RELOC_ARM_OFFSET_IMM8BFD_RELOC_ARM_HWLITERALBFD_RELOC_ARM_THUMB_ADDBFD_RELOC_ARM_THUMB_IMMBFD_RELOC_ARM_THUMB_SHIFTBFD_RELOC_ARM_THUMB_OFFSETBFD_RELOC_ARM_GOT12BFD_RELOC_ARM_GOT32BFD_RELOC_ARM_JUMP_SLOTBFD_RELOC_ARM_COPYBFD_RELOC_ARM_GLOB_DATBFD_RELOC_ARM_PLT32BFD_RELOC_ARM_RELATIVEBFD_RELOC_ARM_GOTOFFBFD_RELOC_ARM_GOTPCBFD_RELOC_SH_PCDISP8BY2BFD_RELOC_SH_PCDISP12BY2BFD_RELOC_SH_IMM4BFD_RELOC_SH_IMM4BY2BFD_RELOC_SH_IMM4BY4BFD_RELOC_SH_IMM8BFD_RELOC_SH_IMM8BY2BFD_RELOC_SH_IMM8BY4BFD_RELOC_SH_PCRELIMM8BY2BFD_RELOC_SH_PCRELIMM8BY4BFD_RELOC_SH_SWITCH16BFD_RELOC_SH_SWITCH32BFD_RELOC_SH_USESBFD_RELOC_SH_COUNTBFD_RELOC_SH_ALIGNBFD_RELOC_SH_CODEBFD_RELOC_SH_DATABFD_RELOC_SH_LABELBFD_RELOC_SH_LOOP_STARTBFD_RELOC_SH_LOOP_ENDBFD_RELOC_SH_COPYBFD_RELOC_SH_GLOB_DATBFD_RELOC_SH_JMP_SLOTBFD_RELOC_SH_RELATIVEBFD_RELOC_SH_GOTPCBFD_RELOC_THUMB_PCREL_BRANCH9BFD_RELOC_THUMB_PCREL_BRANCH12BFD_RELOC_THUMB_PCREL_BRANCH23BFD_RELOC_ARC_B22_PCRELBFD_RELOC_ARC_B26BFD_RELOC_D10V_10_PCREL_RBFD_RELOC_D10V_10_PCREL_LBFD_RELOC_D10V_18BFD_RELOC_D10V_18_PCRELBFD_RELOC_D30V_6BFD_RELOC_D30V_9_PCRELBFD_RELOC_D30V_9_PCREL_RBFD_RELOC_D30V_15BFD_RELOC_D30V_15_PCRELBFD_RELOC_D30V_15_PCREL_RBFD_RELOC_D30V_21BFD_RELOC_D30V_21_PCRELBFD_RELOC_D30V_21_PCREL_RBFD_RELOC_D30V_32BFD_RELOC_D30V_32_PCRELBFD_RELOC_M32R_24BFD_RELOC_M32R_10_PCRELBFD_RELOC_M32R_18_PCRELBFD_RELOC_M32R_26_PCRELBFD_RELOC_M32R_HI16_ULOBFD_RELOC_M32R_HI16_SLOBFD_RELOC_M32R_LO16BFD_RELOC_M32R_SDA16BFD_RELOC_V850_9_PCRELBFD_RELOC_V850_22_PCRELBFD_RELOC_V850_SDA_16_16_OFFSETBFD_RELOC_V850_SDA_15_16_OFFSETBFD_RELOC_V850_ZDA_16_16_OFFSETBFD_RELOC_V850_ZDA_15_16_OFFSETBFD_RELOC_V850_TDA_6_8_OFFSETBFD_RELOC_V850_TDA_7_8_OFFSETBFD_RELOC_V850_TDA_7_7_OFFSETBFD_RELOC_V850_TDA_16_16_OFFSETBFD_RELOC_V850_TDA_4_5_OFFSETBFD_RELOC_V850_TDA_4_4_OFFSETBFD_RELOC_V850_SDA_16_16_SPLIT_OFFSETBFD_RELOC_V850_ZDA_16_16_SPLIT_OFFSETBFD_RELOC_V850_CALLT_6_7_OFFSETBFD_RELOC_V850_CALLT_16_16_OFFSETBFD_RELOC_MN10300_32_PCRELBFD_RELOC_MN10300_16_PCRELBFD_RELOC_TIC30_LDPBFD_RELOC_TIC54X_PARTLS7BFD_RELOC_TIC54X_PARTMS9BFD_RELOC_TIC54X_23BFD_RELOC_TIC54X_16_OF_23BFD_RELOC_TIC54X_MS7_OF_23BFD_RELOC_FR30_48BFD_RELOC_FR30_20BFD_RELOC_FR30_6_IN_4BFD_RELOC_FR30_8_IN_8BFD_RELOC_FR30_9_IN_8BFD_RELOC_FR30_10_IN_8BFD_RELOC_FR30_9_PCRELBFD_RELOC_FR30_12_PCRELBFD_RELOC_MCORE_PCREL_IMM8BY4BFD_RELOC_MCORE_PCREL_IMM11BY2BFD_RELOC_MCORE_PCREL_IMM4BY2BFD_RELOC_MCORE_PCREL_32BFD_RELOC_MCORE_PCREL_JSR_IMM11BY2BFD_RELOC_MCORE_RVABFD_RELOC_AVR_7_PCRELBFD_RELOC_AVR_13_PCRELBFD_RELOC_AVR_16_PMBFD_RELOC_AVR_LO8_LDIBFD_RELOC_AVR_HI8_LDIBFD_RELOC_AVR_HH8_LDIBFD_RELOC_AVR_LO8_LDI_NEGBFD_RELOC_AVR_HI8_LDI_NEGBFD_RELOC_AVR_HH8_LDI_NEGBFD_RELOC_AVR_LO8_LDI_PMBFD_RELOC_AVR_HI8_LDI_PMBFD_RELOC_AVR_HH8_LDI_PMBFD_RELOC_AVR_LO8_LDI_PM_NEGBFD_RELOC_AVR_HI8_LDI_PM_NEGBFD_RELOC_AVR_HH8_LDI_PM_NEGBFD_RELOC_AVR_CALLBFD_RELOC_VTABLE_INHERITBFD_RELOC_VTABLE_ENTRYBFD_RELOC_IA64_IMM14BFD_RELOC_IA64_IMM22BFD_RELOC_IA64_IMM64BFD_RELOC_IA64_DIR32MSBBFD_RELOC_IA64_DIR32LSBBFD_RELOC_IA64_DIR64MSBBFD_RELOC_IA64_DIR64LSBBFD_RELOC_IA64_GPREL22BFD_RELOC_IA64_GPREL64IBFD_RELOC_IA64_GPREL32MSBBFD_RELOC_IA64_GPREL32LSBBFD_RELOC_IA64_GPREL64MSBBFD_RELOC_IA64_GPREL64LSBBFD_RELOC_IA64_LTOFF22BFD_RELOC_IA64_LTOFF64IBFD_RELOC_IA64_PLTOFF22BFD_RELOC_IA64_PLTOFF64IBFD_RELOC_IA64_PLTOFF64MSBBFD_RELOC_IA64_PLTOFF64LSBBFD_RELOC_IA64_FPTR64IBFD_RELOC_IA64_FPTR32MSBBFD_RELOC_IA64_FPTR32LSBBFD_RELOC_IA64_FPTR64MSBBFD_RELOC_IA64_FPTR64LSBBFD_RELOC_IA64_PCREL21BBFD_RELOC_IA64_PCREL21BIBFD_RELOC_IA64_PCREL21MBFD_RELOC_IA64_PCREL21FBFD_RELOC_IA64_PCREL22BFD_RELOC_IA64_PCREL60BBFD_RELOC_IA64_PCREL64IBFD_RELOC_IA64_PCREL32MSBBFD_RELOC_IA64_PCREL32LSBBFD_RELOC_IA64_PCREL64MSBBFD_RELOC_IA64_PCREL64LSBBFD_RELOC_IA64_LTOFF_FPTR22BFD_RELOC_IA64_LTOFF_FPTR64IBFD_RELOC_IA64_LTOFF_FPTR64MSBBFD_RELOC_IA64_LTOFF_FPTR64LSBBFD_RELOC_IA64_SEGREL32MSBBFD_RELOC_IA64_SEGREL32LSBBFD_RELOC_IA64_SEGREL64MSBBFD_RELOC_IA64_SEGREL64LSBBFD_RELOC_IA64_SECREL32MSBBFD_RELOC_IA64_SECREL32LSBBFD_RELOC_IA64_SECREL64MSBBFD_RELOC_IA64_SECREL64LSBBFD_RELOC_IA64_REL32MSBBFD_RELOC_IA64_REL32LSBBFD_RELOC_IA64_REL64MSBBFD_RELOC_IA64_REL64LSBBFD_RELOC_IA64_LTV32MSBBFD_RELOC_IA64_LTV32LSBBFD_RELOC_IA64_LTV64MSBBFD_RELOC_IA64_LTV64LSBBFD_RELOC_IA64_IPLTMSBBFD_RELOC_IA64_IPLTLSBBFD_RELOC_IA64_COPYBFD_RELOC_IA64_TPREL22BFD_RELOC_IA64_TPREL64MSBBFD_RELOC_IA64_TPREL64LSBBFD_RELOC_IA64_LTOFF_TP22BFD_RELOC_IA64_LTOFF22XBFD_RELOC_IA64_LDXMOVBFD_RELOC_M68HC11_HI8BFD_RELOC_M68HC11_LO8BFD_RELOC_M68HC11_3BBFD_RELOC_CRIS_BDISP8BFD_RELOC_CRIS_UNSIGNED_5BFD_RELOC_CRIS_SIGNED_6BFD_RELOC_CRIS_UNSIGNED_6BFD_RELOC_CRIS_UNSIGNED_4BFD_RELOC_860_COPYBFD_RELOC_860_GLOB_DATBFD_RELOC_860_JUMP_SLOTBFD_RELOC_860_RELATIVEBFD_RELOC_860_PC26BFD_RELOC_860_PLT26BFD_RELOC_860_PC16BFD_RELOC_860_LOW0BFD_RELOC_860_SPLIT0BFD_RELOC_860_LOW1BFD_RELOC_860_SPLIT1BFD_RELOC_860_LOW2BFD_RELOC_860_SPLIT2BFD_RELOC_860_LOW3BFD_RELOC_860_LOGOT0BFD_RELOC_860_SPGOT0BFD_RELOC_860_LOGOT1BFD_RELOC_860_SPGOT1BFD_RELOC_860_LOGOTOFF0BFD_RELOC_860_SPGOTOFF0BFD_RELOC_860_LOGOTOFF1BFD_RELOC_860_SPGOTOFF1BFD_RELOC_860_LOGOTOFF2BFD_RELOC_860_LOGOTOFF3BFD_RELOC_860_LOPCBFD_RELOC_860_HIGHADJBFD_RELOC_860_HAGOTBFD_RELOC_860_HAGOTOFFBFD_RELOC_860_HAPCBFD_RELOC_860_HIGHBFD_RELOC_860_HIGOTBFD_RELOC_860_HIGOTOFF@@overflow: BFD_RELOC_UNUSED@@reloc.ccoff-Intel-littlecoff-Intel-big*COM**UND**ABS**IND*section.c.%d%08lx %c%c%c%c%c%c%c*DEBUG*.bsszerovars.datavars.rdata.rodata.sbss.scommon.sdata.textcode.drectve.idata.edata.pdata.debug.stab.stabstrbfdUnsupported .stab relocationhppa*-*-bsd*hppa*-*-hpux*hppa*-*-hiux*hppa*-*-mpeix*hppa*-*-osf*GNUTARGETdefaulthash.c          .122 ,|,|.(22,01-T//++d4l/$45.4.__wrap___real_linker.cCOMMONGLOBAL_bfd%s: indirect symbol `%s' to `%s' is a loopAttempt to do relocateable link with %s input and %s output0123456789ABCDEFR@T TTPT(R@T R@TUUH\%03obfd%s:%d: Unexpected character `%s' in S-record file .sec%dsrec.c$$ %s %08lx %s $%s $$ %s %-5s %s.data_binary_%s_%sbfdWarning: Writing section `%s' to huge (ie negative) file offset 0x%lx.0123456789ABCDEF\8t8\\\\\\\\\\8\\\\Lt\\\\\\\\\\\$L\L\\\\\\\\\\L\\\\`tekhex.c$%0781010 %s %-5s %s0123456789ABCDEF\%03obfd%s:%d: unexpected character `%s' in Intel Hex file %s:%d: bad checksum in Intel Hex file (expected %u, found %u).sec%d%s:%d: bad extended address record length in Intel Hex file%s:%d: bad extended start address length in Intel Hex file%s:%d: bad extended linear address record length in Intel Hex file%s:%d: bad extended linear start address length in Intel Hex file%s:%d: unrecognized ihex type %u in Intel Hex file ihex.c%s: internal error in ihex_read_section%s: bad section length in ihex_read_section%08lx%s: address 0x%s out of range for Intex Hex file?UUUUU\ ?UUUUU\?UUUUU\.stabstrstabs.c  ,8DP\ht(4@LXdp|GSYMFNAMEFUNSTSYMLCSYMMAINROSYMPCNSYMSNOMAPOBJOPTRSYMM2CSLINEDSLINEBSLINEDEFDFLINEEHDECLCATCHSSYMENDMSOALIASLSYMBINCLSOLPSYMEINCLENTRYLBRACEXCLSCOPERBRACBCOMMECOMMECOMLWITHNBTEXTNBDATANBBSSNBSTSNBLCSLENGSETASETTSETDSETBSETVINDRWARNING?k朕y?k朕y8X8x 8Ph<Tl8X8$Tt??ədwarf2.c.debug_abbrevbfdDwarf Error: Can't find .debug_abbrev section.Dwarf Error: Abbrev offset (%u) greater than or equal to abbrev size (%u).Dwarf Error: Invalid or unhandled FORM value: %d.Dwarf Error: mangled line number section (bad file number)..debug_lineDwarf Error: Can't find .debug_line section.Dwarf Error: Line offset (%u) greater than or equal to line size (%u).Dwarf Error: mangled line number section.Dwarf Error: Could not find abbrev number %d.Dwarf Error: found dwarf version '%hu', this reader only handles version 2 information.Dwarf Error: found address size '%u', this reader can not handle sizes greater than '%u'.Dwarf Error: found address size '%u', this reader can only handle address sizes '2', '4' and '8'.Dwarf Error: Bad abbrev number: %d..debug_info.gnu.linkonce.wi..gnu.linkonce.wi.ǜ8D(0Xdlǀ (l0(0(000000ǼǼ0ǼǼ00000  D$ǠǸdxȔȨ@ABCDEFGHIJK`׸פא\ߴ\\\\,,,,,,,,,,,,,,,,,,`t`t`````````````````````````````````````````````````````````````````````````````t``````````````````````````````````````````````````````t```LLLd``LL```LLL$$$$```````8``````LL?UUUUU\??UUUUU\?libhppa.hLD1+4*=LD8k>k>k>k>k>k? 7D7&444444x7>4_@K?4x#*)=49P4_7?UK? 2#r7?U4_4K?#B*H)Hi 47?A_M4K?I4#7C>4^ J4@ HG844^_-7>K? `@HK]( B4_7>K?"7`!Z4C>4 F6"@C>4b"C>4^("@*`H=K" C> \"P@_57>K?77 4_5K?!74e444_%4K?  4z z4x_7>K?" f e_@K? :`4|_e@K? `x4|_4K?@_m4K?`(4|_E4K?`4|_4K?`4|_@K?`4|_4K?HDX44_7>K? p@HG844^_]7>K? 0@HG44@_7>K? H F444_5K?=E7`X4|4z z7>_4K?Ht 4|K>YK>K>K>K>K>K>@O>@@@K?@ @JuXJs` k?JuhJsp k?JuxJs k?JuJs k?JuJs k?JuJs k?k?ok?7Ck?_k?K?!7K?4_4zK?`ȀRHxK4zI7K?k?0Ȁ _e4zK? 07K?_e4zK?Ȁ4_m4zK?hxK?4z4hK _MK?K? B4_4zK?K?_4zK?44K?YK?@O?@P@K?@ @JuJs k?k?7k?K_K _KK?K?Y@7?@ @K?@ @k?7k?K_` JKWh :KXK7K?K?Y@7?_ 4K?ˀK?Y@ @K?@ @k?7 k?KVHJK=KK4x RX7  _@K?K?Y@7?@@K?@ @JuJs k?JuJs k?JuJs k?k?ok? k?k?Ԡ7CKD447?q4w_@K?":(494_7?qK? 8@(497?q_M4K?"4H_ %4zK?"h|4Hx4zHuHtH}k(Hyk @HvJ 7K?!(@HbHV4z7K?!:He؀ z4_E4zK? P7h 4_=4K? HHw!@H|K>K?K? @O?_%@K? ˀK>Hy_-4zK?_hdK? ˀeK>Hy_4zK?_hdK? rˀK>_4K?/ˀK>ˀK>_u4K?=@_M4K?e@_4K?Hy_4zK?hd_4K?ˀK>JuJs k?k?ok? k?k?k?!k?)7Ck?KHIHd7K?!H7K&_4zK?4z_4K?!7444_ M4wK?!ZHuJ47K?Ӕh  4?  4 % 7_54zK? !7ˀhK>ˀXK>ˀHK>_4K?4z_]4K?4K>K?)K?!K?K?K? @O?_ @K??4z_4K?U4zH  4HxK457K?  H4K7K? H 4e4_%4zK?RA4! <  4hgU4JuJs k?JuJs  k?Ju(Js0 k?JuJs k?k?ok>k>k>k>k>k>k>k>7Ck?KWJHd7K?# 7K)_%4zK?447?q_4wK?"*`H*7?q_%IEK? 7H?? 7_ 4zK? ZHwJ @@_7?qK? IE76? ( 7_4zK? !74z_4K? I  745:4_-4wK? :45z5_4wK?!X@_@K?! 4z_ 59K?H_ 4zK?4K>YK>K>K>K>K>K>K>K>@O>_@K? ˀK>YˀuK>Y_4K?ˀEK>Y_4K?4z x4 ' 4 7K? K5z4_M \K?7 ?5J `4z4_ 5h K?RA4! < 4zhh_ 59K?H4_ %4zK?HK4z7K? 7K?C4^ JC0@K&0@H4z@T 0@ _ 4zK?ς K>Y@ @K?@ @k?ok? k?Ԁ7C44 7?q4w_@K?!j4 !j4?4_ m4zK?!J(49X4 _7?qK?! @(494 _U7?qK? @(494 _7?qK? (@_4zK?K>(497?q_4 K? rςHh`ς@K>ˀ0K>ˀ K>_4zK?K>K? @O?_14K?ˀK>@ @K?@ @k?ok>k>k>k>k>k?Ԡ7CKD44 7?14w_ @K?"4 "4?4_4zK?"r(494 _7?1K?"H@(494 _7?1K?"@(497?1_A4 K?""HK4z 7K?!7H_4zK?"7H44_i4wK?H!HaH64 7K?h H6? ֋V: H|44 K }7K?H   _4zK? !p7ˀPK>Yς@K>Yˀ0K>Yˀ K>Y_4zK?K>YK>K>K>K>K>@O>ςh`ˀK>Y_4K?4z_4K?4z_4K?ˀEK>Y_1@K??4z_i4K?m4zH  4HxK45u7K?  H4K57K? H 4e4_4zK?RG4   4hx4@ @K?@ @k?ok? k?Ԁ7C4KYK9_%@K?44 7?a4w_@K?4 $r4?4_4zK?$(494 _7?aK? 8@(497?a_4 K?$HwJ4z7K?$p7H_14zK?Hxk(HbHZ(@#@H4_4wK?H#*HaH9( ?z ?P6?44^C5 :C6?0^4Ӡ4 C4 88__79a C$ :C5?0^4@4 Y  @C" 8879C!4 :C4?0^4Ѐ4 Y  C5 8879C< :C=?0^4@4 Y C4 8879C6 :C:?A0^4 4 Y C= 88~=79_A4zK?HuHcHdRT6ր   x4K>K? @O?_A@K? @H|K(_I4zK?Hvj(4z_4K?ˀ]K>ˀMK>Hyς-k (ˀ%K>_ 4K?EH|JuhJsp k?k?o7#k?4^_4zK? 7K?Y4|@O?@P@K?@ @Ju8Js@ k?k?7k?ր7?74*4577_]@K?K?Y@7?@ @K?@ @k?7k?נ7+447874_@K?K?Y@7?@@K?@ @Ju8Js@ k?JuHJsP k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?7F67#74 K_G4KJЀ !4 IY_]5ZK?$7_5K?7Hp ޿4*5 ` 5)IJI]K55_ 5K? "lI_C2  b55_A5K?8 lIUB2 IJȉ@>IY #R4_159K?#8  HЀ"H)4(4 ^4 4 @H_M4K?"7_5K?7HKM5_=4K? ` ` '` JH5B2 5H_ K?5 @ _P4_?B 0_6`z 60 00@065 ` 4HȈ=H4K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?ˀK>ς}K>ˀmK>ˀ]K>JuhJsp k?JuJs k?JuJs k?Ju8Js@ k?JuJs  k?Ju(Js0 k?k?ok> k>k>k?``7D 7:KpƜK_e7>K?_}@K?_k?IK?k?Q4Hg>Hk>4_4K? 7ȀP4_E7>K??4_i4K?44K=K>K>K> @O>44@4x_4K?4tk>)(|49 (_4K?(|K>49_4 K?(|49k>!K?I_U48K?K?QK>!4D_%4@K?(|G>49_4PK?(|K>49_4`K?4t4 P6?B0_6`z 60 00@06(|K>)49 (_4K?K> 5 @ @K?@ @k?74_uk?K?0ˀKK?Y@7?@ @K?@ @k?ok? k?k?7D7#k?K_ "^m4K?ϟK>K4 44_7?K?h|@K?8ϟ248k?!4_7?K?h|K?K?! 78ϟ4Dk?)4_97?K?h|K?K?) _8ϟ4Pk?17?^4K? |PK?K?1 (H (J (hv(K>K?K?K? @O?@@K?@ @JuHJsP k?JuXJs` k?k?ok? k?k?k?!k?7D7KWK_pƿ@F4_ 4K? 7_)4K?(74z4_4K? *4 HB2g K>K?!K?K?K? @O?4_%4xK?K>(k?144:P_ 4 6K?@ @K?@ @k?ok? k?k?k?!7&7Ek?74^_ 4K?H 7G4_14K?7h44^4zK?XHXC2d X7K>K?!K?K?K? @O?@ @K?@ @k?ok? k?k?k?!7'7Dk?74^_ E4K?H 7F4_4K?`074z4^4K?4z4^4K?4? 4\ R4? 4? 4?04 04` H` @2f ` K>K?!K?K?K? @O?@@K?@ @JuhJsp k?JuxJs k?JuJs k?k?o7?(a4>hdhehfhg hh(hi0hj8hk@hlHhmPhnXho`hphk?Ԁ7E4+4'h >h >h >KIЁ !KHI?h 0,I= rI94_58K?,i<HK64I9Ky7K? *4_!5:K? 4I)ȉ ?I?hHJ4>4>4>47K?+44_4K?+(4:44_4K?+z 0"H>_4K?+JH>р'R44? 4x4 x_M5ZK?H>_5ZK?H>(7X49_4?iK?(4?}4_ 49K?+4??CC?C?4@C?C?͑`0c?C?ϐ 0c?C?ѓ0c?C?Ӓ0c?C?Ւ0c?C?ג0c?C?ٓ0c?C?ۓ@0c?C?ݓ 0c?C?ߓ0c? 0c? 0c? 0c?00`0@0 0 0 0 000@0 00 0 0 000`0@0 00 0 000000C 0c C"0c"C$`0c$C&@0C( 0c(C*0c*C,0c,C.0c.C00c0C20c2C4@0c4 0C6 0c60C8@0c&C:@0c:0c8C<0c<7x5Z44x_4K?$@H>H>4_u4K?H>ы$B :(4:44_4K?$HЀ !@*H*H(4+4 xբI?K44xK_4K?#44^5:K?#b 5i@ ͨ54?465^57K?""645_4K?" ?_5I.I 25z44_M4K?"I)ȉ >oI? 0*H&4?HK4m7K? j(4:(49_4 K?H77K?_]@4Hb?HphHo`HnXHmPHlHHk@Hj8Hi0Hh(Hg HfHeHd4~@O?^ @K? ˀUHb?^4K?ˀ-Hb?ˀHb?ˀ Hb?ˀHb?ˀHb?ˀHb?ˀHb?ˀHb?ˀHb?ˀHb?^4K?ˀmHb?ˀ]Hb?@@K?@ @JuJs k?JuJs k?JuHJsP k?JuJs k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yk?``7C444 444  79x!#A 9 k>_-@K?%74^4zK?$7HЀ ){4+K_5yK? JHpJȃ 0hK_5yK??HpHkЁ`#Z*H,4^5zK?#@IbpbIoI5z7K?c7 "r`J`_4K?_m5K?5#H7ImI5z47K?ca@ V 4 KW@(K_ __ K R!J : J J U _5K?"B7 J ^ RK?74^4zK?  !614z^69K?    K:@!z J4_5K?  )  ^U5InI05z7K? Ikȉ`<4k?H|4z5K>K47K?`7_4K? @_5K? 4z^ 4K?4`@_E4K? @_5K? 4z^ 4K?44K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>@ @K?@ @k?ok=k=k=k=k=k=k=k=k=k=k=k?ԀK=67C7ҧ KZHi  7 7>5J_@K?44x4 x7>1_@K?(49 (7>1_@K?K>H7xk0H(4. 840k8Hb7>Q5HX0_a@K?_@K?7>i57_@K?_@K?7>u57_@K?(49 7>5_@K?(49x7>4_y@K?4@7>kB?B?ɑ0b?B?ː 0b?B?͓0b?B?ϒ0b?B?ђ0b?B?Ӓ0b?B?Փ0b?B?ד@0b?B?ٓ 0b?B?ۓ0b?B?ݑ0b?B?ߑ0b?@0b? 00000 0 @0  00 00@0 000000@0 00 0 0 @0 000000@0B 0B"0b B$0b"B&0b$B(@0b&B* 0b(B,0b*B.0b,B00b.B20b0B40b2B6@0b4B8 0b6B:0b80b:B<@0b<6x7>144x4w_A@K?#x@HwJ5z7>!7K?447>!_4wK?#!04 4 ? RI6J7x* I)RT6ր ?X HnI7? 7K?HmI5Z7?u7K?7?44_4wK?!5ke5HzKV57>!7K?7>!44_4wK?! 4 I ^K:K? 7K458_4wK?!5  I :(4: H4w4_94K? 4K=YK=K=K=K=K=K=K=K=K=K=K=@O=ˀK=Yˀ}K=YˀmK=Yˀ]K=YˀMK=Yˀ=K=Y@@K?@ @JuJs k?JuJs k?JuxJs k?k?ok> k?``7D_-@K?7>Q4_5@K?"zHK>K0B6xk044_ 7?AK?H({HX049 _7?AK?7?K4@0 0@0 0@0000 0 @0  0 0H407j8H44J8^4K? 7?A44_4K? 4K=K> @O>({4: p({49 _4 K?_7K?ςK=ς}K=({4: p({49 p_Q4 K?_7K?ςK=@P@K?@ @JuJs k?k?ok>k>k>k>k>k>k>k>k?ԀK>67C7?7 6U G@5J4 _ 7H4 x4x7?_y@K?4^c?(497?q5X_I@K?4_Q@K?(497?17^@K?4(4* H7?I5Y^@K?47?U5Y^@K?4(49 X7?a^M@K?(497?4_)@K?4@7?KB?B?ɑ`0b?B?ː 0b?B?͓0b?B?ϒ0b?B?ђ0b?B?Ӓ0b?B?Փ0b?B?ד@0b?B?ٓ 0b?B?ۓ0b?B?ݑ`0b?B?ߑ@0b?@0b? 00000 0 @0  0 0 `0@0@0 000000@0 0 0 `0 @0 @0 000000@0B 0B"0b B$`0b"B&@0b$B(@0b&B* 0b(B,0b*B.0b,B00b.B20b0B40b2B6@0b4B8 0b6B:0b8@0b:B<0b<6x7?44x4w_ @K?"z4z_=4K?HjБ@ 04 ) K K* b ) W 4K4z_5K?5)%5k `*?4zI]K6x IJRZ7Z@ _@  % @ 4 I ^JK? 7K458_ 14wK? 5  I :(4:4w4_ 4K? z4K>YK>K>K>K>K>K>K>K>@O>ˀK>YˀK>YˀK>Y@ @K?@ @K_@K0@ @K?@ @k?ok?*`H?k?K xk?7` JHvPK?4z7K? 2HcX`?HvP `?444|K?YK?@O?@ @K?@ @k?o*`H#k?Hw H44x @JX?7?77_ K?0ˀrH X74x *K06KX?@?7K?Y@O?@ @K?@ @k?7k?K\K K97<K?Y@7?K7?K?YKH717K?K?Y@ @K?@ @@kY@ @K?@ @k?7*`H7k?J r6 JK= "K   K@ zKX?@?6*H6kV]m4K?K?Y4@7?k_K?Y4@7?@ @K?@ @K_@K@ @K?@ @K_@K @ @K?@ @K_@K@ @K?@ @K_@K@ @K?@ @K_K77\ (ˀ*K K7 @ 7<@@@K?@ @JuxJs k?JuJs k?JuJs k?k?ok? k?k?k?!k?Ԁ7C7%KY(4_@K? @Hz@@#0@Hy0_4K?#@Hz0_4tK? 7^iHz(K?Hy(74_7K? B 4t]" Hy0_7ZK?"R p@Hy0 &4_4K? 2Hw0 7_e K?"@ hHw(Bә J8 B4@ 6Bҙ ?@0t4@!hH|@]@K? p@H  V   6?!h4 <? (4?444 !8  HZW_7XˀpK>ς`K>ςPK>ς@K>_]Hy0K?=u@ׂ4K>K?!K?K?K? @O?*`H'H>=4 =]@K?H @@@@@@@@@@@@@@@@@@@@p@@@@@@P@@@h@@@@@@@@@@@@@@@p@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@H}€4ƀ4Ȁ4ʀ4̀4΀p4Ѐ`4ҀP4Ԁ@4ր04؀ 4H}44pH} ˀ K>44@4(484Z484`48u4z48]4Hv (4UK>@ @K?@ @@K\@ @K?@ @*`H?K r7 JK "K 8 J K@ 2KX?@?74@@P@K?@ @JuJs k?k?ok?``_@K? K0({4< 8K?Y@O?@@K?@ @JuJs k?JuJs k?k?7k?^ yk?K?k?_]K?K?K?_m7K?K?Y@7?@ @K?@ @k?7_k?K? 2KR_7K?Y@7?K?Y4@7?@ @K?@ @*`H?@K@ @K?@ @*`H?@k@P@K?@ @JuJs k?k?7k?B x@ 4$ h4$*H? *4: ^4 K?K?Y@7?*H9H_ K:K?K?Y@@K?@ @JuJs k?JuJs k?k?ok?k?Ԁ7C]@K? ` @x ]@K?_ 7K?*`H?(49 7@7_4xK?K?YK?@O?_i4zK?K?Y] @K?_M7K?*`H7(49 6@_=7K?EK?Y@P@K?@ @JuJs k?k?ok?``k?1k?)*`4?*`k?!Kk?9JH97:@ 0k?({_49 K?(K?9({_49 K?K?9K?_7?9K?({K?_49 K?K?Y@O?@ @K?@ @*H?K@k@ @K?@ @*`H?@k@ @K?@ @*H?@K@ @K?@ @k?7k?K_` "]4K?ϟ0K?YKWJ@7K?K?Y@7?@ @K?@ @k?7k?K_` "]4K?ϟ0K?YK]KH57K?K?Y@7?@ @K?@ @k8p@k7x@ @K?@ @k?7k?K_` h@K_h 0jkYpKWJ Y zK?Y4@7?]4K?ˀ(K?Y]e4K?K?Y4@7?]-4K?ˀK?Y@ @K?@ @k?7k?k?k?*4:*49@4 ^ @K?*H8K7K?K?7K?K?Y@7?@P@K?@ @JuJs k?k?ok? k?k?``7k?!k?)(z 4:(z498^ M4 K?*H%H7K?!K?)4=7K?x(z(z49^ 4 K?*H%H7K?!K?)7K?(z4:(z49^ E4 K?H7]7K?_4K?K>K?K? @O?@ @K?@ @k?7k?K_K *KK@C<K?Y@7?] 4K?ϟK?Y@ @K?@ @k?7k?K_K *KC`<K?Y@7?]Q4K?ϟK?Y@ @K?@ @kY@4@@K?@ @JuJs  k?JuXJs` k?Ju(Js0 k?k?o7Ck?KWH H|PK>Y@O>*H88K K_4zK?7_@K?7>_7K? ˀUK>YK? hP-K? @ @K?@ @k?7k?K_pƟ"KXKK>Y@7>*H78J K_@K?7_@K?7>_7K? ˀUK>Y=K>@ @K?@ @K_` KWJ  "@4KY@K<(KX@K@ @K?@ @K_` JKWJ KZ@kY(0 KX0 k@@ @K?@ @K_` KWJ  "@4KY@K< KX@K@ @K?@ @K_` JKWJ KZ@kY 0 KX0 k@@P@K?@ @Ju8Js@ k?k?7_k?K?K?Y@7?@ @K?@ @k?7k?K "K J07_@7_K?k?KK?k?Kp7K?K?Y@7?@ @K?@ @k?ok? k?k?k?!k?)7C7'k?KA76H"J B4K>K?)K?!K?K?K? @O?K>y4? 78] 4zK? 7ˀuK> @   K>  K> K> h(K>֜  (` K>q ]i40K?HfHx 4xKK?@ς]*H?8K kZ08kZ(kW0KK(kW(j0KY0k:(@kK_0KW(*j0KX(KY0k8(H?8KT K]0k 8k@JuXJs` k?k?o*H98k?K? "44K?Y@O?K(Hx * x@Hc(Hw?@`?4_ HzK?h|8@X4zK?UK?Y`=4JuJs k?k?ok?7Dk?_KZK? r4_4K? *`H?x4|K6?kK?YK?@O?]i4K?m4@P@K?@ @Ju(Js0 k?k?ok?k?7CKX *`H$xH`(@_@K? @_4zK?H7:h4K?YK?@O?*k?4:_4K?%*`ˀK?Y@ @K?@ @k?7k?K_ :KWpƗ@*_@K?K?Y@7?ςK?Y@@K?@ @JuJs k?JuxJs k?Ju8Js@ k?k?ok>k?Ԁ7C*`H?x4YKT`_]@K?!RHh7?J  (Hz_49K? |^7>K? *K> @_uHzK?(Hz_49 K? |4ht@Hu (@_54zK? @H|K>YK>@O>ˀK>YHw@>Hz(_U49K??E |(Hz_49 K? |ˀMK>Y@@K?@ @JuHJsP k?JuJs k?k?ok?7CK_pƟA@H 7H} j*H48Jz *_}4zK?_4zK?H|K?Y@O?_4zK? @HzHy8_4K??@ˀK?Y*k?44: ^ 4K?Hˀ-K?YJuXJs` k?JuhJsp k?k?ok? k?k?k?!7D7#k?K]74KJ!J@g4^!24y4] 7?qK?c?7?7?q] 4K?K?C70`@_u4K?!(@ ]k?1K?7]4K? 7K?1]M4K?p4 Z4]4K? 744^!4yK? 4_4K? h7ˀ(K>ˀK>׀4K>K?!K?K?K? @O?Hxh044H}h84xHt hHHu(hHv0hH|@hxHKJ17K?Hy8h44yHaHh44h hHHDH7K?h ӀޟhH|@ @H _h Hb(@ H ??@ h ςK>k?ok>k>k>k>k>k>k>k>77Ck?D,7$6KEpKFD,BD,ǽD,ǚD,C H hv4z4H Hbp_ hbp K h|Ha0h`H5J7K?"p7HaH87>7`&4zK `'8G'F]5yK?!745Z5x]4wK?|!@H|K4z4K7K?!j 44 HtJ j 7?9J4z7K?47?94z_U4K? i wHtH|4hwpHkp?hkpHjp__hjpHip?hipHhphhpˀ@K>Y4z] a5K?hep4hfK>YK>K>K>K>K>K>K>K>@O>@ @K?@ @k?ok;k;7Ck?KDHK=Xk;K%P]4K?"`7444]4wK?!HvJ4z4J7;I7K?4z] 4K?HbHX4z7;K7K?!G=G< k;K;]q4zK?!7G=44]4wK?G=!RHuJ7=)4zK4 7K?G= )4K;4z_7;K?K;YK;K;@O;]@K? ˀK;YˀK;Y\4K?@\4K?ˀUK;YˀEK;Yˀ5K;Y@ @K?@ @? `K\ j= z *KЃ (@K?@*H<@*@H<*@H<*@H<@ @K?@ @k?o7Ck?KWJK 7K?0ϟHx7 K?Y@O?@ @K?@ @k?ok?7C7$k?KTJK 7K?0ϟH|H7? K!?P4?? 6H4?_7?`Z  6H4VH 6H4 6H4  H|K?YK?@O?@ @K?@ @k?ok? k?7#7_7K8 @Hx z`KK< @_7K? Ht 4K>K? @O?44y\U4K? k?*4: k?!_}4 K? K?ȀU4@ @K?@ @k?/,ok?k?!k?)k?1k?9k?Ak?Ik?Qk?YK>7$7Fk?K?764 4K #zHI<7xKx h& 4x%@7?9G%aD^ aK? 7Hx""5 H4]I4K?!@Hx5Z59\=4K?4x'@7?Hx9G&DK?YK?QK?IK?AK?9K?1K?)K?!K?O?@/0,K> y}4|Hx\54zK?E4|H@ @K?@ @k?7k? 7]4KX HKW JJ?_ 7K>@7? 2+:J!0@J?@?KK<KH:@ H K:8 K= K KXJ4\7jKV J7Z K5 JX7K6k@?7Z?67k?4:H4k? k?k?_ k?!K?K?!K?K?K? ]K?@ @K?@ @K?K7<J  K04@ˀ@k?ok?k?7$7K? K @@Hߟ*H9?  `X `!@KXH" bXH KPH  KWJ h@@w$H 4( `JXXK8 `XH tH }K?YK?@O?K0 hu*4:H_a4K?4? yXHu z@P@K?@ @JuxJs k?k?ok? k?k?k?!k?)k?1k?97(7Dk?KE4 ]KGK?440ˀh"p4*H?4a4? K]ƽ@:KT 8@J @"}@  779 K]ƽ@8@KT 2J @"}@  779 K]ƽ@8@KT 2J @"}@  779 K]ƽ@@@KT 8@J @"}@  7^5797 K]ƽ@2KT 2J @"}@  779"`4*H?4a4? K]ƽ@BKT 2J @}@  779 K]ƽ@H@KT 2J @}@  779 K]ƽ@H@KT 2J @}@  779 K]ƽ@H@KT 2J @}@  7^E797 K]ƽ@BKT 2J @}@  779H R_7 !4P4?*H?47@JƵ@ J ""7?_7ZaZ 67KHƨ@2KV 8: 879KGƧ@2KU 8: 879KBƢ@2KT 8: 879KAơ@"K] :779~7 H4!B4  _4K?  iG( 7K*0 A\4< 2 85F75X_4K?AA64"`P45WAX6774c6@@4c4>  H4K>K?9K?1K?)K?!K?K?K? @O?@P@K?@ @JuJs k?k?ok? k?k?k?!k?7CK_"KD*k?9 _E4zK?"87H0""@0@H @ Jh @ǕH}K64 '@' 7?Q4?H KX4zK8G'F _-h K?h HLJb4@6a4H"*@ JA*J  Kj ӀӀJӀ ӀӀ@676@=4K>K?!K?K?K? @O?K?97_4K?m4JuJs k?JuJs k?k?ok>k>k>k>k>k>k>k>k?7(7F76K) (4) \M5:K?@w44Ί 7@u6AR @HHII+`$zHH?4y4K=7K?$jK>HI8KЈ 0K(49 _4K? <\ e4K?k>ٌ!(H47?K`5Z5ye7K? k?HI I_"zH `6 zH7= HI4zPJ"JĢJHh`P5G4hgXH? p 47?Kx5Z5y =7K?k?K>45xI9_5HK? Bk?H % 4I9_IK? *(44:]4K?K>4\m4K?!H `  E  xHW  K>YK>K>K>K>K>K>K>K>@O>(494z])4K?H59]4K?EK>Y59]4K? ĨK>YI4z]y4K?K>YH `5&4 fH u (k>44:]4 K?Hk?ok>k>k>k>k>k>k>k>47k?G07G7$k>C46 C6HhHǙ`*H)H *#:4?d(K>k?44K> k?4_MK>K?HJ4H)h\}59K?#07HJ44K 5XU7K?45Z58]4K?"4\u5YK?@6aRHJ4Kp\ 59K?"X7@6 4 k?H֋ k?J7P4k?K>5K7K?45Z58]A4K?!@@65k7k?4\ 5YK?Hfh(44He  gK>YK>K>K>K>K>K>K>K>@O>*H"H _ 4?d(*H+ (KX (K] 8d( (d(EK>ˀ K>YˀK>YˀK>YˀK>Yk?ok? k?k?נg?ig?e7#7Dk?!6*H8K? !g?aHzk?YǚA*KXJg?aHx KPHu k?YHK "Hw JXK0 k?Y4_U4yK? @KH_pg?eg?iHj4c?mK Hzg?aHyk?Y+49ς y2HJ 4c?m4c?mk?K>4y4k?K>7?9k?K?!_Uc?oK?K>K?K? @O?k?77k?K48!xK80K5@!bK! H"@!JKC6 K< KXJk`4 h46K6 JX7K0JP  ?64k4@KU7?!J4='K6 JXH"&8G&F h"k?K>7k?K>_=k?K?K>@7?@ @K?@ @k?ok>k>k>k>k>k>k>k>k>k?``7DKEk? k>k>k>KHI IL bH R\ HK?K>7 Y k>H?@HHY4\4K?$k? H 47>7> 4_5YK? 7K+0 $k?7? 7>k?4_5YK?$*4ſ]4HK? j(K>%xHK77?A7K?7?A44]4K?#HHI+ H r\uHK?:7H44]!4K?#ZH?@H!H4(y4(4 \IZK?74_5YK? 7I0"HJHW04(@HJH?04@@IZ5j45X]4K?# 4ž4K> K> K`x@ԟ 4?נJx@ֿx@6?C(_ 7 7T? C(4?5BKH (@(y4:P^4 >K?4K>YK>K>K>K>K>K>K>K>K>@O>ˀK>YˀK>Y7? 7>k?_E4K?;4ˀ=K>Yˀ-K>YˀK>YHK64K 7K? M@I0C4)=HC6\HHKK *544 ]4K?HKVJˀ K>YK47? 7K?7?44]94K?<@ˀK>Y(y44:P]4 >K?@@ @K?@ @k?ok? k?k?k?!k?)7Ck?K_KI\4K?#7Hf"H"ZHHg4\4zK?"@H" 4K! H"XF!K:K\K7K?!744\E7?K?k?I4z7?k?Hu4JJ(i7K?444] 4wK?!@I 5k? 4z7?k?H}4KJ(7K?444] 4wK? @ ?M5  =4H=}@4z\4K?4K>K?)K?!K?K?K? @O?ˀK>ˀK>ˀK>ˀK>@ @K?@ @@K<8k?ok? k?k?k?!7$7GK>k?KYK:KVG0 8C4k?447K?!"0!4΂!HK@t@KHF(02 04Ȁ 4ʈ :H(`*@|ן`| hy(H@*@v`v  zK>K?!K?K?K? @O?k?ok? k?k?k?``k?!(y49_@K?!7@(:A@HHK?!\9@K?!7\ K?!K?k?)H4\ )K?!K? @@(8AP@HHK?!4\4K?@(?AH7HH 0@K?!K?)\ y4K? 44K>K?K?K? @O?[4K?Ƞ4(y44:])4 K?K?!-4ȠU4(y44:\4 K?"K?!(y44:\4 K?➅@k?ok?k?7$4@(k?  4c_@\i4yK? 8744K?YK?K?@O?44\4xK? @ @K?@ @k?ok? k?7Ck?K_Kp!*H}K6h7(&'@7?A8G&F]14K?2D HyK94\ 4zK? 444[4wK? `@H|kp4K>K?K? @O?ςK>ˀK>ـ @]4K?ˀK>@ @K?@ @k?ok? k?k?k?Ԁ7CKWJ!J!rH}K6h6('@' 7?A44z8G&F\ K?!447?[ 4wK?!(@[@K?4 4]i4K?2F4?k?)44[m4wK?K?)!rH8k[}4 K?444K>K?K?K? @O?HeH7?Y7K?7@(4: (49 \4 K?*H!H67Hy47K?[E4K?4]4K?4@ @K?@ @k?o7Ck?K_Kp@ 8@Kx "]9@K?HxkpHK@ 2K "] @K?Hyk K?Y4@O?@@K?@ @JuJs k?JuJs k?k?/,opk>k>k>k>k>k>k>k>k>k>k>k?Ԁ7E44K_K &K(4[]5K?2C%"HK:(׺ _}4K?$HK6h7?H4\(& 4i'HJpJh9G&D LRHH]584K5Y7K?A?64  5.k?H5)@59k?K K 4k?J5YE0A4)7K?k?544y_5K?A657k? K 5)@H4i_4K?"h 4i*`H*h4 A74w rA?6`bI,P " "^4K?"7I9XA86 ' X :I=#5,  47  7 @ z7  b7  J7  27  7 774\5K?"(745\ 5K?5?5\ 5K? -A86 I594K7K?": (@^4K?!7I5A86 0 <`4|`4|`4|`4|@zHH- b7?59P4&9G&E_K? <hA86HK59P4_H8K? <A8644|K>YK>K>K>K>K>K>K>K>K>K>K>O>@/0,I6=H *`A86`M4| @_ 4K?7I4  !A86XI 5@(A74Hj iRX7>HK(E>4|(k? 4:^I4vK?E4|@ @K?@ @k?7k?K_` *K7x6K?Y @7?[4K?K?Y4?@7?@ @K?@ @k?ok?7C4H\ak?K? 0744K?YK?@O?44H\4K?h h0h8h@ @ @K?@ @k?ok?7C4H\Yk?K? 0744K?YK?@O?4[4zK? h0Ȁ4h8*H?4h h@U @P@K?@ @JuJs k?k?ok?k?7D7%k?7:7_}7K?H0 JC:HK K RT6>ҖE vK?YK?K?@O?@ @K?@ @k?ok?7D7^k?K? K0 KKhzK hwK(hxK0hyh} K0B2HH RB4B>WE w4K?YK?@O?[4K?ˀK?Y@ @K?@ @k?ok?k?7D7k?^6K?!K0!@C6A%? KPKXh}K`hwKhhxKphyKxhz ht(CH9@@HJ Ha RE4>ТE bCHX:HK Hb RW6>E eCHw:HK Hx RZ7Z>UE u4K?YK?K?@O?[=4K?ˀK?Y@P@K?@ @JuJs k?k?ok>k>k>k>k>k>k>k>k>k>k?Ԁ7Fk>7 B$*(HxK>]M49K?K>YHg0&HJ   RW6>(He8K>49@]EK?@ H   R\7>ӟEk?D0(49Pk?@44 k?@6k?Htk?yD(јK>]D,K?@6!4 i g AtHIlP4 5m@ RL5>ьEk?(K>49]ek?K?HK45K>K4%7K? @@4_"*"Z#:k?(ExX49Ew\]K>K?AyHYJIh RK5k>(K>49@]ExEK?@65)Gi$RH(K49`]K>K?H$@(4$4H K04p K>]u K? ?4K>Y*`Hb0Hz8H?h@ 7 @ 07@K>(]49 K?K>Y(K>]49K?U@6D0 Ez\k?(49IxPEwX]5K>K?Ix` (@E|h Aal =@6Ablk?(49@Ewh]K>K?m@6HJ@y@D0JH <k?(4:(49\4 K?AmHIhM 7 RZ7Z>_Ek?I|`5k?IwX]K>K?U@67:_%4yK?Hmk?*`4"Hu0H_h P7`Hk8` p7k?Hv (JK>]49K?K>YK>K>K>K>K>K>K>K>K>K>@O>@ @K?@ @C?0\4C704@@@K?@ @JuJs  k?Ju Js  k?k?ok>k>k>k>k>k>k>k>k>k>k>k>K>7F7$k?K>7 7k?K> 7>6k?H5?4k?k?y_k?K?#JK>#Jk?H74k?y45Xk?4k?_Mk?K?"  ` HK " "I+ `"I9(Y K Kz4A|4 0@Aa64"բ j@K"IoH04?4 I? Ab65y@  ObE(ӹ`^4K? :A4!A66ז 꿗E(I? 4H4 # H4 "XKK  jK0"@KC46479@9 G(Ҷ C6]7@X C6@ G X@ HˀK>YςpK>Yς`K>YˀPK>Yˀ@K>Yˀ0K>YI? 5OOBI 2 ڠ"In I I?  Ix RW6>E@*ָ jAa4=Ab6H؃=4K(=4K 4K0 uK8mH2 I 5l? H5(U7 (0"  `  2H "4[14PK?h؀ "k k(Hak0k84K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>@ @K?@ @7KTJГ 0JXJP  067X'6`' 7?8G&F @7?@ @K?@ @k?ok? k?k?k?!7F7%k?^7K? 7H0!4@[54K? 744@\ 4K?d0*H7`4H Rd(Hh [ Y4K?ˀK>ˀK>K d(Hh KXJd(H KPH  h HJ0H 0H"X0HE0 0h HwJpd,hd0@c44K>K?!K?K?K? @O?@ @K?@ @k?7k?K_` "[ 4K?ˀ0K?YKWJ7K?K?Y@7?@ @K?@ @k?7k?K_` "[ 4K?ˀ0K?YKWJ7K?K?Y@7?@ @K?@ @k?7k?K_` JK7` :KXKY7K?K?Y@7?[ 4K?ˀK?Y@P@K?@ @Ju Js  k?k?74_k?K?K?Y@7?@ @K?@ @k?ok? k?k?k?!k?)k?1k?9k?Ak?I7D7)k?K_h74 #H`pp‹$:H X4*H*XIB4G\5 K?$7  gh`H  444[4K?#HH`64 7K?#p7$ *H<x#@*H!H7J!@*H)x*H*`64?! 44[4K?#0@[!4K?HH`774 I7K? ` K` ` IX74 5` K` ` 4  \4K?ςK>[ @K?!@ `>U5k?}@ "h`[4K? @\14K?ˀ(K>[A4K?4K>K?IK?AK?9K?1K?)K?!K?K?K? @O? ?84K>ˀ}K>ˀmK>ـ  \94K?ς5K>  h`\4K?[4K?ˀK>ˀK>  @h`[ i@K? @\i4K?ˀeK>[y4K?@ @K?@ @k?o7Ck?K_h 0P@H`pp* Z ?84K?Y@O?[4K?K?Y4@O?hy`Hw64z 7K?0h``K?Y@O?@ @K?@ @@p@p8FF jBJB **@4< X*@4< *@4< (*@4< 8*@4< H@ @K?@ @@@ @K?@ @k?74Zuk?K?K?Y4@7?@ @K?@ @@4@ @K?@ @k?74Zk?K?K?Y4@7?@ @K?@ @@4@ @K?@ @@4@ @K?@ @@4@ @K?@ @k?74Zuk?K?K?Y4?@7?@ @K?@ @@@ @K?@ @k?74Zk?K?K?Y4@7?@ @K?@ @k?74Z=k?K?K?Y4@7?@ @K?@ @k?74Zk?K?K?Y4@7?@ @K?@ @k?74Z=k?K?K?Y4@7?@P@K?@ @JuJs k?k?o7C_k?K?2_` K?Y7@O?k?Z=4 K?K?@P@K?@ @JuhJsp k?k?7 (k?_7:K? @_}@K?7 @K?Y7@7?k?Z4 K?K?@ @K?@ @k?ok?7D_k?K? 07` J44z[=4K?4|K?YK?@O?Z4 K?4|JuJs k?k?7 00k?_@K?K?Y@7?ˀK?Y@ @K?@ @k?ok? k?6k?Jpƕ k?Q7?AYHeXH8H'A'I8G'QFQ 2  4$ZU4 K?HH|8 4ZK?QK?He8 h84K>K?K? @O?7?A*H%8H''8G'F k?Y J]4zK?7K?QK?Y_E4K?PHv8K?Y7 Pha8>4H K]4zK?G_4 Z]@K?U4@ @K?@ @@@@@@P@K?@ @JuJs k?k?ok? k?6k?Jpk?A7?AYX'AƗA'I*H"88GH_7?A'F!KK?A4_4K?`7Hu8 hv8 :@*H!H48h7ZM4K?4K>K?K? @O?8G7?A'1FHeHx8H1  b 76 ?@2\ HK?  Ȁ% HHt8 4ZK?AK?He8 h8]94zK?K?A@P@K?@ @Ju (Js 0 k?k?ok?``k?7:7?_@K?7?K?44[@K? @K>@O?(xk?44: [m4K?K>@ @K?@ @k?o7Ck?KXpƘ H|8*H98K? K]4zK?7] @K?H Hwx  4<h|8K?Y@O?@P@K?@ @JuJs k?k?7k?K_pޟˀb*H78J K]@K?7_E@K?K?Y@7?@ @K?@ @k?7k?7_k?KXpƘ@j*H=8K J Z 4K?4?K?Y7@7?k?*4k?4:[4K?EK?]A7K?7@?E@]A@K?K?]Q7K?7k?Z 4K?K?@ @K?@ @k?ok? k?k?k?77C 7$!R0!HypƙAHu` *Hv0 H}8"z*H<8K"jK (4H Hwx ]4K?"X7*H$HHZ4zK?4,!@Z 4K? h*k?!4:]142K?Hyp4 Hfhd8(HHt8 hw86HHxh  67 `\qHK? `  ZM4 K?߀4hw8Z4 K?߀444] 4zK?\u@Z4 K?@4 Hz8 Dhd8 h84K>K?K?K? @O?@ @K?@ @C_CW @ \@ @K?@ @C_CW @ \@ @K?@ @C_CW_  Y @ @ @K?@ @C_CW_  Y @ @ @K?@ @:_@?@ @K?@ @:_@?@ @K?@ @CUC] = CXC_ 7T  \@ \@ @K?@ @C]CXֽ  _CYCW  Tח @ \@ @K?@ @CUC] = CXC_ 7Tט  W A @ @ @K?@ @C]CX  _CYCWי  T  A֢ @ @ @K?@ @k?7k?*4: 4,]@K?4K?Y@7?@ @K?@ @k?7k?*4: X4Z]Y@K?4K?Y@7?@ @K?@ @k?7k?*4: 4]@K?4K?Y@7?@ @K?@ @k?7k?*4: 4] @K?4K?Y@7?@ @K?@ @:W_7X?@8@ @K?@ @:W_7X?@8@ @K?@ @k?7k?*4:4 ]@K?K?Y@7?@ @K?@ @k?7k?*4:4 4]@K?K?Y@7?@ @K?@ @k?7k?֠77]7?RB4B@X!@RT6ҘAx4P7?4 XU6? ӽ讟_7Z(a  XT6?  =7T 4Z?ӽ Ӻ6 44? 7 7?Z ]9~6K>@7?k?*4k?!4:@4 Rk? k?[ k?K?K?K?K? K?@ @K?@ @k?7k?ր7=7_7R\7׀ @!RA4!84A4P7?=0 XT4T? ּ  \_7Z(a" 0 X]4]?  7Z6] X0T44? ֽ  ]7Z X0T7? ֝ 7Z ] X0T6? ׽  \9~7ZK>@7?k?*4k?!4:h4 k? [!k?K?K?K? K?@ @K?@ @k?oK?k?k?` k?K?Hw K94Z 7 K? K?K?4Z4xK? h@K?Y4@O?K?Y4@O?Z4K?ˀK?YˀK?Y@ @K?@ @k?7k?4*4: 4 "[ @K?K?Y@7?@ @K?@ @k?oK?k?k?` k?K?4Z K? bK?K?4[%4xK? *4K?Y@O?ςK?YˀK?Y@ @K?@ @_ 4?7@@ @K?@ @KWB004\C9 84@@ @K?@ @k?ok?7CK8KYK?K  K?Y4@O?* 84: *49 [a4 K?0**49 H[)4 K?*H:KV7Hy-7K?Z4K?ˀK?Y@@K?@ @Ju 8Js @ k?JuXJs` k?k?o4_}k?K? (744|K?Y@O?_]@K?h| h`h*H?h `h`8h`h``h`h`xh`@h`h`h` `h`p-h`HZ4 K?` 4|@P@K?@ @Ju HJs P k?k?o7C_k?K?Hx74kK?YkhHy k @O?@@K?@ @Ju XJs ` k?JuJs k?k?ok?7Dk?_k?K? 0744|K?YK?@O?K?_ 4yK? X@_HzK?[ 54zK?ZQ4K?`]4| d44z]yhhK??4|Z 4K?_eHzK?[4zK?`4|@@K?@ @Ju(Js0 k?JuJs  k?k?ok? k?k?k?Ԁ7Ek?!k?)4Z @K?44K?)_@K?!h7_@K?!P7K?!_}4yK?!2ĀB!!j(K?)_49K?0 |(44:[Y4K?H!bā e!0hwh hzh\4zK?!4 hx@`4|`4|Z 4K?_=HzK?[]4zK?`4|(K?)_49K? |(K?)_49K? |_HzK?[4zK?44|K>K?K?K? @O?4]hyh(44:[)4K?@_HzK?[4zK?`=4|@ @K?@ @k?ok? k?7C7k?_k?!K? 8744K>K?K? @O?K?!_4K? X@Z4K?_uHK?[4K?ȀU4 44hh\ K??4_HK?[ 4K?Ȁ4@ @K?@ @k?ok?7D4k?Zk?K?_@K? 0744|K?YK?@O?K?_4yK? @@_HzK?[4zK?`u4| d44z\-hhK??74|Z4K?_HzK?[54zK?`4|@@K?@ @Ju hJs p k?JuJs k?JuHJsP k?k?ok>7Ck?K_h 0BHuHw`64z y7K? :HaH6(4zA7K? 2Ԁ44K>YK>@O>_e4zK? 7Hvh @H|pHzZ7>K? @_4K?k>_ӚK?K>G>4 : THz_ҙK?_HzK?[14zK?4@ @K?@ @k?ok>7C_k?K? 7Hth HupHzZU7>K? @_4K?k>_mӚK?K>G>4  ]Hz_UӹK?_HzK?[4zK?4K>YK>@O>@P@K?@ @Ju xJs  k?k?ok?k?7D7%_k?K?2C`J d H 44z_5h`hK?4|K?YK?K?@O?@ @K?@ @k?o7Ck?KYh "Y 4K?ˀxK?Y[I4K? |74K?Y4Hwphwphxhh`8@O?@ @K?@ @k?o7Ck?KVh HtpƔHzHw`7Y4z7 )7K? ˀpK?YHuJ(4z7K? Bˀ(K?YYM4K?K?Y4@O?h`8*H=4h}44zh 4hxphhh``h`h`xh`@h`h`h` `h`Hh`h`h`Zh`K?K?Y4@O?@P@K?@ @JuJs  k?k?7k?_KZK? 7K?Y7@7?k?Y]4 K?K?@ @K?@ @k?ok?Z!k?K? (7K?4Z4zK?K?Y4|@O?@P@K?@ @JuJs k?k?7k?_KZK?K?Y@7?@ @K?@ @k?7k?K_ ʇ@* @ z@b J *44:Z4xK?K?Y@7?ςK?YτK?YψK?YˀK?YϐK?Y4 ψK?Y@ @K?@ @k?ok?נK?4!a@֟v@?6?!79?ֹ!ֿF YF ڇBZB!@ *+44:xZ=4>K?4|K?Y@O? ?x@@ ?4|x@   7(4u4| ?x@ 4=4|x@ ?4|x@4?  (44|@@K?@ @Ju Js  k?Ju Js  k?Ju Js  k?k?/,opk>k>k>k>k>k>k>k>k>k>k>k?K>7)7E7647:'@ 4_@K?4 7?I8*K H6I I$'9G'E 8`$2*H4 @I@ `04 H8 Zk?K>459k?54k?7K?#IN@_M4K?57I?rI K @H0 ` Rk?_4K?H0H7_HK?7HH(b@NHр n@@8)& @*#C""E2$z4 4|K>YK>K>K>K>K>K>K>K>K>K>K>O>@/0,I KXHH K,0KPH L  7 I: H W IBXH\0IAPH`   04,`= HH`! IXP  i+HK$! )K[ 49+8K? H)I[ 49+hK? @I! , H0IJPI, L `i?|4|d4| ,IHPI+ ui. ,eH0 HPL HX ,\ H Jh47K?HPӕHX H  Hx MMѺ47K?E4|H JP4Y7K?HPHX  H  I`Z47K?4|H KVP47K?HPHX < 5HH`  Z4A7K?4|H Kh47K?HPHX \ 6HHx  Z47K?54|)44:+(Z4dK?4|@ @K?@ @k?/,opk>k>k>k>k>k>k>k>k>k>k?@@K>7(7E76475& _@K?4 7?<I*JH<I I'!9G')E#)H8 bk?K>4k?55k?e7K?#H@IIv@:I K IHHKX KL0KPH  Y I" I|XH`K0IuP @0    IkP  iHK )XK[A49!xK? ZH)XJ[ 49!K? "I   L H0 H0 Rk?_E4K?H0H7_EHK?7HH(k@Hрx@@0 #@""*Aj! "4 4|K>YK>K>K>K>K>K>K>K>K>K>O>@/0,IPI `ei|]4|dM4|=IkP ImPI `i@HP҅ e HX    6U HH6h4%7K?HPHXӁ H Y IxA -ZZ47K?4|HHVP4m7K?HPHX  G HK`   _Z47K?U4|HKP47K?HPHX  H < : H` wZ4]7K?4|HI847K?HPHX< H   JH Z47K?4|@P@K?@ @Ju Js  k?k?7K?7k?KH ߨτKT K?K?  H\ KXJ0KPKV`5    48_ K?K?Y@7?@P@K?@ @Ju Js  k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Ԁ7H7%7 64 KUKLKI(`k5_@K? `7"҄Ā " *(44:'`Z%4 "K?0@j(44:'`Z4 >K?I0 4I?@տ5?շ!_ 4K?@I0IPֿ6?V!տ_M_& &"""# (44:'`Z4 .K?l@IP`IX4t@׺*     #X <H(44:'`ZE4 lK?4K>K?QK?IK?AK?9K?1K?)K?!K?K?K? @O?HH6h4z=7K?\I0HHVP4z7K?\}I0l@ ѹ@  "l@ =(4 -     i@Ѡ    74 "4l@l@ Ӏ i@    X V 4-l@l@`  *l@4?Ӏ Z(4 ӂ   i@    5 4 "4Ml@ Ā B *(44:'`Z4 PK?} hHIVx54y7K?=4HIv`54y 7K?4@ @K?@ @k?7k?K_KP U7K?K?Y@7?@P@K?@ @Ju Js  k?k?ok?``4? r_@K?K4 4@ 4 (x4:\ 4K?(x4:\ y4K?K?Y4@O?(x4:\ 14K?*`H4@K?Y6@O?k?4:\4K? (x@ @K?@ @4~ hˀ*`H?@ @@ @K?@ @@4@ @K?@ @@4@@K?@ @Ju Js  k?Ju Js  k?Ju Js  k?Ju Js  k?k?ok>k>k>k>k>k>k>k>k>k?``k>7$6K H44_@K?7D4Z5K?2G$bHHk?444_=4xK?$@HHh@44@(֟`(4_K>K?C4A@@H!(4)wK>4+7?ak?a " k?K>44xk?_4K?HXJpJx  Jx7jx B ! !45z+Z4K? (>5)"Z 4K?h4|K?a! J44k?H4K@K?a7K??G (k? 44JJ4k?KHJ0K9=7K?> (k? 4k?Kk?KKHKH68JK@K7K?> (rk?44k?4x_4K?g5z+\4vK?  @Z E4K?44|K>YK>K>K>K>K>K>K>K>K>@O>@ @K?@ @k?ok?KC` Hk?HzZ %K?K? @Hc`?@4K?Y4|@O?@ @K?@ @k?ok? k?k?k?!k?)k?``k?1k?977:Y ]@K?77Z@K?2EȠK?9Z4K? 4H# k?I7~`(xK?I4Z49K?K?1\ 4K??4 4K>K?)K?!K?K?K? @O?(xk?A44:Z4fK? (x@P@K?@ @Ju (Js 0 k?k?7k?k?\k?K? K?_}K?K?K?Y@7?@ @K?@ @k?ok?k?k?7C7&k?KW7D K_Y i4K?44K?YK?K?K?@O?H44 H4z4j HhHaH68 7K?!-  7K?74Y !4zK? 7Ƞ4 *`H7 4zJ7j Hv6h| h hh hhhxhhhhHbHV7K?>h4zY4K?Ƞ44Y4zK?Ƞ4@ @K?@ @k?ok? k?k?Ԡ7C7:k?!(490HdZ@K?!@@(K?!Z49K?! @(K?!ZU49 K?!@(K?!Z49@K?   H@HZK?!K? @H?@K?![4zK?K>K?K? @O?*H<*H<*H<*}H<ˀuK>@ @K?@ @k8 @4@ @K?@ @k?ok? k?k?k?``7Ek?!k?)4KF JK?)K?!447K?H?4H 0@K>K?K?K? @O?(xk?144: Z 4zK?K>@ @K?@ @k?7k?K_ *k8@K?Y4k8H@7?Y4K?ˀK?Y@ @K?@ @k?ok? k?k?k?!k?נ7$7C76K8 a@(9 ??@H@@HHK>砺 HhA @GY4K?4K>K?!K?K?K? @O?Y94K?ˀK>Y4K?ˀK>+44: XZ4>K?@4hzH 0@  4Y4K?k?H4z4K`447K? 4ςuh}ˀmK>@ @K?@ @k?7K?k?K= @J`zK4H Z J zς`K?Y74Y7K?ς(K?YX4K?4K?Y@7?@274Y}7K?ςK?Y:K<7 Y7K?ςmK?Yk?KVJ@y7K?-K?Y@ @K?@ @K?X K!4K K 4 7K?@K X@K BJ 06J!0@K ?7@ KKkK0kK(40@0KXp?@K *: KUX KZ@?@@ K?K>@@4KKK=7?@k4@ @K?@ @k?74k?K?  4K?Y@7?K9 ˀK?YK]K97K?K?Y@ @K?@ @k?7k?K_` P@K_h 0*kYK?Y4kX@7?X4K?ˀK?Y@ @K?@ @k?ok? k?Ԁ75k?K? K#(49 0JK0[ K? ([Y@K?(49(ߓ B4 | 4@|a 4@k?v 4@k?t_ 4@k? 4@ǃ 4b@ 4@cHk?4k?y[K?K?K>K? @O?# 4z@ 4@k?yk?o*`H#k?k?Hz@ bY@K?HyK?X7K? B4cHz@?@4~K?Y@O?@@ @K?@ @k?o7Ck?K_ K @*H9 @*H:!HwA!"*H= 4ƒ!_%KK?Ht"Ӝ4‚@ @׀Ӝp4H"4@K?Y(444K?Y@O?4~4~@ @K?@ @\04"\04 \04@@@K?@ @Ju 8Js @ k?Ju HJs P k?k?ok?7C7$_mk?K? _}ӚK?  0HzHx K0Hw  Hz K?YK?@O?@ @K?@ @k?ok? k?k?k?!7C7&k?K_76 4K4z 7K?@K4z47K?a @Z 4K?4?K>K?!K?K?K? @O?K4z17K?e@Z 7K??=7>HK4z47K?~@ 4 @ @K?@ @@K@P@K?@ @JuJs k?k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k?K=k>7D7)k>)k>14KLK=k>K= k> `K=k>! KI BHw+Hx*K>)He0K0K>14XX 4K?*7(49`\4K? |(49p\4K? |H 0 :KHk>94KHY94K? |K>9Y4K? |Hx 0 k?Hy4_4K?)K>9k?44Hy_HxK?)X@Hy_I4K?i87ZI5ZK?2H@)Hy45_A57K?hazI !j4 @5 IK(K(K(K (K( (KX(HH}IaJVP= 57K?IbHYItK5 JPK- J0It  HHy I|K` 7K? @`>5J @Z5K?h`(Hg 4 H44 H@!zHKVP47K?H!b@0Hb(4K@0hk(4 w 4 @ 8644Ht(6?,X4Hx RQ619 9 \ ݠ"7' I  ݨ77?? ςxK=Y7 Ha(4*hj(4 4 -@ Hh(5 hi(H(%7hg( J Y4K?%h| H(Hl4 4 Hh44 g4 4 4H4A4'%:)'2HwK>9  W HJ6P5 7K?\Ht( &HKP54u7K?Hv  <Hu LHt  HH}  +Hz k Hy j(50Y)5K?HzP `75X 4K? 2HuP Z4K? @HzP @Zq@K?Yi4K? Y6K?h|P*7Y 5K?HqP $ Y4K?HyPK>H( :Z 4tK? H(K> 4K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=ςmK=Yˀ]K=YK>ς= #ˀ5K=Yˀ%K=YˀK=YˀK=Y @YE5K?ˀK=Y(4:(49Y]4 K?*H:KV7e7K?X4K? @Y5K?ˀ K=YςK=YˀK=Y HHVP447K?Hr H &Hr Hq Hp j) Hy k@(50HI6P547K? A! 4 `4HbE 55A (`HJP77=7K?5+8 HKP57K? Ht(@ 5Hv oA @HIP4 Nm7K?Hx  Hr 4Hn Hm  Hz j Hb j@(Hx  U 4?HtHq  Ha  *`Ho  4Hn j 40Hr H7 k(Jhy(_ Hz K?K>K>)He0K0K>14= Ho8/4H04Hi@HgHHJP54 7K? B?6=@ Ht( X 45@HH 5iH8H9H4 4 4 444H4A? !!* ( 8!H85)44K> \4^@- 5@K>5H(HJVP5:e7K?ܡ @HHVP5:%7K?K>! HHVP5:H7K? ҠbHJh5: 7K?K>!\hi@hr8hgH he0Ҩ4@4 >?4 H8ˀK=Y@ @K?@ @K_K7 @4? 4@JuJs k?k?o*H?k?Kk?H BKY%K?K? 4cH?K*`H#Hz@ B4_ K?K? b4cHz@?4X4K?4K?Y@O?H|H|?@4?7K?Y@ @K?@ @k?o*H#`k?H (k?Y}KK? X@_K?K? h|04K?Y@O?ςK?Y@P@K?@ @JuHJsP k?k?ok?k?k?Ԡ7D 87#(_m4:K?7 @(49Y4K? Zh` _M4K?0 |K?YK?K?@O?*H?`4hw K ˟ *H:KXK˙m y@ @K?@ @k?o*H#k?Hw4J@ "67?67^a K? 74K?Y@O?HwJ?@6K7?6K?Y@ @K?@ @k?o*H?k?Kk?Hz@ Pk?K?K?7K? :4cHz@?K?4K?Y@O?H|@ @K?@ @k?ok? k? 7k?7C7%^ik?!K? | H7Xi4 K?4K>K?K? @O?^!K?!K? | (7X4 K?ˀK>K?!Y4K? d4E e@P@K?@ @Ju XJs ` k?k?74_k?K?K?Y@7?@ @K?@ @k?o7Ck?^!KZK? `K?Y@O?@ @K?@ @k?ok? k?k?k?!k?)k?1k?976k?C87$7C44 H77X 1 X  ? 4 ?6E 1E Hy  5:Ha = @ P7IT4 "IZY m4K?!IJ@?@!:Hv44y47K?!7 RHz^94K? 74Y4K?4 D IHd EHf 5\K>K?9K?1K?)K?!K?K?K? @O?@5\@5\X 14 K?@m5\@ @K?@ @k?7k?ր7V75K:J1@J K " b6J?@*44:Y4xK?K?Y@7?@P@K?@ @Ju hJs p k?k?77\k? 7:_4K?K?Y@7?@ @K?@ @k?o7#k?^KZK?2_` K?Y7@O?k?X 4 K?K?@ @K?@ @k?ok? k?7C4k?k?)KX k?!Hw J4K?)K?! 7K? 2H?4H4}@K>K?K? @O?@P@K?@ @Ju xJs  k?k?77\k?k?@ k?K?_4(K?0ˀJK?K?_M7K?4?  k K?Y@7?@P@K?@ @Ju Js  k?k?o4@Yk?K? (744|K?Y@O?*`H?K_E4zK? "h` h`(h`0h`8Y4zK?`e4|@P@K?@ @Ju Js  k?k?7_k?K?4 k8K?Y@7?@P@K?@ @Ju Js  k?k?7k?_k?K?Y%K?K?K?Y@7?@P@K?@ @Ju Js  k?k?ok?k?k?7C7%k? P64z44_]4K? 7ϟK?Y4(_e4zK?!7 H X4K?7_4zK?!: h 4? H? Hz X=4K?Hw H87   0h} H6hHv 6ha Hb(@ He0@0hd(@ h hd0HK?YK?K?K?@O?ϟK?YϟK?Y@ @K?@ @@K\ @ @K?@ @k?ok? k?k?k?!7Ck?K$( K%8HXY4K? p7HKx7?47K?7?44Y 4wK? 444Y 4wK? bH ?H4K>K?!K?K?K? @O?ˀK>ˀK>@ @K?@ @k?77\k?k?@ k?K?_ 48K?0ˀBK?K?_7K? k K?Y@7?@ @K?@ @k?77_k?K77kW k(_k0K?K?Y@7?@ @K?@ @k?7_]k?K?K? 0@@K "K(K 0K?Y@7?@@K?@ @Ju Js  k?Ju8Js@ k?k?ok? k?k?k?!k?)k?K>7#7E7k?1K: HB044@ 844_m4K?!@@4: r)49 4X4K? :4Hz44_4K? k?Hz4K?1_K>K?74|K>K?)K?!K?K?K? @O?X 4K?Y7K? `7`u4|X4K?Y17K? 7`%4|k?H)49 B0 4_ K?4_4K?HzK?14_e4K?7Y4K?U4|k?H44B0 _ K?HzK?14_4K?7Y 4K?4|@P@K?@ @Ju Js  k?k?7_k?K?K?Y@7?@ @K?@ @k?7k?7?7WK9 P@J0 k j0J(@0j(K?Y@7?k?+4:k?4Zek?K?K?]K?@P@K?@ @Ju Js  k?k?77\k?k?@ k?K?_ 4HK?0ˀBK?K?_M7K? k@ k8K?Y@7?@P@K?@ @Ju Js  k?k?o48k?Xk?K? (744|K?Y@O?*`H?K4z_5K?K??4|Y4zK?`}4|k?ok?7Ck?KW HxK4z7K?`74zX 4K?h|70 rHK4z7K?`Jh|4K?YK?@O?ˀK?YˀK?YˀK?Y@ @K?@ @k?74@k?K?K?Y@7?@ @K?@ @k?74@Pk?K?K?Y@7?Ju Js  k?k?7k?K_` * @@K?PK?Y*` H?K@K_=@K?K?Y@7?W4K?ˀK?Yk?ok? 7C7k?_uk?K? "4K>K? @O?k?Hx4zK?@ HwK?K>@ @K?@ @k?77\k?k?@ k?K?_4 K?0ˀ2K?K?_57K? K?Y@7?k?7_k?K?K?Y@7?@ @K?@ @k?ok>k>k>k>k>k>k>7C7$k?KW؂#hk>H}*`H*7?1K K _IYK?#bŀ4H44_ 7?1K?#74_7?1K?#rI 5KK?@44ş5HK(7(Hi肠!5%4?HI 0 JHJ0"I "h  !BI !*HyK64zI9i7K?"7I_'84X5ZK? xiFK>7?5Z47K?!x@K? iE iFI) >@H4 H >5@_7?1K?ςhe4W4zK?0ςW u4K?ˀK>YˀK>Y5 MHI44_7?1K?=KH5 H_7?1K?4K>YK>K>K>K>K>K>K>@O>@ @K?@ @k?74@k?K?K?Y@7?@ @K?@ @k?74@k?K?K?Y@7?Ju Js  k?Ju (Js 0 k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k?``7D77&6_M@K?"HH J*H))v#!7*4+4 HI I @I Q#4 k?H4I_ 4K?4#p7I #RI J  #I( ! J_!4K?"`i0I J0I _-i(K?I04\I ?"5yp_ 6:K?I0 <I0Jˀ K>YJK64I=7K?0ˀk?H46@HK?  mhK>YJJ64I7K?  mK>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>ˀuK>YK_6:K?I0I0J0k J0I I(_i(4HςK>YJu 8Js @ k?k?ok>k>k>k>k>k>k>k>k> 6k?7Dׂ7%*H'K>* BH(4J17?iHlI _ (@I J Ӏ^""_@II  4w׀JH_w4k?44k?iI k?Ik?Ik?k?y_k?qK? IƔK?i K j i(?44'4K77JˀK>YHH! H8 K?iK@ 0@I ZK  J :k@I J I_?iK?ii(4cÝHl4K>YK>K>K>K>K>K>K>K>K>@O>K_ KZ(K_?@2 KW0JK@" ˀ@@K\(K_0@K@@K?@ @Ju HJs P k?Ju XJs ` k?Ju hJs p k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yk?ԀK=K=7G7(7*H*k>K=k>K= E(W4 Xk>0k?Iy(4 4 k?It04k?Jk?HKJIy7K?0k?K>47k?5_}4K?50X7J_ JW(0B *L6YjP(_=HK?ir(Iu k>4  y+k?Ip(44 k?I04k?Kk?HHVKIy7K?+ie0Ip 0 tK>  }"ii(@r"@| K>61B5?61B<4\"(49 4 W 6:K?"JB?4_ 4""B!B55" *zk?H04k?J 45Ix 7K?!ˀK=َ*k?I}04 4k?It(k?Hk?KKKIy E7K?*I}(=ii(_55:K?Ia04 <W=K>K?H_ 7K?/87K>X 6:K?j0H5y_]6K?@ P!ςK=و H_5yK? mH_ 4K?(Pi|0ii(_ 5:K?Iq04<K>و"(49 _ 5K?Ip0Ix0KkL Iy0 Zk?H45k?K(Ix 7K?+i`0Ik(4K>K>8 2 Iw 66 4?K> 44HK6Ix7K?,p7IaI|4jIrjIajIq jIb(j Iv0j0<}j (K>j0HIt(JXEK>K?<@Ix4 '4'@I0Iw(H芨%BI0]H-!4 R@k> B@k>K=q ""IK`"H :H 44_y4yK? bk?H45H6PIy457K?"8@K=yk>4t(k>4<(k>4! @ K4 4k>*H"*k>H,k>54 w4 ]k>Ɨ*45k>4k>H k> ^k>K=qK> K> Jk?45k?4_m4xK?|@5k?H44y_a4K?7`=7H@ @׀4K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>(44: X4 K?5@ l5yih(_HK?ih(4 p(k>4: ZY4 @K?k?ˀK=(k>44: 4 X7K?=k?ˀ5K=H_5K?Ib0 \Iw0Jk, I| 6@HJ0 b(ik @(k>4: Y4 LK?k?ˀMK=ْ  Iv0J@4k?H4k?Jk?Iyk?7K?5@ˀK=K>IbF *K>? K>ሸ 5U@k?H47k?Jk?Iyk?K%7K?4@ˀK=(k>44: 4 6X!7K?6?(k>4: Y4 K?k?ˀ-K=ˀK=(4: (49 X4 K?*H5J7J4x677K?W A4K?ˀmK=k?H44k?K5y5A7K?2@ˀK=ˀK=Iz  HK=0 }(ik =Ik(k?H5zk?_ uJP(K?IxK>764Y7K?2@ˀ K=Iv  HHA0a34k?H5zk?_ J0(K?IxK>7647K?1M@ˀEK=ˀ5K=ˀ%K=@@K?@ @Ju xJs  k?Ju Js  k?Ju Js  k?Ju Js  k?k?ok>k>k>k>k>k>k>k>k?7Ck@7$k@k?9K_ zK RJ0J 0C:(_0c:(J?JK?@Hp J7?94z4_4K?#H?7?9k?A7?9*`H"k?QHY 7?Ak?I_HK?47?9@p4zK?#H!He!(4&hxH!:H  Hx6hx H I*5Z]}59K?bh7Xy5zK?2H`"JIW5Z59]u5K?b 7I8x"Hx hxXI5K?H>HHx J Wq4zK?!hphxH ?_h H>?hxHe 4H jH7?b!4z44_-4K?!H?HH?m@4K>YK>K>K>K>K>K>K>K>@O>ˀK>YˀK>YˀK>YˀuK>YˀeK>Y4`4YM7K?띵HxˀK>Y4z44_4K?>HˀK>Yk?4z44@4K?>OHˀuK>YˀeK>Yk?ok?7C7k?KWK?j 44 Hz ]=Hz7X K? rh|HyHz :  Hv6 h|4K?YK?@O?ˀK?Y@P@K?@ @Ju Js  k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k?@@k>7#7k>7:_ 1@K?#Hx!He!HX!@H?@HeƟǂHX 4I II ??iK @ %Bi HX :%RHI4^4K?%pI HtJ4z7K?"JHy#7K>7k K>_K?!HeHu **H'*H(*H))V"4*614 4 4HI  *I  J @ >7HXI(! :K>K>_5K?% i84ş?44K>YK>K>K>K>K>K>K>K>K>K>K>K>K>@O>ˀ}K>YˀmK>Yˀ]K>YƟ@I H Bk?I44k?_K>K?:k?H44^IK?7K?HXI]iI(I_?@iI( I0 i IiI( I0i 5Z 8Y 4rK?i I  *Iv ޿I I 8ǟ*HX04I  J ҠM@zH`0 PI @I 4z_u5K? 4I K @C(\Z@5445Z 8W4K?I ˀ K>Yk?7k?7_K87?B҇ ":!!‡!z!J K  KƟ@*k?4:Y4`K?PK>K @2*H5!@*H4k K>@7?*k?!44:WM4RK?K>K*kH9ek *H:=k K*kH=k K!0k K7(KkK"0k K8(K K=(>-*H5Uk k?*4:k?Y4K?K?@ @K?@ @k?ok? k?k?k?``7E7$KY8 !z4h8HKX!b 8@KH4^ 4K?!H@ X@HK_K7K? 7H  4_e4K?H?h4H_}HK? b4K>K?K?K? @O?ςK>ςK>ˀK>(vk?!44:0W-4K?]4@P@K?@ @Ju Js  k?k?/,opk>k>k>k>k>k>k?7&k>76K$#Hhp$(@K>W Y4 K?$@7H H K>HY_@K?$ H( *H KK] \KHk?4H 4k?K>4_IKK?"RK8"BH7@ KIH 0@H K HiphHwx] @K?7\!7K?#7H K5K>] 9HK?0"4k?& \K>K?7>K>4y5&9G&EZ1K?7X95K?" HipHwx 7 Hzx7]h}x4K>YK>K>K>K>K>K>O>@/0,k?H44H H6H4K7K? ˀMK>Y(k>44: XW42K?Hhp(k>44: XW46K?K>ˀK>YV 4K?ˀK>YV 4K?ˀ]K>YˀMK>Y(44: XW4K?HHH J8 KK9k?H4k?J@k?K7K?<4XI5K?ˀ]K>YˀMK>Y@ @K?@ @k?o7#k?W14(K?0ˀJH 0h|h|K?Y@O?@ @K?@ @k?/,ok?נ6k?1k?9k?AJ7? \$p K?7?AHwk?K?1K?AHx '9G'EZ K?K>O?@/0, z *+44:W 4JK?k?K?14wK?9@K?AK?eK>K?A@4wK?5K>k?/,ok?k?!k?)k? 7k?A6K HXa4K?2E!H  04 86@€(4 6@$ \UK?AK?7?QH4yk?K?A4'9G'EZK?7X4K?4|K>K?)K?!K?O?@/0,+5k?I4:Y14K?5H`}4|Ju Js  k?k?/,opk>k>k>k>k>k>k>k>k>k>k>k>k>k?77C7'6K JH@$x@H I/X$hI&I<PH$I!@HA$H I7x Hp$K>!^4K?%JHH L KZ*H,*H-#714IPJ  "J K ^ J( J Bk?J44zk?_4K?2k?H44^JK? 6_ -7K?5JjIPA9(9CI:HW-@K? 7A-(-CI?H Hk?4z4Hk?4_5WK? 7$ \ 4zK?7?!H4zk?44&9G&EZIK?# @WE5ZK?4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>O>@/0,)k?)4:8Y4K?}Hς5K>Y)k?!4:8YI4K?eI<P)k?4:8Y 4K?=I!@)k?4:8Y4K?H)4:x)49W 4 K?*H5H7HmIIJ7K?V14K?ˀK>YˀK>Y)44:8W4xK?B@)44:8Wu4zK?@ @W55ZK?ςK>Y@ @K?@ @@ 84K_ 0 7KZ@?@@@ @K?@ @@4JuJs k?k?7*`H?k?K 4_kK?K?Y@7?@ @K?@ @k?o7C_=k?K?H b40V4zK? Zh|4k k(4K?Y@O?ˀK?Yk?o7Wk?7#7?4VU4K? @@V@K?4 wϟK?YC?K?Y@O?JuJs k?k?ok? k?k?Ԁ77C 0k?!!:V4 K? K>*`H7J @ _4K?   g?(4:X(49hW4 K?*H9K67?HyK?!7 7K?Va4K?K>K?K? @O?(49H7?W4K?(k?ok?k?7$7Ck?7V4K?2_ˀ4HwJ J 0 _Hyk? H}7htK?YK?K?@O?JuJs k?k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yk?``k>k>44444 44V5@K?+*K>_7>K?(X7*`H#*`H()u4)@)uk>4 4 H4 @n$z 4 & ''K>4K>_7>K? X7 ( BK>_7>K? 7 (0#&څ'W}4K?4)7 K>7>_4K? 7I' ߋ : P6WU4K?( \ 7.K>7>_-61K? 87I&@ \߃?G& 6.K>V K?(76W)4K?W 4K?K>_E7>K?4 X7 ( BK>_7>K? 7 (0& *K>_7>K?&(7 x ? X4K> _=7>K?Ӓ r ?7K>6_68K?&J (0%PK>VK>K?K>7?Q7?4V4K?%@C?S w 4ƃ8%JC?U v %2< !  QJ W }4K?W 6:K?%76'K>44V68K?$4C?QӁ4=?4? = I 46? 5K>_7>K? P7"@K>_7>K? 7?@!K>K>HV67?qK>W 7 K?V 7?qK?K>V7K?77?qWy7K?K>]5YK?#7iP04iT iP8iOHiNK>_M7>K?87K>" W4K?ςK=K>K>4_5K?(@K>K>4_}5K?@K>K>4_=5K?@_55K?e@_ 5K?@K>K>4_5K?@K>K>4_m5K?@K>K>4_-5K?=K>K>K>4_5K?P@ 8(C?U 88ҸK>K>_4K? @W4K? @W4K?4K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>@=K>CC6?7 z  x ӯ֏P  CC׸ 6? r  b Җ<  X7CC 6? v  z ֱCC_  y  t Ң P֢1 5 P @9 UPIT0I_H 9K> iRHCC7 w k љչZ M CC 7 |  t БԱ E  XCC8 C } C q * W  u    :AK>Ҷ ׁ  B hbW=5K?ςMK=@ @K?@ @k?o7C_ k?K?44VY4zK?!J7?44V Q4wK?!C?4! *`H7C?4  C?  C?  _ M4zK? @_=4zK? @Hb@ Hap?@ hapH|K?Y@O?ˀK?YVY4K?ˀK?YˀK?Y@ @K?@ @k?o7C_}k?K?44V14zK?!7?44V )4wK? @C?4H C? _m4zK? @_ ]4zK? @Hz@ Hyp?@ hypH|K?Y@O?ˀK?YVy4K?ˀK?YˀK?Yk?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k?Ԁk?a7&k?74444K9V@K?&K?_U7?aK?%*`H)(4*4 4 4 f4b 0R&K?7?4VQ4K?%RC? 0  C? 1  5ZX-4K?C?C? <  = ҡ҂  QR @W4zK?W!6:K?$h76(K?44zV!68K?$ 4pC?4 Rנ HH%R @W6K?ςK>YBB65? =  ! B" BB_ 5? =  6 ?_ӗ  W_6BB6  1 B]ם 9 BҖ  8  5  AH0:A   PU "45?!7??_P7_?BB 6 !  5 1Q : _4a@@  764 4  < ֺ  < 9 0   6  9 Q֑  5 P /  7~6K?_}7?aK?:e@K?a  @W4zK?4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>HH  @W4zK?ς=K>YHH%  @W4zK?ςK>Y5ZX 4K?K?(k?4:X }4K?m@(k?4:X =4K?@(k? 4:X 4":H _5V4K? p7K?15U4K?*H6J 24 bˀK>ˀK>H8 G  6?B"Hu4 |4 a H8    H *K  dHw P4JHؠ26J @J6 H 0 d4K>K?)K?!K?K?K? @O?k?ok?֠7_44c=q7=q7=`]7T2A62 .@. *&Ab& "@b?@HK<*4<P | 7*49P|" ! V 7*4<P | | V   7K< 8P78?*49PB"" BB|" 7B6 _6ar 76"" 7A|! !! V |6 V6  "|" B" 6 !|! V 7~6 RY79< *47P! !\ 44\ V| 7 B74V%4xK?|(4K<@O=k?77=k?K]46C H4P 7 7K] ?@k?4_4K?K=Y@7=k?ok? k?k?k?!k?)k?177$k?K4k?A K*H'H 言6Hi[K?AK?47  k?HK?A_4K? jH  E5&4K>K?1K?)K?!K?K?K? @O?ˀK>k?77?k?K?k?_KXK?K?Y@7?k?okk?Ԁ7CKX  :UQ4K?4K>YK>@O>4hy7>W4zK?@(@U4K?ˀK>Y(490\4zK? 7ˀ=K>Yk04k K>kHkH|h@ @K?@ @k?o6k?k?k?U =4K? ZK?K?44xU-K?K? 4K?Y@O?ˀK?Y@ @K?@ @@4 JuXJs` k?k?ok? k?k?k?Ԁ7Ek?!KZU=@K?7K?!U@K? 64UE@K? H7*`H#4|K>K?K?K? @O?(HK?!49 PVq4zK?@z@?4|*`H$44fH H@  0 @?44|_@K? @ @K?@ @k?ok? k?k?k?!7#7Fk?KEU]4K?2Dˀ *`H'4_4K? 44 4 h h(_h0K?h8HH440h@4hHhPhX_]h`K?hhHH*4hpH94hhxh d4060 u77D0 z4c4 `K>K?!K?K?K? @O?@ @K?@ @k?740U%k?K?K?Y@7?@ @K?@ @k?77:k?YM7K?K?Y@7?@P@K?@ @Ju Js  k?k?ok? k?k?k?!k?)k?1k?9k?K>7D7%k?A pk?I4K>K?9K?1K?)K?!K?K?K? @O?ƿ ςK>H!H44!54 4J X= 2JH " J8 J84J?@!*H!k?Q4 4 I I8 W iIH pr(4:p(49V4 K?K?QI7IK7K?I?%@4hH =@ςK>k?K?A44_K?IK?]K>@ @K?@ @@4k?7*`H?xk?K!4^kK?*`4H?7h<7 7T64744!67<646 64:=45794 677cH76cJ4A47c44c\ W786K?Y@7?KX*`H?7C !H44 7?6P7?B <Җ \6_79?` BB BҼ V B׶Җ   Vֶ9 5U5Ӕ6U \W>7?W@K6*`H<6B  4 4P7?  X _7` X  6 76 66  7 X ?4 X  @:k?ok?k?k?7$7Ck?K]ԀK R(H8 8@H% @(H7?@ 4U4zK?#B7Y7U4zK?7 0Ƞ4V  K?44V K?HyK?(h$h?Ht4K?YK?K?K?@O?k?ok?7#7k?_7K?П   _ 4=K?YK?@O?@ @K?@ @k?ok>k>k>k>k>k>k>k>k>k>k>k?Ԁk>1k>9k>)4l?#4f"xK>YK>9U48K?K>)B%X7K>9 7?Q7>)K>)K>97k>)K6kK>9JpjpK>9H.Ii0K>9K L_ @K?7K>9U5K?$ I7?QU5K?i Ѷx h _7>)K?H}0  K>)C!ZK>Y7?Q_7>)K?K>97X 7?QK? 74K>9U4yK?"X747?QU4xK?K>9[]4K?7K>)C!r(k>4p4j4b4h44 4 4 `  8gK>9!>OK>)uK>9_7>)K?K>)B 7*`H$B эԭ K>94x_5  K?K>)5k>)4cB?BK>YK>K>K>K>K>K>K>K>K>K>K>@O>(k>44: pV 4RK?m47k>)_7>)K?h|0_7>)K?hj Hu0 5hbHK>7: p4V 4K?uK>9K>46 pV 4K?5Ik?ok= k=k=k=!k=)k=1k=9k?Ԁk=Ak=I44U@K?"2*`H#(k=Q7=4J(4ƈ"4K=A44 U Q5K?!A i "XA A z ": K=A6?45U5XK?! HK=A9K=I5!7K?K=A44U94K?C= 4( w4K=A4U4K?@ 4%>%@?4(k=Y44:V4K?*`K=Q47VA4K?A K=Q7:4V4K?- H K74k?K%04` k?AK>4  Щ_K?AK?     0 4?m4K>K?1K?)K?!K?K?K? @O?  X  7 4 U@ @K?@ @k?7k?K= Ӵ K?Y4@7?K?k?4_k?K?K?Y4@7?@ @K?@ @k?7_k?K?K?Y@7?@ @K?@ @k?ok? k?k?7D7#k?KUk?! k?)H H rH0HH ڠJ4_ 4K?H0HH  4?&4H?e@Hv  24K>K?K?K? @O?k?K>44yk?K?!_5K?)K?ςK>K_448}@ 7 B?6?4b4`7_@6`?7P6?+48}@ 6 77?_6?O_ }@  7?7?|@ t@Ӗ  6?}@ ҡ Ҝ 757?e_k?ok?k?k?k?7C7$ !hKE44 ar4` 4 47?WP4W?47@477?7Z?_7`j 4777 K?YK?K?K?@O?U)4K?4  :4b (44$`4m7?(4:p\  457?k?ok? k?k?k?``76k?!4 (t4 4?ҡ Ң| 4Jו ט הי k?4*`46J E9P49?=CT Ҷ _7Z(` 7Z_@  Ҝ BDU   ҽ = 9u7Z*`H4C?7?C?  4C?  4  A ӗ ӝ| זK?!ׂ Ug?K? 4 4K?!44U4K? x@K>K?K?K? @O?(tk?144:U4BK?=4(tk?)44:U4JK?MK>@ @K?@ @k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k?``7D_@K?HJ(2(s"4%64@"7>q4 (4,4 4 4#@ 4# 4# 4#z 4#Z 4#: 4# 4"@ 4" 4" 4" 4"z 4"Z 4":@ 4" 4! 4! 4! 4! 4!z 4!Z@ 4!: 4! 4  4  4  4 @ 4 z 4 Z 4 : 4  46@#k?qI _ 7?qK?405 K?qX| K?q K?q7k?q4 K?q Ӑ| K?q YK?q6k?q ү| K?qK?q6k?qҚ Ӯ| K?qK?q6k?qY "| K?qOK?q7k?q | K?qK?q7]k?q | K?q K?q7:k?qO Y6|6 K?q XK?q7\k?qK?q4l4_E5XK?5k@ixE5@(H&84 H 7>q4bk?yH_U7?yK?K?y7=k?y7?y'_ H0K?H0HH _ 7?yK?K?y4f4_%4K?H?/k?yH!H!(s4&4~7>q4 f4 n4 p4 l4 h4d[@K?!7 k?7?6?I J4?_@K?  K?6k?I_U7?K?I H_07?I_ K?K?4f4_]5K? @>4(t4:44U4K?!r4K=YK=K=K=K=K=K=K=K=K=K=K=K=K=@O=K?4=k?u .K?6k?MK?7k?%K?6k?K?7k?TU4K?ˀK=Y(tk=44:U46K?M4@ @K?@ @@4@ @K?@ @k?o7Ck?T548K? k00K?Y@O?@ @K?@ @k?77:k?X7K?K?Y@7?@ @K?@ @k?ok?k?``k?7 B (sHK?V549K?xK?YH K7:4Xk?K?(sHK?49VK?K?K?YK?@O?k?7*`H?Pk?K 4^QkK?K?Y@7?@ @K?@ @k?o7Ck?K_ :4T4zK? 2h|4K?Y@O?ˀK?Yk?o7Wk?7#7?4T]4K? @@T%@K?4 wϟK?YC?K?Y@O?k?ok? k?k?Ԁ77C 0k?!!:T4 K? K>*`H7J @ ^14K?   g?(4:(49 U-4 K?*H9K67?HyK?!77K?T4K?K>K?K? @O?(497?U94K?(k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yk?ՠk>7D444T@K?+rh47>_-k>K?k>44 4 417K>*`H&*3k>4Ƈ004t*JT4K?7?!7?44T4K?*Z7?!4? g*?6C?! ְC?#C?%C?'C?) C?+  ׹C?-C?/ =  Ѱ0   RK> 6Pו ѱ 8 / 4zU6K?(7k>44z6T4K?(4m 04  )7@   4 " O P5? ]  @A  ׁӰ   ?_7a  U 7  B T 4= A  7 B  V-  B\ RB1 RҲ    Z 9 9 Q W  2ґR 6 Ӓ5  B   ~}7 Q  - B  Қ Ӓ&ꋺ$B惒"2⁂'j+ JIV0I_H (   N 2 @  iVH *HK>56U 7?aK?TU7?aK?7T 4K?$x75ZU7?aK?4[Y5YK?$(7iKH4 ( iU . iV0iV8 iLd&*AAAA  ӏN  ֏N9   " \  @h&2AAA 22A  Y AA A yy  ь    A  տ QH M   !  @hd%AAAA  -  ׮Ң-Ә]   6  @2 ` h%AAAA  __  J B ђ N   P d% H  hK>4_4K?0@K>4_4K? @U u4zK?4K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>7?!  K>4_4K?@K>*4: *49 U4 K? B*7  6WH2ׯѼJV k?H4U7K?T 4K?@H0h UU5K?ςK=K>+34: +349Ua4 K?*H*IV7H4Y7K?T 4K?@K>+4: +490U4 K?*H)I67H47K?T )4K?M@K>*4: *49U4 K?*H(I7H47K?T y4K?@K>*4: *49@UQ4 K?*H'H7H4I7K?T 4K?@AA A A  W  Ӱӑ  qҒ K ׵  ] h4 4_ 7>K?/57K>9@ Uu4zK?ςK=K>)4: )49U4 K?*H"HV7H45q7K?T4K?@ @K?@ @k?o7C_]k?K?44T4zK?!7?q44T 4wK?! @C?q4t!r*`H?47?s4? !Z"?7C?C?  ?җ **_4zK?!0@_ 4zK?!@H|K>@O?T @K?4 ˀK>ˀK>T4K?@Tq4K?ˀ]K>TI4K?ˀ5K>T!4K?ˀ K>ˀK>k?ok>k>k>k>k>k>k>k>k>k>k>k?Ԡ7(7C744K9T@K?% k?a4z_7?aK?4 $(4*`H*(k>4 t 0%"7?q44T )4wK?$H@C?}C? Y C?qּ ] C?s   Z  T ҵ$  N.24U5K?#75445T4wK?#84 "4P5? \  A U  V ҂բ  4_6ar  Y , C M Y ѭ׭ = 6 Z  L B B  X BB   78 ]  B A  W !!  7 T  B \  N Ӝ  4~6IHAz544T4wK? 4z_7?aK?<@I H͢*(4:(49 U 4 K?*H?K7Hy7K?S%4K? @U4K?4K>YK>K>K>K>K>K>K>K>K>K>K>@O>K>5 0V=4K?7?q(4:(49 @U 94 K?*H7J7Hy97K?S4K? UY5K?ςK>Y U)4K?ςmK>Y@ @K?@ @k?ok?67#k?K7k? Xk?THyHK?h|؃ 7K?_4yK? bHK? TK?K?4K?YK?@O?ˀK?YˀK?Y@ @K?@ @k?ok? k?k?k?!k?)K>7E7&k?6!k?1H _4 TY4K? 74T)4K? 7K?15T)4K? hH8  | dHK ZJ܀J `ςK>ˀK>ˀK>K P7KHy=27K @KY7 xHa 04K>K?)K?!K?K?K? @O?k?ok? k?֠K>67W*4?  ֣     ] <||  !  | ӣ| 4tԄ ӽ c?1Ԗּԁ Ԙ k?!֢ ֣ k?) "7?3=P7=?ӵBd| B\ 7B: _6arנ 76| 7Ё b| z \ !| 6 Ӗ | Z Z d 6~644V|   ]77?!4U4xK?|(4K>K? @O?@ @K?@ @k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k?Ԁ7C44KGH"r(k>4 _ 7?AվHH"H 5  .4 j#k?x x g?A444_4zK? ˀK>Y Jg?A44k?4_4zK?#Z44 Bk?  g?A444_4zK?#k? 4 4z_6K?#z   = H=@H!2 7?k?  lx   k?444_4zK? ˀK>Y7?k?ԍ ԊԈ ԟ k?444 _54zK?" k?444z_4K?04K>YK>K>K>K>K>K>K>K>K>K>K>K>K>@O>K>4Z VM4tK?k?ˀEK>Y(49 4T7?QK?(4:`(49 T 4 K?*H?K7Hy7?Q7K?S4K?ˀmK>Yˀ]K>YˀMK>Yˀ=K>Y@ @K?@ @k?o7Ck?S 40K? K?Y@O?@ @K?@ @k?o7#]k?K?0` 4K?Y@O?ˀK?Y@ @K?@ @@4@ @K?@ @k?77\k?k?@ k?K?[4 K? 8@K?K?[7K? K?Y@7?@@K?@ @Ju Js  k?Ju Js  k?k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=k?k>yk>17C7$k>9k>ak>iKH7 H-8%@JH-"0@K>y8@F*34%,$07>!0N1 9$G 'J ?,K>9I ǩLK>1IX *H(,K>9IX @*H',Rk>!H!J4 k>!40TA4zK? )x7[]@K? )H7K>y(494_4K?*`H" HY4[4K?(K>y*49V4zK?h(K !5 Ak K>15H$F0@K>y*4&,07>!Hk>A4z0N0&k>I5D? Ti4K?k>QK= \'7K>I k>4k>YTK?K>1U KHK?k>aK>9UK:HK?k>iK>a 0@K>1K:H4k?K>aZy4zK?&@K>9K=H44zk?Z)K>iK?&2k>)K>144K>aIH  6քK>Y*`H)4 4 D4 PI$Z@ !k>)Hx4KPM7K?K>!! 4? "rHvJP6:7K? C""  I77'`BZ \ :I?6R'PBZ ?6R6_?7C?M@h6144͂5Ax&&6?57`4k>!HwK>)4K>iJP =7K? k>qK>A4HZ_4K?M! 444̀@5B? *%R 6?61&@K>A6OK>q44[5K?"P7J *J5 @J1 ?@4 S4zK?!K>a K>QK =5[14K?!jJ4}5K>aT]k>aK?K>ik>iT5K>IK?K>1K>1 A i@0J __K>90j J _j K>AK>A_MIK?J4("xj@K>S4zK?K>Q \K>a @TK>aK?K>i @TK>iK?4K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=K>I!(4K>IwP5w?K>Y7HF4Bk>Y77_` 74Y977 `77(@770 777 m79 !ς%K=YςK=YςK=YςK=YςK=Y8-@61S@K?@S]@K?I?4?X  5854?K>y(Sk>4:V 4K?@ @K?@ @k?/,opk>k>k>k>k>k>k>k>k?K>7E7J PK'HHk?44xHXVuHPK?K>YIh (k>IHH8HI 59KV`I 7K?I 4I?IHH# 4h4ji5k(4"P,@ (k> `!j "45S5YK?HK`5 ` 7K?AA C!HJ`k?_ HK?K?57 =7K?HX7H&E0@07?HJx5 0N0'7? 7K?55JIm5kH@h! H@k?44xHXVuHPK?K>YK>K>K>K>K>K>K>K>O>@/0,K>6V)4*K?HK>6V4^K?H(k>4:V4vK?H@@@K?@ @Ju (Js 0 k?Ju 8Js @ k?k?ok? k?Ԁk?K#!4K>K? @O?KPk?_ HzK?Ha(H8XK?KH H(KX4K7KP SK?K? ˀ5K>Hy_eK?K? ˀK>H(*H:KXT>@ςK>(k?!4:`VA4K?H(_HzK?[Y4zK?ς=K>@ @K?@ @7 K?J KH"K@  @7?J 7?+24: /@6'F0@00N0'  7 7 '4<@7?@ @K?@ @7_?4?*48  8 @*@4<*@4<*@4<*@4<*@4<*@4<*@4<*@4<*@4<*@4<(*@4<8*@4<H*@4<X*@4<h*@4<x*@4<*@4<*@4<*@4<*@4<*@4<*@4<*@4<*@4<*@4<*@4<(*@4<8*@4<H*@4<X*@4<h*@4<x*@4<*@4<*@4<*@4<*@4<*@4<*@4<*@4<*@4<*@4<*@4<(*@4<8*@4<H*@4<X*@4<h*@4<x*@4<*@4<*@4<*@4<*@4<@4@C<C?4 @7?k?7k?K_7:Kh57K?K?Y@7?k?7k?K_7:KP7K?K?Y@7?k?7k?K_7:K8q7K?K?Y@7?@7<k?ok?7#7k?C? :4 44|K?YK?@O?S %4zK?7 444 u@]֝ \67_79@444 u@]֝ \76_794@`2@?a@@? <\@k?7k?7_7:Cx J  *44:TA4K?8K?YKJK87K?K?Y@7?KKJPQ7K?K?YKK?Kh7K?uK?Y77?*48 /''G0@00N1 9$G 'J 5 *KT @K(?@4@7?k?/,/-o`k>k>k>k>k>k>k?7k>7%K%r(K>V m49 8K?$7(4: X(49 hT4 K?*H5J77K?Sa4K?Ȁp4K>S4K?Hx  K>74_7?aK?K?a7$G (4& , $ 40SqK>K?K>74_57?aK? K?a 4_K>K? 4K>4_7?aK?K?a G K>74_7?aK?K?a7 !0 H :7H  T9@K?#@h H H 4H77?ahH _K>K?K?a  K>74_U7?aK?K?a7 > 7?&E0@00N08G&H%  h(Hy 'H K>4_u7?aK?K?a77_4K?!p ' <40X4HHhy SIK>K? |70ȀH} k?44Y -K>K?0ȀH} E@(4: X(49 T 4 K?*H4J7Hx 4y7K?S4K?Ԁ44K>YK>K>K>K>K>K>O>/0-@/0,k?ok? k?k?k?נ7%77D6K7Kk?!+4?WK: K978?4? 4_4yK? @xu4|K?!S4K?K?!4y_%7K? 4cK?!7_ 4yK? H h K?!S4K?K?!4y_7K? 4cK?!7_e4yK? H  K?!_4yK?d K?!_-4yK?h` K?!_]4yK?p0 K?!7?_4yK? K?t4|K?!Sa4K?K?!77?_4yK? K?# 7K?!_4yK? H 0 K?!S4K?K?!4y_ 7K? 4cK?!7_-4yK? HC  K?!_4yK?bX K?!_]4yK?b( K?!7?_4yK? K?}4|K?!7?_4yK? K?z4|K?!_ 4yK?bh K?!_ 4yK?d8 K?!_ 4yK?h K?!_4yK?p K?!7?_4yK? K?y4|+4:X+49hT4 K?*H8K7H 7K?Re4K?4|K>K?K?K? @O?k?ok?k?k?7$7Fk?KZ76S40K?H0h0K?K?k k(K?YK?K?K?@O?JuJs k?k?7k?K]78?*4: *49pT4 K?*H"HV7 7K?*H<K?Y@7?K_(4^C?K?Y J KT 7? @KZ*H546 _U7K?5K?Yk?ok?k?7C7$k?7_K$ ZK x7K?KHz @ Z d `he @K?YK?K?@O?HzRE4K?H}} |k?/,/-/.///0/1o k=k=k=k>k> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk?Ԁ7&7CK)(KK -k>(49 pVy5zK?-7(4: p(49 S4 K?*H.I77K?Ru4K?Ƞ0461K>_69K?ӟ掰61 ⍒.k?4 4k?5Y6_5wK? 4 5N4z5_5XK? H@K>69_u7?K?$E0@0H7>K?70N1 08G'H  27 H(T 4K?,Xh(HH( K>69_%7?K?HH(96 \K? 69K>_7?K?HH(XU  \K? Q 69K>_e7?K?HH(W T  <K?H6: hK>S Q48K?K>7Hu@k k(k0H(HfP _4K?4 k>K>_]4K?4K>_4K?4K>_4K?Ӝ7>K>444_& K?K>_u4K?4K>7_54K?4K>59_ӇK?ӈK>SQ5K?4P5)7 K>_59K? \5)b?5JK>59_7?K?!07(4= / '$E0@0H7>K? 0N08G%H   27 H T K?'h H5h59H J7?_}K>K?>7K? K>5Y_57?K?"`7(44 . &$E0@0H7>K? 0N08G%qH q  27 H(T9.K?%h(HH(" ? iK>5Y_7?K?HH( <K? * 59K>_Y7?K?HH(  \K? 59K>_7?K?HH(   <K? 5YH7h7?_K>K?=7K?K> J :7>  (4. -(45 . &(4)''10n4 4_4K?744 44 4 K>_969K?ӟ74? 7  61k? k?7>  46' 1@1@0N1N 01!8G'K9W'V  F  + J 5Y_%5wK? 4 5N>@K>,4 4HHh0SK>K?h(70ȠjH0k?44YK>K?0Ƞ"HhPH0H @(4: p(49 S54 K?*H,I7HyPH0-7K?R4K?Ƞh4ȠX4ȠH44z_i69K?@vx\ 44K=YK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> K>K=K=K=O=/01/00/0//0./0-@/0,(4: p(49 Se4 K?*H-I7m7K?R4K?Ƞ4k?45Yk?6_ }5wK?69_)7?K?7>K? '9G'E\@K>69_)7?K?K?= K>69_q7?K?K?7 _ m4K?5@K>69_ 7?K?K? @27> 0N09W'!G!A@K>_69K?$] KZ0@ K_ @0RK( K KU5B7K @?K(4@ˀ@K4K@@ 2K_? KW7"KZ@?@@4KY@4k?ok>k>k>k>k>k>k>k>k>k>k?``7DKHk>KJX4 44\4$4 "7?aK>_!5YK?7K?a 0RH0_q5K? 7Ia!Z4 Iu!4 Iy - 7?y5W_ 4K?K?y !p7!"!J?!*!JIK?0 (Ix(r4:(r49@S 4 K?*H'H757K?R4K?ˀK>YK>RA4 K?HpɜmhpK?( K? K? Ix5 /Iy Ib@ 4=W7?a4K>YK>K>K>K>K>K>K>K>K>K>@O>k?ok>k>k>k>k>k>k>k>k?``7%7G64 K* X 5Y_@K?ӄ 5J ! *4_5YK?<8 F "4_5YK?7 F 4_ 5YK?ӆ 5Kȁ: !459_4K?"`7`4|(rk>4:U 4 K?@(r4:(r49S4 K?*H:KV74 7K?R4K?`4|(r4:(r49pSe4 K?*H9K6744 ]7K?R4K?`p4|*H8(rK4:04 7K?Ri4K?44|K>YK>K>K>K>K>K>K>K>@O>7?Q4_ 5yK?K?Q7  (r4:(r49S4 K?*H7J759 7K?R)4K?`4|5:_i5YK? 7(r4:(r49`S4 K?*H?K759 7K?RY4K?`4|4R 4K?74cxk0k`H 464$4 H 7?i4_4xK?K?i 7* ?r? BK?y0hv(H4gH heX4 hjHK?yh|PK?y aK?y}hb K?y b4tT5ZK? \8*C?4\ C0^7hj@K]8 @47_K K8"K?@@4@4k?ok? 7Ck?k?KY8k? !(k?!Hzh bH}H!K>_4zK?!h|h_4zK? @HzhK>K?_MK?K?HzpK?7_K?!K?7 4 4K>K? @O?ˀK>4ˀhx84ˀhw84ˀh8k?ok?k?`` K$@KD H(qS 49 (K? x@(qR4: HK?(qH49 xR7K? H?gH44K?YK?@O?@ @K?@ @k?ok>k>k>k>k>k>k>k>k>k?K=K>k>K>K>K<0I& k> `K> # 4!@K>RQ48K?#7 &K>_]4K?#7 84 K=HK>_ K??7K>R59K?#  K>_4K? 7IKH zk?H45YH  K>X K? @H ,  K  K>_5YK??E7H) " H"BH JK>5_%59K?"@I?5HH"" @_AK>K?< Hk?559k?4x_4K?"@HH]@4K>YK>K>K>K>K>K>K>K>K>@O> 0G)k>4:T4 K?ˀMK>Yˀ=K>Yˀ-K>Y)k>4:T54 fK?HˀK>Yk?559k?4x_E4K?K>Y^K>K?H7  >hK>458_54K?H h=7H  I =EK>5_59K?=e@k?559k?4x_4K?EK>Yς5K>Y=}@!6?  @ 7w@7?@ k?o79?k?y@WW_K?!K?Y \@O?44 V T ?]ֺv@ \ע ]3M@ 7\ע ]֚1  X@ \{ X _4ҟ \ W5 Av@ \֢׿5 U ]4 Wӟt W4֙ X ]5 =Y֚ @ \֢׿ U ]{ WӟU W4֙ X ]ҡ=Y֚v@ \k?ok?4?*4?  : 0K?Y` K?Ycc4wa4 784y#k7< ׀ hC44 4u B0 *44:hS q4K?K?Y4|@O?=7?4?*48 @4@4K]K 2 4@KYK6 24?@KZK\ 24@ @4,@4"@4*@4@k?ok?7C7:7 4?*48 8 _4K?`` C4_K?0 C"6@_ K? C#7 @_ K? C_`K? C#876@_u K?H C#7 @_5 K? C_ `K? C"6_#K? C_e` K? C"6C_@K?@ Cz8K?Y*44: XS4K?K?Y4|@O?@@@@k@ k@(k@0@k@8K k0K(k8Kk Kk(KK@k?7k? " K]K\\KT]K__T&! KU0KW kW0K_UKUkU KW_KV8VK](k]8KAkA(WK?Y@7?$?U@KY KXYKVkV KYXKT(TKBkB(uY*k?44: SI4K?5K?YJuJs k?k?ok?7#7k?K 0k?_}4xK? H!H 2K?_54xK? H H  @@K?_4xK? @H( H0 @@K?_4xK? @H8# R4?K?YK?@O?ˀK?YςK?YτK?YφK?Yk?ok? k?K>77$k?76k?!6_7K? X777 wH7 K?!_U4cK?P4|K?!4z_4K?H  e 4|K>K?K? @O?k?ok? k?k?k?!k?)k?1K>7'k?7E76k?4>4 4_ H? Kx 7K?44y4_4K?@74 Hy77  w4 &^' k?4>4? G4 HKx y7K?44y4_4K?74K>K?1K?)K?!K?K?K? @O??4427? Hu6] v4 pk?7Y? =70 44y4_e4K?Ȝ47?A4"8 HJx4 7K?44y4_4K?ȜE4k?ok? k?7K>78k?47?k?!x7E 46 44k?_4K?K>K?K? @O? ׂ" "4k?4 47 HJxi7K?K?!44_}4K?uK>44 HKV`77K?K?!44_4 K?K>k?ok? k?k?k?!k?)K>67Ck?J47$k?14ӧ6@`Ө>4=Y4=a4=b4>€B@ WZ4? K>4K>k? 6 HK7 4 K?14z4_ K?744K>K?)K?!K?K?K? @O? Y>Y    @HHY87H~! ZZ HHY r479r4 8 Z4 `X  K>4z4k?K?1_4K?Ȝu4Ч Ha4H6x47K?K>k?4z4K?1_4 K?Ȝ4@ H4_ W *_ ?7@@4?@ @K?@ @K?K? K_P K7  k=@4@ @K?@ @k?ok? k?k?k?!k?)k?17(7K>k?640Rk?AK?K?A7R4K?7` `4|&K>4J K0&K^jK I7 4^k0@4|4"Ճڄ܀Zր*҂"̂ȁā: d ` `x K?ARQ4K? |0` 400   d ` K?AR4K? |0`4 d `h K?ARA4K? |0`r4 d ` K?AR4K? |0` 4 d ` K?ARq4K? |0`4 d `0 K?AR 4K? |0`:4 d ` K?AR4K? |0`4K?ARY4K? |0` 44 d ` 4# 4 4"4| !K?AR4K? |K?ARi4K? |K?ARA4K? |K?AR4K? |H @Hz Ht0` 48 440H|4Hb XH}hd 0@  @ Hh`(  z0@N`  @ 4|K>K?1K?)K?!K?K?K? @O? "4 4"84@4m  0 ?O4|4N-  ?'4|K?AQ4K? |K?AQ4K? |K?AQ]4K? |K?AQ54K? |H @Hy H} `=4| 48 44 0Hv4Ha 7HzGhd 0@  @ ]h`(@ @K?@ @k?7k?4@*H? 9 ] =  Y `  k?*4:k?4 lTk?K?K?K?4K?Y@7?k?ok? k?k?k?!k?7C7$76@@K?!h`pH4x hvpD7?=(4?46 V @Hbp_hbp4QU4zK?H}HaH"@!jHw `4J U2HHJ0J@ Y  4J?@HH HPhwH|KHHˀK>Hap4<]h}pHbp4AThtpHgp?mhgpHpMhpˀ@K>Ht huJHP 4*4[4zK?Hh}H|k8Hvj0Huj@HHvj`H% HujHHHf % hPHE HtjXHeHDF@H|K>K?!K?K?K? @O?Ju HJs P k?Ju XJs ` k?k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=7&7Ek?K:7R4K? 7H(H4 ' Q m4K?Hx@H44zQ]4K?H(2H` '44 H4 P4 ?4 ;{4 4HX G 4 Q 4K?g7>44HQ4K?'rK># Qk>K?7Q4K?' 7K>R)5K?4T5K?&7C>_I ן_i K>5k?C>ҹ?C>C>_eҘ_K?&@@K>%K>Hh 4 Q4K?e44P7>Q4K?%K>Hh '  ] 4QE4K?eRK>i0K>G iK>_ MK?%i`47?R4PK?K>@#444P7>Q4K?$K? # Qk?K?7Q4K?$07K?R96:K?4T69K?#7C>4k?6:C>C>Ӹ_5K?#@Q4K?7?j!C>ӟ]7?04$B$#0J? W2@j7  C>Ӏ J? ?j? C>J? _j? C>@J" _@j" K>و 2K>ᓠ0J" 0Lj: K? BJ! ?_j! K? j5J<K?j+xK>K?)@:4B7>7?K>j=0K>j7@K>j?HK> j6K>_=K? j<`K>64K?) i@`iHI0K?9 K?A i@IK?) K?1 6 iHH`5=5HR K?!7 @R4zK? @R4K?4K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=J8 8j8 J: _j: J9 ?j9 C>@C>"K>J7 j7 H R4@84K? H 4?@*H1@J744X4K? 4P4? iЯ_6`j  j65b i4D4 h iЀ @R 4zK? @R 4K?ςK=Y@ @K?@ @k?ok= k?Ԁ7Wk=4447=Q!@K?4":G=4 4 d4DG=Ҷ6=(4?49? @K=4Q)4K?bK=7>4Q!4K?4"@K?9K=Q4K?bK=7?4Q4K?"@K?K=QA4K?bK?K=44Q17=K?4\ x@Q@K?#4KK?K=р BK=44`Q 7>K?4`!P@K=7=_-4xK?#@Q 4K?ˀK_=4wK?K<@ @K?@ @k?o7Ck?QA4hK?h|04K?Y@O?k?ok?k?k?k?Ԡ7C4Q@K?%7Hu4Hzp ]#*4`QA4zK?Hyk< HtJ %*Hp*4 DQ4zK?Hh< HJ %:H :C  HKV B _b H "HK5 B ?b H \"HK B ןb HJ H0j @(?DZHHHJ j(@("Dp@HHHJ HK H`"b@K0? k0HKCK  HK4K9 BC5ֺ 95HKK CC =^֝ ~c H 4K?YK?K?K?@O?4 D #)7!'  h h(h0hPHd?g4(4%4?@4K? (@@4K?>H@x4K?@ k?!P]4K?K?!74Q7K?*H!@H744X a4yK?Hk@`!P4P4? K:@k7(@^k7H_6`  Kk(^kH6 KҠk(Ҡ^kH6 KҀk(Ҁ^kH6 KӠk(Ӡ^kH6K>K?K?K? @O?k?o7?(a4>hdhehfhg hh(hi0hj8hk@hlHhmPhnXho`hphhqphrxk?@@k?17Dhyhx4h`KVJ+4%?!K`hzHh}44Q@K?h`Ht'*H'@)P4()P4) )Pha4 lHz_@K? 8@HzKZ_uhzK??@H`&5z_@K?&P@Hz_5yK?&"Ip DIrJM 4?i@6ZȀ`Z446YR)4K?&@^=4K?4k?J 45^7?1K?JJ_7>4?  H J 757?@4? 2  4f H5K`J47K?Ixߠ@5Ixp J!H"B 6?@("k?H5 K`J:7K?47?15^4K?ɜIxxF:k?J<6:J 6B5 HJ6x)7K?47?15^=4K?ɜIxxFk?J65H_ 76: HJxq7K?47?15^4K?ɜ(IxxIlHq44I h1@H}P = K?bk?1^U4K?Ixx4 44 4Ip JH?KGKH5K(4 K?16k?15Ixx5wIpAv(6H @IHk? 7?14^55K? 445Q4K?'IqK?1HnJ! h5HhnIk`9w5zHKhHb4BhbHw☷HzHaHb4 "Hb?HrxHqpHphHo`HnXHmPHlHHk@Hj8Hi0Hh(Hg HfHeHd4~@O?ˀeHb?ˀUHb?7?k?45k?7?1^6K?ɜIxxJ 2k?45^7?1K?74@=`H@JHP   K?14Z5k?14QZ/֢k?J47?1K 6@4 ^5K?ɜUIxxHw46 Q4&K?Ixx4J H@J 2k?45^U7?1K?741Yւk?J47?1K 45^ K?ɜ5IxxH47 Qu4`K?IxxH|47 Q54K?k?:@ K?1495k?1J]KO K?16U5-k?1J  4hk?74 J7?1 5^4K?ɜIxx7 J<5 HJKVx57K?47?15^E4K?ɜIxx 44 7?14k?^ 5K?ɜIxx <4 56: Hk?JVx-7K?47?15^ =4 K?ɜIxx K?1645k?1Ht46 Q 4K?◵k?ˀHb?k?o7hd? he?hf?hg?!hh?)hi?1hj?9hk?Ahl?Ihm?Q7Ek?7h?qK?K?~ 4 `  >k?k?74k?P}7K?bP4 H"4`4k?_@K? 0@k?_4K?"x@k?Q!HK?Hl?q K 5  745Z5k?Q4K?!J5 @ W hw?q h?qK?K?~@ ^k?k?75KHK`5y5k?e7K?k?_4K?H5k @5)K )8Hˀ4~ˀ4~K hI8Hk?Q 5zK?5 , ( `5)(?5kH=4 K5Z44k?Qe4K?8 4~Hb>Hm?QHl?IHk?AHj?9Hi?1Hh?)Hg?!Hf?He?Hd? @O?k?o7hd>he>hf>hg>hh>hi>hj>hk>hl>hm>hn>ho>hp>ׂ7Dk?76h|?IK?K?~4`  k?k?Hj>74 @7IXhx?qIZhz?yI]h}?ITht?4k?P4K?eJ "4 4k?q4 ` j k?P 5K?Ho?I6  7446k?Q 4K?$5 @ W hw?I h?IK?K?~@  ^k?k?74HH6`595k?M7K?5)5k?Qy5:K?Fp5F JBB#@0H@0I(@0 5HK(H5  ( 5?5)5JH= j "84 4 ` Jk?P]K?Hm?I75 M445k?Q4K?"5 @ W hw?I h?IK?K?~ ~k?k?74HH6`595k?7K? 5)Ik?Q5:K? 55iX  ( 5?5)5JF 444k?Q 4K? ˀ4~׀44~Hb>YHp>Ho>Hn>Hm>Hl>Hk>Hj>Hi>Hh>Hg>Hf>He>Hd>@O>HI(EHJ(%(ˀ54~Ha>ς (k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k?k?97C44KYK?44k8KUJk@KBpE ZHxK4 4 PJ@7`j@4`HoI D HtJ !:44zP5K?g@HzKU44J@7j@4wHmIQ5K?'@H|K44wKJ5?59J@ j@ ( HmIQ=6K?&H}K !244zP5K?fX@HxK44wJ@6j@4HkIzQ}5K?%HvJ44wJK5?59K@ k@ ( HlIQ7ZK?%HyK64zjHkIn_iK?HjIA Z h(XHj7H IOi`_A4zK?HlI 7?9h(hHk  ; Inip4zHbH]5_ kK? ˀK>Y?H(?I@ W ?h(IJ A(!G@iIHA(9G` IHIHaH!K?9h*HjK?9H IMiH|KiHK( #r #HjHapHw%"5J%"j XHgHbpE'45?P}4zK?Gˀ8K>Y(4&)_4K? 0@H_4K??@HtpHj "5 " !"5Z_@K? 4_5YK? IW iDIU @H4IYK= AU(5EiHI_HPIJIXK @AT(4EILI_HI IJ@>5Z">=HHbpˀ8K>Yˀ(K>YˀK>Y׀4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>@O>ˀ}K>YK4ke5H(4+4 -_5ZK? 04IJ_5ZK??@Hn#X45_@K?#5Z_5K?"I ڀ Hwp  2__? 5_2H 0IW00 0h I /2H80I_00h00h8I0Hvp  rI0 _( H h I0H(  h(I0 O iI 4Hup 8I_؅@I@H h45zQ4K?A(445zQq4K?u@ H@ I@ Y  h@IK IKU I<5<-IJuHap44Q46K?=@44Qa4FK?ILI E45=*H'4#44Q4wK? ˀ]K>YHdH4I HiHuJh xHtJjHcHehHk?ok>k>k>k>k>k>7C4_ ak?K?HaH97K?H Hx  Hwk? ) HbHG 7?1hHb; k?H\kH}4z4K(_k?K?)HK4zK?1i6K?1Hy _ yHxK?Hi; I)i&7?Y4z_4K?)*HhI4zK?YiHaK?Y H4@jHK?(HgH44zP)K9hK?h@Hga44P_y4K? 0@H_I4K??@Hi !J5:_y@K?! 4_59K? I? HJK  *CHKHKW4P4J 7j 4wI?K 4FI4QJ K?&I) >5:4~5HHga44P_4K? 0@H_Y4K??@Hi !Z5:_@K?!4_59K? @I< @HK?K  *C֠ HKHJ4P4K 6k 4I7J 4wI5QJ K?$I) >5:4~%HH|K44zPHXK?d`He4H_I4K? 0@H_4K??@HHZ4H4Q4wK?#_]HHK( KKY4P4zK?cHdH(4H4Q 4wK?4H#h@Hwp4 #P@HaH%DH" F@4 @@4zK?H}K44kP4zK?c@@HxK44Q 4wK?4#Htp !P@HbHD HvhHH|H(4KKhPH@ h@`h@H h(HuJH JHb*H8 XBJ84PA4zK?b 44w4`Q Q4K?4`!4K>YK>K>K>K>K>K>@O>ˀK>YˀK>YˀK>YˀK>YˀuK>YˀeK>YˀUK>YˀEK>Yˀ5K>Yˀ%K>YR4zK?4( "HyK44(@R4zK?HvYˀmK>YO4K?ˀEK>Yˀ5K>Yˀ%K>YK_K6x4@J?J?  J?J?  J?J?: J?J?  J?J?  TJ?  =   9 U J 4 J(J0  J8J@: JHJP  JXJ`  TJhJp  =JxJ  @6k?ok?77$k?448P4zK?H4 H K8  `4 wH0 :*H: Y8_4p z 0w@  rw24 }H8 tH@hu(X4 y4 b 4 t 4 x 4x a 4X u 48 v 4 |4 0 a*H?H h `H4  "J @4 zJ 4@^ yH J ^ 8*H8 " `H K0(HJ vH K0H? h| H@h`0@hd0K?YK?@O?k?ok>k>k>k>k>k>k>7Dk?KYK=KE Kk>4zQ K'@K?2F`!44PM4xK?!044 K]X & 7?a ] 4_5K?K?aAZU _ ZK?i5)(A\י \K?qEA6 4eAK?y֟^ XaTK?K? WiW K? ߉> _K>4P4K? 44y4Q4K?  @Qa4K?4K>YK>K>K>K>K>K>K>@O>ˀK>Y @Q4K?ςuK>Y@ @K?@ @k?o7Ck?K_ :^ e4zK?4hw_94zK?_4zK?K?Y@O?k?o7Ck?K_K8 K?Y4@O?K` "O4 K?ˀ0K?YQ @K? k?ˀK?YHwJ`4P7K?HKP4P4zK?@ ˀK?YHzKY`44wOeK?K?HK` 8K? 8k8K?Y@O?@ @K?@ @k?o7C@k?K?0ϟH7 K?Y@O?k?ok?4k?KXp  C<ӟ 0 KC` `K$ H02Hw@ ^u4zK? "Hc`?@*H#4|K?YK?@O?KCK!` P$HtЈ "^4zK??4|Hc`?@*UH#k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?Ԡ7C4K]K0KH00_4zK?!Hk  _?Ig8Q Y5:K? 744P 58K? Q5:K?2D jHjIYH4O4zK?@24459O4wK?  @Q4K?4K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O? 4p4*H+*H,4 HA\ӟ 0 i0 4i0 4i0 4i0 4i0 4hi0 4Hi0 4 (i00 i00i0EX i8IBG  I_ i AV * j‡ RAYIi@4 iI`iIIYi@iAZ@|I@|iAY?|怪"2ₒ  ZAUANI i _?0i 0iAB_ i 0i AUҠ?IҠ?iIA"P95K?7? !@I JQIK?!@I_i5`5J(I@ 7? (4:/@4y$00N8E' EHtj0 Q 4K?ς]K>I֟?i4z_M5YK?i K0I  iI׿i4z_5YK?i K0I i(I49 O 4K? 2II iK (I49 O 4K?=5`I?i@ @K?@ @k?ok?7C7$_%k?K?0ϟHxHu`J0_P7_? 7?4?_6``R  6`7` 7`77`  4 H|K?YK?@O?@ @K?@ @k?o7Ck?O4`K?0K?Y@O?@ @K?@ @k?ok? k?k?``k?!x7 ڈ :(oHK?!Q49K?0K>(oK?!Q49K?(oHK?!Q49K?(oHK?!Q}49K?K>H  K*H?7#K?!T4K?(oHK?!49Q4K?K>K?K? @O?@ @K?@ @C?04C70H4@JuJs k?JuhJsp k?k?/,/-ok<)k<1k<9kP@K?k=)kK=RK;k<)/40*H8k=9+4:(k<*`H()/4?hk<. )/42k<. )/41k Kk=K=k>QKB?,r Y  k=IB0I61B:61%(R \!6T? 4B7%" \%B46R?%Қ  rB961B4 V5 6? $Қ Ӽ?B9I B7 4$  ?>@46V??4X@ ٖW–P7?@֚  Z4_6R?`r @@ VR@ֲ  A@A  Bע 4 ]Zp (@]@K?I7 B74 24_ @K>Y w4J!Z4c K=)6k=)44P4K?44Py7>K?K=嚿k= K< K=PIK?K=)K;K4c K=J(K=HZHP@K?K=h\(x74k9 `4`K=9K=I 4t4 4ҏ4ht7? "Hb4U]Hh} "Hx4 \h| "Hw4 Aha!Hh7< \ w$AE0@00N0$I I U   6xhv0@8@E07<0N0& A8ֽ֜    h| Hy74pht7<?Hu'9E0@00N0'  ! \ BA 5 huHz vB *Ϡ *HK<8K<(K<45: HP!4%zK?I_@5I5B7K>Qk=B73B0K< kI t4l54`K>Q }4 ?ˉek=)K=IK=!J K> H6P <7K?= |k?ok? k?k?k?!k?)7#7Ek?K?x76K<؃!hK!P 4K?!H7HKX44HyO 7 K?! 454O4K? k?44k?45_ M4K?h|xHu ςxK>?O Y4K? k?9ˀ8K>ς(K>ˀK>׀4K>K?)K?!K?K?K? @O?HtJk?1Hzh@?%HxςK>k?K?147k?_ 4wK?PK?1K?Hb @4K?9hah@ @K?@ @k?o7#k?K? ǿJ44_e4yK?0ϟHwx64K?Y@O?@ @K?@ @k?ok?67k?7#4_7K?0ϟHxHwh 7?!?P4?? 6 4?_7?`Z  6 4V 6 4 6 4  H|xK?YK?@O?@ @K?@ @k?o7#k?O)4(K?h|ؓ h`K?Y@O?@ @K?@ @K_KX 2KK K58j84@ˀ@@ @K?@ @k?ok?k?67$k?K_7K HK8 ^4K? @^4K? J4OA4K?Hz\H}K 2׀4K?YK?K?@O?HJO I4K?HvJK JX ςuK?Y@ @K?@ @k?ok?7C7$k?KWJ bHK:X J4O4K?HHK@ *׀4K?YK?@O?HtJO 4K?ςK?Y@ @K?@ @k?ok?k?k?7C7%k?KU76J BHzOy4K?HxHtJ Hz4K_C cHvJC=פ =HdH HfHK? "K?YK?K?K?@O?ˀK?Y@ @K?@ @k?ok?k?k?7D7#k?KV76J BHO4K?HHJ H4JB% 9HH?K?CX cHHD K?YK?K?K?@O?ˀK?Y@ @K?@ @@kY0@ @K?@ @k?ok? k?7Ck?,!Xk?!O 7K?RU64֠ $74 N4zK?Hb \HbH_"*4 DHu J 4HKK7]kHeHHtJK?!O6K?P42!:O7K?RV64 $74 NU4zK?Ha <HaH? 4DHt JHzKWJ7jHxKHvJK?!Ou7K?4K>K?K? @O?ˀK>ˀK>@ @K?@ @k?ok? k?k?k?!7%7Ck?76N4HK?"87 h@OY4K?7O4zK? !7O4K? h@O4K?7O!4zK? !7O4K? h@Oi4K?7O4zK? !7O 4K?K> h@O4K?7O)4zK?  7O4K?Hk(4K>K?!K?K?K? @O?ˀK>ˀK>ˀK>ˀK>ˀK>@ @K?@ @k?oK?k?k?` k?K: K?Hw K=K?4O K? h@K?K?4N4xK? *4K?Y@O?ςK?YˀK?Y@ @K?@ @k?ok? k?7C7%k?6k?)KX :]4zK?4h}^4zK?]4K? bH P@HK_ 44zKO K? 2׀4K>K?K? @O?K>k?!4w4PK?)K?K?! (4}K>@ @K?@ @k?7Y!k?K?K?Y@7?@ @K?@ @@4@ @K?@ @k?ok?``(n4:(n494 P@K?*H?K7 7K?*`H76@T@K?4(n4:X4)O@K?4K?Y@O?k?o*H8k?+H?84#8 Hk?HyPK?K? B4cHw?Hy4~K?Y@O?@JuJs k?k?o7Ck?K_ K A *H:!@*H= Hw@ *H4  bHy0" R4Hu@_ӚK?ӜK?Y@O? r_KK?Hu444}4m4~]4~@ @K?@ @k?ok?7#7k?_7:K? ӟ4? 8@Hz KW0Hx  Ht Ht K?YK?@O?k?ok>k>k>k>k>7#7k?Ok>K?Hu( P 7?iK? 7Ht(! Hy(44NK>K?H( !!h44P !*K>4Ne K?aJK>44PN]7?IK?!@H7: K? 4K>N K?`K>44PN7?IK? zH7 K??w4Hx(4@ P a4K?ς8K>Y @P )4K?4K>YK>K>K>K>K>@O>k?ok>k>k>k>k>k>7#4k?KNk>K?Hv( P7?iK? 7Ht(%h@H|0P K? 7Hu0%"Hy(K>4N4K?H( \$@Hy@K>4N & K?D@Hy0K>4N4K?Hw0 ݋$JHi( #44 P #K>4Ne K?cK>44PN]7?QK?#H}pK?Y  K>4N49?K?c`@K>44N7?)K?#"K?)K>N 6K? "7K?)K>N]4K?K?)"@H K? 7? K?4!K>4N K?bK>44PN7?QK?!@HypK?Y &  _ K>4N6?K?aK>44N7?)K?!P@K?)K>4YN@K? !7K?)K>N}4K?K?) H K? 7? K?>-4H}(5-@ P4K? @P4K?ς`K>Y @P4K? @Pa4K?4K>YK>K>K>K>K>K>@O>@ @K?@ @k?ok> k>k?Ԡ7CKD44 7?q4wN M@K? r4K=K>K> @O>H4N4zK?d4ςhw4 ˀ}K=4?4NU4zK?@ ˀ=K=(4907?qN m4 K? ςh`7>44xN 4wK?4x ˀK=(49`7?]N 4K? (@N4K?ˀ=K=*H=Hk>)4k7?IN 54K?k>!K>)K (@N54K?ˀK=N4zK?K>!  447>QN u4wK?4 ˀ%K=G>U4 2\ (@Nm4K?ˀK=4 4z_ 7>QK? ˀK=HK>! ?46N]4zK?@ ˀEK= H  N4zK?  ˀK=44z_=7>QK?;@ˀK=ˀK=k?ok? k?k?k?!k?)k?17#7k?KE !*H&H`"!rHHG!X@^M4K?!HH!K07?a4^4K?K?a “ 0K?i  H H}7 tHNEHK? 6 6 "7??7 >4`HȈ>e@4K>K?1K?)K?!K?K?K? @O?ˀK>k?o7Ck?N5KZK? X@Hb@Cu 49׵ K?Y =V \@O?HyC87?7?6 4 \ ם  Bց  ZK?Y \@O?k?/,ok=k=!k=)k=1k=9k=Ak=Ik=Qk=Yk=ak=ik=qk=yk=k=k?ՠk=k=k=47>YJk7>Yk 4Ok=K?k=4444 7K=)zK>k= O k=K? 7K=)(@OK=K? 7K=(@N 5K=K?K=44OK>K?K=44OK=K?K=4Oy4K?K<5  4? 1  k=O7K?  7K=Ɉ'@OeK=K? 7K=ш 'K=H*4l &H4)46. *H-IX` IYK:X IJ^ =5ZK?&IOIW4%PJ0 k= 7?a5Z^y6K?K?a$ 0K?i@ $J $K= @0)@0IB@0HR@02A K?֟ tҕK?a֢  ulK?iAzX RAt@ =ր W awҙ ayJ J Ӝ=׼ Ӽ׀ Ӗ^avK?q7 x6 `Et֝ etK?y wK?K? Yiy i`(a`0_ih8K?i`HK=7i|@  7=K=K= K=&00N8D&D  Z 6jHIz@7=K= &00N8D&D K= 2 = 6Iz@K=K= KJNH2`K?576V 7K?5JO 15K?N-JK?7  RW6  : 5 RX7 ? 5kP5:6`I]K6x 7IJ 5@9IX`K=K=4O4K?K=ً @K=K=4O4K?K=< @K=K=4Oq4PK?K=\ @@K=K=4zO)4K?K=у ˆ!!ڈ!"`":4K%@O 4K?>@O 4K?=@O 4K?`=4O 4zK?4@ @K?@ @k?ok= k=k?Ԡ7C7$KZ7=O @K? (@N4K?ˀK44>k>k?k?k? HЀ Xk?!K`" *KK?!4YJ0k?!Kȋ?@k?9K?! 4k?177>ik?)7>q4zk=)k?Ak?Ik?Q_ ]k?YK?0ˀ"k?qK>i 4$k?K=) 6 k?aK>q k?i7?1k?yJ? k?J? k?J? k?J? k=1k? \k? 6k? k?Tk?=k? k? k? k?J k?J( k?J0 \7>yk?J8 6k?J@ k?JH4(k?6O49 K?Hv(49 k=!J0O7>K?O @K?K=!7>O7K?O@K?K=!7>OA7K?(G=49 O7>K?K=1(49O7>K?7>B?4@B?B?B?4ֹ B?B?ִ4xg>B?͐ 0b?B?Փ0b?B?ג0b?B?ْ0b?B?ے0b?B?ݓ0b?B?ߓ@0b? 0b?0b?@0b? 0b?0b?0b?000@0 0 0 @0  000000@0 00@0 00000 0 @0 00B @0B" 0B$0B&0b&B(0B*0B,0B.0b B0@0b"B2 0b$B4@0b(B6@0b6B8 0b*B:0b,0b.0b00b20b4 0b8B< 0b<@0b:6x7>y44xO4wK?(ˀ447>Oa4wK?4\(ˀJk?K>i4z7>_K>qK?04KK?K? @O?K?)N]4K?K?!P4K? 7Ƞ}4h K>h0K?!N)hHK?hK>h`@ @K?@ @k?o7Ck?Mu40K? K?Y@O?@ @K?@ @k?o k4 k4k4k4!k4)k41k49k4Ak4Ik4Qk4Yk4ak4ik?Ԁ7C4448MU@K?h|#4K3K4iK4aK4YK4QK4IK4AK49K41K4)K4!K4K4K4 @O4k?K44 4k?K5_%4zK?$@K54N 4zK?47444 N4wK?DJK4?7k?"B?k? ( 8@ (0ׇ"z7?"!=74_ Hk?K544k?_4zK?#2k?H5 7>k?NKK?K57>4_U4zK?"HK544zN K5K?0474*H' (4(4 4 4 4 4 44@ˀK3K54N A4zK?m74K575 4N14wK?K5='74Hx775qNM4K?74K5754N4wK?K5<744N 94zK?K>H|HwJ > >X>t>>???8?T?p???@@,A<A@A|ABBBCCtCxCCCCCDDlDpD|DDDDEEHELEFF4F8FFGGdGGH0H|J4J8JJJJKlKKKLXLM8M<MMNNODO`OOPpPtPQQHQLQ`Q|QQRR,RRRRS`SdSTPVL,VPY,Y4[+[]h+]^^<` `a abbPbbbbcc,cDc`chccdg gghghlhphhhiipitjjkkkkklllllllm m(mmnno o$ooppppppppq$q@q|qqqrrrrsTsXs\sxtPtTt`t|ttuPulv vvtvvv|(|(HLP D` hlp4hPTt<hh4dh8d Xt``dl$(PLP,Hh,0hl < (H|(D  $PThlt    < @ PT,08$(`''D`!@!DD$Hl$.X.t$ Ôð< @ ʹ͸|Ҙ ,`ӈӌӜӸHL0\(`,048hl$8(<8@$@`|܀ܜ 4Xt0pt\`d,08\0LPTDH 8   00TXdh D` $$( (l(p($(D|hl hlLPlp    ,     \ x dh|<@,Htx|\(!(!0#L)#P#)#$$$($%%H%L%%%%&&& &&&&$&(&0&4&<&@&H&L&T&X&`&d&l&p&x&|&&&&&&&&&&&&&&&&&&&&&''' ''' '$','0'8'<'D'H'P'T'\'`'h'l't'x''''''''''''''''''''''(((((( (((,(4(8(@(D(L(P(X(\(`(d(h(l(|((((() ))))T)X)l)p))** *x*|**+,+0.G.2p2t233l3p334<4@4l4p<Ѐ(<>DЀ(>H>>>>>>>>@ @C CD DDDE E$E(E,EEFFFFI IJ@ JDJdJhJ|JJJJJJJKK KTKXKKKKLLLLMMMMM0M4MHMLMTMXM\M`MdMhMlMpOOO$O(O`OdOOPPPlQ4Q8QTQXRRS@SDSTTlTpUhUlVxV|WlWpWWWWWX[[]]8]]_` eD(eHfx(fg0gj 0j<jpjtl\l`n nn4n8nDnHnlnpn|nnnnno4oPoooooooorrw  w{  {} }<@ptlpDHdh (,L P |DP@dP@h\x,H@D\x048T$(DLPt 4 (D`dptx dx|T Xx | TX@00D$00@̀0̜d̀,0ΈΤϘϜXt|ҘҠҼ\ t       D  p    * , $        $ x l    p    $  < T p 8 P h  8 D       τ @ Ь  x ќ    P h ׬  8 P ب  4 ِ ٸ   ڀ ژ ۠ ۸ t ܠ   P ݰ  |   0    $    ( x     0  \ t ,    8 <   <  t L   \ t X p <    4 4    \  @    < t  # #@ #X '< ' ) )h ) *0 *H * - . / / /` / / / 0 0 0` 0| 0 0 1< 1| 1 1 2 2 3 3T 4 5 5$ 6 6 7D 7 7 8` 9P ;t ; ; < <<  >\ > ? ?< ?t ? @ A B C C D D D E E F F G G4 H4 HL J Kp L\ Lt M N N OH O P Q Qd Q Q R R S T Y ]l ] ^ ^$ a b b8 c cH cl c c g gl h h i j k k l m n o p q( q s` td t t uT vx v v    T l H  t 8 P   x  $ l  l        h     \   0 p   T l   0 l   $   L , x       d |  H p \     Ø   Ҁ 0 H Ӡ  ( d ܄    \    h     ` x 4      H     ,      `    0    , ! # # % % 2 F PT W W ] _ f| j$ o8 o         ` 0    ` <  ,  x   H h | h  ( ̄ h Ό  \ Ҁ Ҥ  @,s@@&@@)@$@@( @@`@~0@@@@#@@@+@@@@ @$@@0@@#0@~h@~`@A( 80<lD@.8@Ap4`@. {D{{@ { {xpx@@@,w`x0wH@@v@)v vHv@@)@&tu`u@s@&Hs@%r@%rX@@%PD(@@DC`C8A@Ap@>@@> >@@(\?t=;t;<<1</  \(P/`ҀC000|0`/܄\DuTvx00ӠdccH0cl0 h `4H,   `0f|j$̄0xlp(phH`] hhoo8WB\ҀҤΌ/۠@@"@j@z >>@*@2>>>>???0?@?p?????@ @P@`@p@ngl ngl D(D@DPD`DpDDDDDDDEE(E@EXEpEEEEEFFF0FHF`FxFFFFFGG G8GPGhGGGGGGHH(H@HXHhHxHHHHHIII0IHI`IxIIIIJJ J8JPJhJJJJJJKK(K@KXKpKKKKKLLL0LHL`LxLLLLMM M@MXMxMMMNN(NHN`NxNNNNNOOO0OHO`OxOOOOPPP0PHP`PxPPPPPQQ Q8QPQhQQQQQQRR(R@RXRpRRRRSS S8SPSpSSSSSTT8TXTpTTTTTUUU0UHUhUUUUUVV(V@VXVxVVVVWW8WXWpWWWWXX0XPXhXxXXXXYY(Y@YXYpYYYYYZZ(Z@ZXZxZZZZZ[[([@[X[p[[[[[\\ \8\X\x\\\\\]] ]8]P]h]]]]]^^ ^@^X^p^^^^^__0_H_`_____```0`H```x`````aa0aPapaaaabb0bXbbbbcc c@c`cxccccddd0dHd`dxdddde e8ePeheeeeeff(fHfhffffgg g8gPghgggggghh0hPhphhhhhii8iPipiiiijj j8jPjhjjjjkk k@k`kkkkll l@l`llllllmm(m@mXmpmmmmnnn0nHn`nxnnnnoo o8oPohoooooopp(p@pXpppppppqqq0qHq`qxqqqqqr @rp@#0@%@rh@#@%@r`@$@@%h@rX@$@%P@rX@$r`@$@rh@#rp@#0@:rNrbrbrdrdrrrrrsrcsgststsis(is0es8ps@Ns@@ sss@@ s@@ @@ @( @&@+@@)@,@@B@J@R@Z@b@)  @j@r@z@j@@z@@@@j@r@z@j@@z@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@"@*@2@:@B@J@@@@R@Z@b@b@@j@r@z@@@@@@@@@@@@)  @j@r@z@j@@z@@@@j@r@z@j@@z@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@"@*@2@:@B@J@@@@R@Z@b@b@@j@r@z@@@@@@@@@@@srecsymbolsrecstartendsizebinary@) @j@r@z@j@@z@@@@j@r@z@j@@z@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@@ @@J@@@@R@Z@b@b@@@ @@@@@@@@@@@@@  @j@r@z@j@@z@@@@j@r@z@j@@z@@@@@@@@@"@@@@*@@@@@@2@@@@@@@@@@@@@@ @@@@@@@:@B@J@R@Z@J@@@@R@Z@@@@b@j@r@@@@@@@@@@@@z@  @j@r@z@j@@z@@@@j@r@z@j@@z@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@b@b@@ @ @@@@@@@b@b@@@@@@@@@@@@@@@/$TEXT$$SHLIB_INFO$$MILLICODE$$LIT$$CODE$$UNWIND_START$$UNWIND$$PRIVATE$$PLT$$SHLIB_DATA$$DATA$$SHORTDATA$$DLT$$GLOBAL$$SHORTBSS$$BSS$$GDB_STRINGS$$GDB_SYMBOLS$R_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_NO_RELOCATIONR_ZEROESR_ZEROESR_UNINITR_UNINITR_RELOCATIONR_DATA_ONE_SYMBOLR_DATA_ONE_SYMBOLR_DATA_PLABELR_DATA_PLABELR_SPACE_REFREPEATED_INITREPEATED_INITREPEATED_INITREPEATED_INITR_RESERVEDR_RESERVEDR_PCREL_CALLR_PCREL_CALLR_PCREL_CALLR_PCREL_CALLR_PCREL_CALLR_PCREL_CALLR_PCREL_CALLR_PCREL_CALLR_PCREL_CALLR_PCREL_CALLR_PCREL_CALLR_PCREL_CALLR_PCREL_CALLR_PCREL_CALLR_SHORT_PCREL_MODER_LONG_PCREL_MODER_ABS_CALLR_ABS_CALLR_ABS_CALLR_ABS_CALLR_ABS_CALLR_ABS_CALLR_ABS_CALLR_ABS_CALLR_ABS_CALLR_ABS_CALLR_ABS_CALLR_ABS_CALLR_ABS_CALLR_ABS_CALLR_RESERVEDR_RESERVEDR_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_DP_RELATIVER_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_DLT_RELR_DLT_RELR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_CODE_ONE_SYMBOLR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_MILLI_RELR_MILLI_RELR_CODE_PLABELR_CODE_PLABELR_BREAKPOINTR_ENTRYR_ENTRYR_ALT_ENTRYR_EXITR_BEGIN_TRYR_END_TRYR_END_TRYR_END_TRYR_BEGIN_BRTABR_END_BRTABR_STATEMENTR_STATEMENTR_STATEMENTR_DATA_EXPRR_CODE_EXPRR_FSELR_LSELR_RSELR_N_MODER_S_MODER_D_MODER_R_MODER_DATA_OVERRIDER_DATA_OVERRIDER_DATA_OVERRIDER_DATA_OVERRIDER_DATA_OVERRIDER_TRANSLATEDR_AUX_UNWINDR_COMP1R_COMP2R_COMP3R_PREV_FIXUPR_PREV_FIXUPR_PREV_FIXUPR_PREV_FIXUPR_SEC_STMTR_N0SELR_N1SELR_LINETABR_LINETAB_ESCR_LTP_OVERRIDER_COMMENTR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVEDR_RESERVED(*none*)som@@ /@j@r@z@j@@z@@@@j@r@z@j@@z@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@"@@*@2@:@B@@@J@R@Z@b@j@r@@z@@R@Z@@@@@@@@@@@@@@@@@@@ @@/ @@/0 @@/@ @@/P @@/` @@/p @@/ @@/ @@/ @@/ @@/ @@/ @@/ @@/ @@0 @@0 @@0 @@00 @@0@ @@0P @@0` @@0p @@0 @@0 @@0 @@0 @@0 @@0 @@0 @@0 @@1 @@1 @@1 @@10" @@1@" @@1P$ @@1`% @@1p% @@1' @@1' @@1) @@1* @@1* @@1* @@1* @@2 @@2 @@2 0 @@200 @@2@0 @@2P0 @@2`0 @@2p0 @@20 @@20 @@20 @@20 @@20 @@20 @@20 @@20 @@3> @@3? @@3(@ @@3@@ @@3P@ @@3`@ @@3p@ @@3@ @@3@ @@3@ @@3@ @@3@ @@3@ @@3@ @@3@ @@4@ @@4 @@4 @@40P @@4@P @@4PP @@4`P @@4pP @@4P @@4P @@4P @@4P @@4P @@4P @@4P @@4P @@5P @@5P @@5 P @@50P @@5@P @@5PP @@5`P @@5pP @@5P @@5P @@5P @@5P @@5P @@5P @@5P @@5P @@6P @@6P @@6 P @@60P @@6@P @@6PP @@6` @@6p @@6 @@6 @@6 @@6x @@6x @@6 @@6 @@6 @@7 @@7 @@7 @@70 @@7@ @@7X @@7p @@7 @@7 @@7 @@7 @@7 @@8 @@8 @@80 @@8H @@8` @@8x @@8 @@8 @@8 @@8 @@8 @@9 @@9 @@98 @@9P @@9h @@9 @@9 @@9 @@9 @@9 @@9 @@: @@:( @@:@ @@:X @@:p @@: @@: @@: @@: @@: @@: @@: @@: @@; @@; @@;( @@;8 @@;H @@;X @@;h @@;x @@; @@; @@; @@; @@; @@; @@; @@; @@; @@< @@< @@< @@<0 @@<@ @@ @@> @@> @@>0 @@>@ @@>P @@>` @@>p @@> @@> @@> @@> @@> @@> @@> @@> @@? @@? @@? @@?0 @@?@ @@?P @@?` @@?p @@? @@? @@? @@? @@? @@? @@? @@?@@@@@@@@@ @ @ @ @ @@@@@@@@@@@HHHHXXXhphphxx        !      !x (08@HxxPX`hpx@.8t@.@t@.Pt@.`t@.ht@.pt@.t@.d@.d@.d@.d@.g@.d@.g@.s@.b@/N@/N  h@*@2@~`@@h@*@2@~ hx@*@2@~  hp@*@2.reg.reg.datahpux-core@ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@@ @ @@@@@@@@@@@@ @@@@@@@@@@@VRT32ihex@~0@@%@%@%h@%P@@ @&xtekhexbinutils/binutils-SHLIBS/opt/binutils/lib/libopcodes-2.11.2.sl010055500000000000003000002300000732753177100224720ustar000300000000000000@d0@0 ((((Gc(Ql@  92453-07B11.17;^`X"ooX X hhX!++X 8ǘǘX Hxx$X XːːL>(X@X|>(XX@XX>(аP@P>(!H$@aH$Y ? Ql@$TEXT$$UNWIND_START$ $UNWIND_END$$RECOVER_START$ $RECOVER_END$ $PRIVATE$$BSS$$DLT$$PLT$ $SHLIB_DATA$ $SHLIB_INFO$$CODE$$LIT$$DATA$ $SHORTDATA$ $MILLICODE$$UNWIND$MILLICODE$y@ nJX Pmp(O gy 4 {u/P!xkeU)!xT!xr'6@JRdJV|ɿ@C/!l˴:0gz 4 z\u/ xSeMU)xWxq'60XU/xU<UR UbUuUDUUR@U RXX`hp (08 @HPX `$(h,p0x48<@DHXLPXTX\`XdhXlpXtpxx|X HX`hX (08@HPX`hX  $(,048<@XDHL\`dh l(|HX`hpX`hpP` (X px $( ,(048@<H@XD`HhLpPPTXX\`dhlp`thx|0 (X (08@HX`hpx  X$`(h,p0x48<@DHLPTX\`dhlptx| (08@HPX`hpx    ( 0 8 @ H P X $` (h ,p 0x 4 8 < @ D H L P T X \ ` d h l p t x |   ( 0 8 @ H P |x  |x  |  | !|! !|!$!0|!<!H|!T!`|!l!x|! !|!0!|!@!|!P!|!`!|!p"|"" |","8|"D"P|"\"h|"t"|""|""|""|""|""|##|##(|#4(#@|#L8#X|#dH#p|#|X#|#h#|#x#|##|##|#$|$ $|$$$0|$<$H|$T$`|$l$x|$$|$$|$ $|$0$|$8$|$H%|%X% |%,h%8|%Dx%P|%\%h|%t%|%%|%%|%%|%%|%%|&&|&&(|&4&@|&L&X|&d &p|&|0&|&8&|&H&|&X&|&h&|&x'|' '}'$'0}'<'H}'T'`}'l'x}''}''}''}''}''}'((}(8( }(,@(8}(DP(P}(\X(h}(th(}(x(}((}((}((}((}))}))(})4)@})L)X})d)p})|)}))}))})()} )0)} )@*}(* H*}(*$X*0}0*<h*H}0*Tx*`}8*l*x}8**}@**}@**}H**}H**}H*+}H++ }P+,+8}P+D+P}X+\(+h}X+t8+}`+H+}`+X+}h+h+}h+x+}h++}h,,}p,,(}p,4,@}p,L,X}p,d,p}x,|,},,},,},,},(,},8-}- H-}-$X-0}-<h-H}-Tx-`}-l-x}--}--}--}--}--}-.}.. }., .8}.D .P}.\ (.h}.t 8.}. H.}. X.}. `.}. h.}. p.}/ x/}/ /(}/4 /@}/L /X}/d /p}/| /~/ /~/ /~/ /~/ /~/ 0~ 0 0~ 0$ 00~ 0< 0H~ 0T 0`~(0l 0x~(0 0~(0 0~(0 0~00 0~80 (0~@0 81~H1 H1 ~P1, X18~X1D h1P~`1\ x1h~h1t 1~p1 1~x1 1~1 1~1 1~1 1~2 2~2 2(~24 2@~2L 2X~2d 2p~2| 2~2 (2~2 02~2 82~2 @2~2 H3~3 P3~3$ X30~3< `3H~3T h3`~3l p3x~3 x3~3 3~3 3~3 3~3 3~3 4~4 4 ~4, 484D 4P4\ 4h4t 44 44 44 44 44 4 5 5(5 5(054 (5@05L 85X05d H5p05| X505 h585 p5@5 x5H5 5P5 6X6 6X6$ 60X6< 6HX6T 6`X6l 6xX6 6X6 6`6 6h6 6p6 6x6 77 7 7, 787D (7P7\ 87h7t @77 H77 P77 X77 `77 p78 88 8(84 8@8L 8X8d 8p8| 88 88 88 88 88 99 99$ 90 9< 9H(9T 9`09l 9x899@99H99P99P9(9X98:X:H: `:,X:8h:D`:Pp:\p:hp:t:x::x::::::::;;;;(;4;@;L;X;d;p;| ;;0;;@;;P;;`;;h<< p<<$<0<<8>`>@>(`>4H>@h>LP>Xp>dX>px>|`>x>p>>>>>>>>?? ??$?0?<?H?T?`?l?x??????? ??0??@@@P@ @,X@8@Dh@P@\x@h@t@@@@@@@@@@@AAAA(A4A@ALAXAdApA|AAAAAA AA(AA0BB 8BB$HB0B<PBHBT`B`BlhBxBxBBBBB BB BB(BC0CC 8C,C8@CDCPHC\ChPCtCXCC`CChCCpCCpCCxDDxD D(D4(D@DL8DXDdHDpD|XDDhDDxDDDDDDEE EE$E0E<EHETE`ElExEEEEEEE(EE8EEHFFXF F,hF8FDxFPF\FhFtFFFFFFFFFFFGGGG(G4G@GLGXGd(GpG|8GGHGGXGGhGGxGGHH HH$H0H<HHHTH`HlHxHHHHHHHHH(HH8IIHI I,XI8IDhIPI\xIhItIIIIIIIIIIIJJJJ(J4J@JLJXJdJpJ| J J(J J8J(JHJ(JPJ0JXK0K `K8K$hK08K<pKH@KTxK`@KlKxHKKHKKPKKPKKXKKhKLxLL xL,L8LDLPL\LhLtLLLLLLLLLL(LM8MMHM(M4XM@MLhMXMdpMpM|xMMMMMMMMMMNN NN$N0N<NHNTN`NlNxNNNNNNNNN NN0OO@O O,PO8 OD`OP O\pOh(OtO(OO0OO0OO8OO8OO8PP8PP(@P4P@@PLPX@Pd Pp@P|0PHP@PHPPPHP`PHPpPPPQPQ QPQ$Q0PQ<QHQLQPQTQXQ\xQ`Qd Qh|P~H~~l~~x~    Alibopcodes-2.11.2.slgeneric_symbol_at_addressdisassemblergeneric_print_addressprint_insn_hppabuffer_read_memoryperror_memorygeneric_strcat_addressdisassembler_usagememcpyabortdcgettextstrncatstrlenbfd_getb32bfd_get_archstrcatstrchrsprintf7!?9" 7]!9ӽ9Y4!:ӽ9Y4T ;|ӽd Y"ӽ9"ӽ@>B! @ Z A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  a@@@ @7]]B@]@*@@]@@ @z@ @@@ : k? k?k?XZ]XZ]XZ]XZ]d@"Z]> ZZ]> ZZ]9 Z8 =@Y :Z @Z@ ZZZ] ZZ @"ZY :ZZ@= ZZZ@= Z ZY :Z]ya: =]: =]  : =@4ZBu ZZZZ ZZ]ya: =]: =]  : = @4ZB ZZZM ZZY :}@4Be]yZZ5@*Z@ya AZ@ya AZ]ya A @Z@] Z]: =] y a: =4Y(ZYY8Z@] Z]: =] y a: =4Y(Z YY8Z]Y Z @*Z@YA AZ@YA AZ]YA A @ ZZmZopcodesUnknown error %d Address 0x%x is out of bounds. %08lx0x%s @L08`lt(0t,$,$,,,,,,,,,,,,@  `t>8><:@9=8>>>8>>>8>;;:>>) >>>>>>6==1`8p:X6>:p>;`;;<@<<?>7 :9h65)X9557?|8L8(>>>&D=`>&,&,)<>&t>=686\66=6:995)0&\;8:7&=8=`:>94'%&&L''$''''''''''''''%8'''%''''''''%h%'''D'''&&&&'''''''% ''''x.,.......................+\'....,.-.)8...)..,+..).*)......*t+'(\.(.(,x* ..)8'.((-)'+.*)\'X**H1./11111111110\1.h11.1/(101/1X11111111/`11/1-111110$1.81111.. 01111,CcY<>?!@+&U~FfGHINnOoZMadu|/=0123%e$m}ldicallretcmpibcomibcmpbcombaddbaddibnopcopymtsarlddldwldhldbstdstwsthstbldwmstwmldwxldhxldbxldwaldcwstwastbylddaldcdstdaldwaxldcwxldwsldhsldbsldwasldcwsstwssthsstbsstwasstdbystbysldoldiladdilbblgateblrbvbvebeblemovbmovibcombtcombfcomibtcomibfaddbtaddbfaddibtaddibfbbbvbclrbtspopbtspushnompushbtscmpclrcomclrorxorandandcmuxoruaddcmuaddcmtdcoridcoraddiaddioadditadditoaddaddladdoaddcaddcosubsubosubbsubbosubtsubtodssubisubiocmpiclrcomiclrshladdsh1addsh1addlsh1addosh2addsh2addlsh2addosh3addsh3addlsh3addohaddhavghshlhshladdhshrhshraddhsubmixhmixwpermhshrpdshrpwvshdshdextrdextrwvextruvextrsextruextrsdepddepdidepwdepwizvdepvdepzdepdepzvdepivdepizdepidepibreakrfirfirssmrsmmtsmldsidmtspmtctlmtsarcmmfiamfspmfctlsyncsyncdmaprobeprobeiproberproberiprobewprobewilpalhalcipdtlbpitlbpdtlbepitlbeidtlbaiitlbaidtlbpiitlbppdcfdcficfdceficediagidtlbtiitlbtmtcpumfcputocentocdisshdwgrgrshdwgfwgfrfldwflddfstwfstdfldwxflddxfstwxfstdxfstqxfldwsflddsfstwsfstdsfstqsfaddfsubfmpyfdivfsqrtfabsfremfrndfcpyfcnvfffcnvxffcnvfxfcnvfxtfmpyfaddfmpynfaddfnegfnegabsfcnvfcmpxmpyufmpyaddfmpysubftestfidpmdispmenbspop0spop1spop2spop3coprcldwxclddxcstwxcstdxcldwsclddscstwscstdscldwclddcstwcstdflagsr1rpr3r4r5r6r7r8r9r10r11r12r13r14r15r16r17r18r19r20r21r22r23r24r25r26dpret0ret1spr31fpsrfpe2fpe4fpe6fr4fr5fr6fr7fr8fr9fr10fr11fr12fr13fr14fr15fr16fr17fr18fr19fr20fr21fr22fr23fr24fr25fr26fr27fr28fr29fr30fr31rctrcr1cr2cr3cr4cr5cr6cr7pidr1pidr2ccrsarpidr3pidr4ivaeiemitmrpcsqpcoqiirisrioripsweirrtr0tr1tr2tr3tr4tr5tr6tr7,=,<,<=,<<,<<=,sv,od,tr,<>,>=,>,>>=,>>,nsv,ev,*=,*<,*<=,*<<,*<<=,*sv,*od,*tr,*<>,*>=,*>,*>>=,*>>,*nsv,*ev,nuv,znv,uv,vnz,*nuv,*znv,*uv,*vnz,swz,sbz,shz,sdc,swc,sbc,shc,nwz,nbz,nhz,ndc,nwc,nbc,nhc,*swz,*sbz,*shz,*sdc,*swc,*sbc,*shc,*nwz,*nbz,*nhz,*ndc,*nwc,*nbc,*nhc,m,s,sm,ma,mb,b,m,e,e,m,sgl,dbl,quad,false?,false,?,!<=>,=t,?=,!<>,!?>=,?<,!>=,!?>,?<=,!>,!?<=,?>,!<=,!?<,?>=,!<,!?=,!=,!=t,!?,<=>,true?,true,u,l,r,us,ss,w,tsvfpe%d%sR-%x%x%scfCY?-+nHNZFIuv sr%d%s ,bc ,sl ,co ,o,gate,l,push,pop,m ,i,z,dc%s,c%s,tc,db,b,%d%d%d%d ,n ,n%%r1%%sr0,%%r310%d%%sar,%d%c#%8x@P@K?@ @JuJs k?k?77Uk?J74776&J77J 7?Y'A8G'IFXI 6 BJ _6K?K?Y4@7?K?Y4 @7?@P@K?@ @JuJs k?k?ok?k?77Dk?Kk?* p4:*49_E4 K?HzK?74 17K?hK?Y*49H_4 K?HzK?7K?7K?K?YK?@O?@P@K?@ @JuJs k?k?ok? k?``7$(497X7?a_m@K?HH(497?a7K?K>K? @O?@@K?@ @JuJs k?JuJs k?JuJs k?k?ok? k?7#7 @*7X498_7?aK?_4zK?k?_7?aK?K? *4z_7?aK?HK>_]4zK? 4z_7?aK?K>K? @O?@ @K?@ @@4@P@K?@ @JuJs k?k?7_k?K?4* *`H70J@4K?Y@7?@ @K?@ @@=}@!6?  @ =}@YW@ 7w@7?@ k?o79?k?y@WW_K?!K?Y \@O?44 V T ?]ֺv@ \ע ]3M@ 7\ע ]֚1  X@ \{ X _4ҟ \ W5 Av@ \֢׿5 U ]4 Wӟt W4֙ X ]5 =Y֚ @ \֢׿ U ]{ WӟU W4֙ X ]ҡ=Y֚v@ \JuJs k?k?ok?*4?4?  : K?Y`K?Ycc4wa4 784y#xk7< ׀ PC44 4u B _U@K?K?Y4|@O?=7?4?*48 @4@4K]K 2 4@KYK6 24?@KZK\ 24@ @4,@4"@4*@4@k?ok?7C7:7 4?*48 8 _4K?`H C4_K? C"6@_ K? C#7 @_ K? C_m`K?p C#875@_] K?0 C#7 @_ K? C_`K? C"6_#K? C_M` K?h C"6C_@K?( Cz K?Y_@K?K?Y4|@O?k?77_k?K6 (K:*`H8(7  *`H9 7947K?K?Y@7?k?77_k?K6 (K:*`H8(7 *`H9 794  7K?K?Y@7?k?7k?7_HPK6* _K:49*p7u7K?K?YK:* (49**`H8(7 *`H= 7407K?K?Y@7?k?7*`H8(k?7 K6K:7m7K?K?Y@7?k?7k?7XK6`@K:*49)7K?K?Y@7?*49(7K?K?YW_BX>@ \k?7Zk?_4 K?K?Y@7?k?7Zk?_54 K?K?Y@7?@\@\@\@\[k?7Zk?_4K?K?Y@7?k?7Zk?_U4K?K?Y@7?k?7_k?\W? Z֟ Y׸  V5 6Z_e4 K?K?Y@7?k?7 k?] \BT> A!U k BBB Z_4*K?K?Yל k@7?k?7]k? JW Y֚  Z_54K?K?YלB@7?k?7Vk? JYW _׷ k Uך  Z_4"K?K?YלB@7?k?7Bk?ע JTX _ָ kY[ W  A Z_ 4,K?K?YלB@7?@@K?@ @JuJs k?JuJs k?k?ok< k<k<k4E7K? 7Hh547K?4?K;KK?*`H&(7#7!Q4 424 7 HH ( H  b790?@(HH49$4x7K?ψK;(HH49"pH57K?HB(4:"_K? 8@(HH49" 7K?H@6_k=qokq(i]k=4=X4k= )}_k>i=!?Yk=jkk=w5pk=ְwk>yv 6 k=it_ 4 k>z:k> K<5տk>9yYk>A6k>K<֊}>)rb[k>!qBk=9ryk>z\tk=yu4k=AK>q4A }?k=4k=Q4`ןkk=Yr^lk=am?k=4@nk<4O4kk=4k=4k=tk<4@k<4 k14k=!K>qk>IK<_Jk>Q70k= 4@k<4k<4@k=yk=k>akk=)kY7?K=1E4? V " K=9_4K?4K=A_ 4K?4K=A_4K?45_ u4K?t44@_K=I7?4? 5_ 4K?4 (5_ 4K?4_ =4K?4 (K=A_ 4K?\4_ 4K?44(HH49"p54@7K?K=Q(K=A_ 4K?4_ 54K?4 (K=9_ 4K?T4_ 4K?,4 (K=9_ E4K? 4_ u4K? 4K=iK=YK=a( Z_ 4K? |4_ 4K? T4K=AK=y4Z_ 4K? 4K=9K=y]Z_ }4K? 4K=y ,Z_ E4K? 4K=yK= Z_ 4K? \4K=yK= Z_ 4K? 4(HH49"p54P7K?K=(K=9_ 4K? 4_ 4K? t4K=9_4K? D4_ 4zK?7_ 4K? 4(HH49"x>7K? 4H_ 54zK?(H49"76Vu7K? <44@WK=6? _4?  Kq(H49"H 7K?4(HH49"y7K?D4K=%&(HH49!!7K?4K=qH8H(49#@7K?4(49"7K?\4 F(HH49#PA7K? 4K=(HH49#`7K?4(HH49"p 7K?d4(HH49#p I7K?4(HH49# 7K?4 (HH49" 7K?t4(HH49#a7K? $@(HH49" 7K?4(HH49#7K? @(HH49" 7K?T4(HH49#A7K? @(HH49" 7K?4 (HH49#7K?t4@4~H PHK K=H(49"pB 0H54Q7K?454!7K?4(HH49"p557K?44@ҶK=6?@4?: 9 @K<(H49"HL )7K?4K<(H49"pH 7K?4K(49"pH \ Hq7K?84K A (H49"pH7K?4K<(H49"pH 7K?4K>(H49"p? Ha7K?(4 4HH K<( 49"7K?4K<ّ} 4H( H 49"7K?H4x 4HH( < 49"7K?4K(49"pH H 7K?4KHH A 7K?@4܂2(HH49" 7K?P4_Y4zK?7_4K?4_a4zK?7_4K?4_)4zK?7_i4K?x4_4zK?7_!4K?04_4zK?7_4K?4_4zK?7_4K?4_4zK?7_I4K?X4_94zK?7_4K?4_I4zK?7_4K?4H8H(49#7K?x4(49"y7K?@4C@@ H@(HH49# 7K?4CH@(HH49#7K?x4@.Z(HH49"Y7K? 4Hp_4zK?K> 6V47K? 4Hp_4zK?K> 6V47K? P4_i4zK?7_ 4K? 4(HH49$7K? 4(HH49$7K? x4(HH49$0i7K? 04(HH49$@K=7K? 4(HH49$@x<7K? 4(HH49$P7K? H4K>!(H49$@HX>)7K? 4K>!K>)( XHH49$@~7K? 4(HH49$@K>!q7K? 84K>!K>)(49$@HH BX7K? 4(HH49$@@7K? 4K>(H49$@H i7K? 04K>y(H49$@H 7K?4z_4K?4zS_i4K?x4z_94K?H4(HH49$`x=57K?4K>1 Z_4K?4K<_4K?4K>9 Z_I4K?X4K>A,Z_4K? 4K>ILZ_4K?4(HH49$`x=7K?4@4? 4~_ RK>Q(H49"pH U7K?4K>Q(H49"H 7K?4K=(H49"H 7K?h4K=qH(49" 0HH@E7K?4HH7K?4@4~H @H( 49"p7K?p4( 49"m7K?04_4zK?7_4K?4K= K>Y@K<_c_4K?4K= K>a@K<_B_)4K?84_q4zK?׀7_4K?4_!4zK?׀7_4K?4(HH49"p557K?H4""2K>i6?_4K?4 a@(HH49$`58?7K?4 P@(HH49"p55@7K?H4 J(HH49"p55P-7K?4 J(HH49"p55`7K?4 (HH49"p55p}7K?@4(HH49$p57K?4@Ҙ.7?ψ K;ٍ J(HH49"p557K?}4 J(HH49"p55]7K?%4 J(HH49"p557K?44">4(HH49"p557K?e4Hp_ 4zK?K> 6V457K?4(HH49"p557K?4X  X0@Tpt $<@TX,0tx,08<@DHLPT,0PT $(,048<`d8<x|hD@Hǐ@      D \ X x     8 Pd 8@aH@@+@OGp@ǘːː\8tP @l,xj,xn(b)nWn?Qn5,b,w?nn5,b,w?nn5,b,w?nn5,b,w?Nnx,b,w?nnx,b,w?nnx,b,w?nnx,b,w?Wnx,b,w?@nx,b,w?@nx,b,w?Wn5,b,w?@n5,b,w?@n5,b,wx,txcocc@(s,b),tcocc@(b),tcxccx(s,b),tcxccx(b),tcmcc5(s,b),tcmcc5(b),tcq&(b),xcq#(b),xcxccx(s,b),tcxccx(b),tcocc@(s,b),tcocc@(b),tcmcc5(s,b),tcmcc5(b),tce<(b),xceJ(s,b),xceJ(b),xce>(b),xceK(s,b),xceK(b),xl(b),xj(s,b),xj(b),xcxccx(s,b),tcxccx(b),tcocc@(s,b),tcocc@(b),tcmcc5(s,b),tcmcc5(b),tl(b),xj(s,b),xj(b),xcxccx(s,b),tcxccx(b),tcocc@(s,b),tcocc@(b),tcmcc5(s,b),tcmcc5(b),tl(b),xj(s,b),xj(b),xcocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)cqx,&(b)cqx,#(b)cocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)cex,<(b)cex,J(s,b)cex,J(b)cex,>(b)cex,K(s,b)cex,K(b)x,l(b)x,j(s,b)x,j(b)cocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)x,l(b)x,j(s,b)x,j(b)cocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)x,l(b)x,j(s,b)x,j(b)j(s,b),xj(b),xx,j(s,b)x,j(b)cxx(s,b),tcxx(b),tcxx(s,b),tcxx(b),tcxx(s,b),tcxx(b),tcxccx(b),tcmcc5(b),tcxcdx(s,b),tcxcdx(b),tcmcd5(s,b),tcmcd5(b),tcocCx,@(b)cmcCx,V(b)cscCx,V(s,b)cscCx,V(b)cxccx(b),tcmcc5(b),tcxcdx(s,b),tcxcdx(b),tcmcd5(s,b),tcmcd5(b),tcocCx,@(s,b)cocCx,@(b)cmcCx,V(s,b)cmcCx,V(b)cxx(b),tcxx(s,b),tcxx(b),tcm5(s,b),tcm5(b),tcm5(s,b),tcm5(b),tcm5(s,b),tcm5(b),tcm5(b),tcm5(s,b),tcm5(b),tcmx,V(s,b)cmx,V(b)cmx,V(s,b)cmx,V(b)cmx,V(s,b)cmx,V(b)cmx,V(b)cscCx,V(s,b)cscCx,V(b)csx,V(s,b)csx,V(b)l(b),xj(b),xk,bk,b,Zk,bcpnXLclnXLclnW,bcgnW,bnWnW,bnW,bnx,bnx(b)n(b)cpn(b)Lcln(b)LcPn(b)n(b)clnz(S,b),Yclnz(b),Ynz(S,b)nz(b)nz(S,b)?ynx,b,w?yn5,b,w?tnx,b,w?tnx,b,w?tn5,b,w?tn5,b,w?dnx,b,w?dnx,b,w?dn5,b,w?dn5,b,w?Bnx,!,w?Bnx,B,w?bnx,!,w?bnx,Q,w?bnx,w$x?Sx,b,t?sx,b,t?sx,b,t?Lx,b,t?lx,b,t?Lx,b,t?lx,b,t?Lx,b,t?lx,b,t?Lx,b,t?lx,b,t?Ux,b,t?ux,b,tcT?Ux,b,tcT?ux,b,t?ux,b,t?ux,b,tci?Ub,tci?ub,t?ub,t?ub,tct?ai,b,xcv?ai,b,x?ai,b,x?ai,b,x?ai,b,x?ai,b,xcY?Ax,b,tcy?ax,b,tca?Ax,b,tca?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,tct?Sx,b,tct?sx,b,tcB?Sx,b,tcb?sx,b,tcv?Sx,b,tcv?sx,b,t?sx,b,t?sx,b,t?sx,b,t?sx,b,t?sx,b,t?sx,b,t?sx,b,tcv?si,b,x?si,b,x?si,b,x?Si,b,x?si,b,x?si,b,xca?Ax,.,b,tca?ax,.,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,t?ax,b,tcHx,b,tx,b,tx,*,tx,.,b,tcSb,*,tx,.,b,tcHx,b,tchx,b,tchx,b,tc*a,t?Xx,b,!,t?Xx,b,~,t?xx,b,!,t?xx,b,p,t?xx,b,t?xx,b,p,tcS?Xb,!,%,xcS?Xb,q,|,xcS?xb,!,T,xcS?xb,P,T,x?xb,T,x?xb,T,x?xb,P,T,x?xb,P,T,xcz?Xx,!,%,bcz?Xx,~,|,bcz?X5,!,%,bcz?X5,~,|,bcz?xx,!,T,bcz?xx,p,T,bcz?x5,!,T,bcz?x5,p,T,b?xx,T,b?xx,T,b?xx,p,T,b?xx,p,T,b?x5,T,b?x5,T,b?x5,p,T,b?x5,p,T,br,AcrU,tR,tU,tR,tx(s,b),t(b),tx,Sx,^xtS,tcW!,t^,tcw(s,b),x,tcw(b),x,tcw(s,b),R,tcw(b),R,t(s,b),x,t(b),x,t(s,b),R,t(b),R,t(s,b),x,t(b),x,t(s,b),R,t(b),R,tcZx(s,b),tcZx(b),tcZx(s,b),tcZx(b),tx(s,b),tx(b),tcLcZx(s,b)cLcZx(b)cZx(s,b)cZx(b)cLcZx(S,b)cLcZx(b)cZx(S,b)cZx(b)cZx(s,b)cZx(b)cZx(S,b)cZx(b)x,(s,b)x,(b)x,(S,b)x,(b)x,(s,b)x,(b)x,(S,b)x,(b)cZx(s,b)cZx(b)cZx(s,b)cZx(b)cZx(S,b)cZx(b)cZx(s,b)cZx(b)cZx(S,b)cZx(b)Dx,bx,bx,^^,xcZx(s,b)cZx(b)cZx(s,b)cZx(b)cocc@(s,b),fTcocc@(b),fTcxccx(s,b),fTcxccx(b),fTcmcc5(s,b),fTcmcc5(b),fTy(b),fecJy(b),fed(b),fecJd(b),fecocc@(s,b),ftcocc@(b),ftcxccx(s,b),ftcxccx(b),ftcmcc5(s,b),ftcmcc5(b),ftcq&(b),fxcq#(b),fxcocCfT,@(s,b)cocCfT,@(b)cxcCfT,x(s,b)cxcCfT,x(b)cmcCfT,5(s,b)cmcCfT,5(b)fE,y(b)cJfe,y(b)fe,d(b)cJfe,d(b)cocCft,@(s,b)cocCft,@(b)cxcCft,x(s,b)cxcCft,x(b)cmcCft,5(s,b)cmcCft,5(b)cqfx,&(b)cqfx,#(b)cxx(s,b),fTcxx(b),fTcxx(s,b),ftcxx(b),ftcxfT,x(s,b)cxfT,x(b)cxft,x(s,b)cxft,x(b)cxft,x(s,b)cxft,x(b)cm5(s,b),fTcm5(b),fTcm5(s,b),ftcm5(b),ftcmfT,5(s,b)cmfT,5(b)cmft,5(s,b)cmft,5(b)cmft,5(s,b)cmft,5(b)Ffa,fb,fTIfA,fB,fTFfa,fb,fTIfA,fB,fTFfa,fb,fTIfA,fB,fTFfa,fb,fTIfA,fB,fTFfa,fTFfA,fTFfa,fTFfA,fTFfa,fb,fTFfA,fB,fTFfa,fTFfA,fTFfa,fTFfA,fTFGfa,fTFGfA,fTFGfa,fTFGfA,fTFGfa,fTFGfA,fTFGfa,fTFGfA,fTIfA,fB,fC,fTIfA,fB,fC,fTFfa,fTIfA,fTFfa,fTIfA,fT{_fa,fTFGfA,fTF?ffa,fb,hI?ffA,fB,hF?ffa,fbI?ffA,fBfX,fB,fTHfi,fj,fk,fl,fmHfi,fj,fk,fl,fm,=mNv,ONv,oNtv,1Nbv,0Nx,bu,2Nucxx(s,b),tucxx(b),tucxx(s,b),tucxx(b),tucxt,x(s,b)ucxt,x(b)ucxt,x(s,b)ucxt,x(b)ucm5(s,b),tucm5(b),tucm5(s,b),tucm5(b),tucmt,5(s,b)ucmt,5(b)ucmt,5(s,b)ucmt,5(b)ucxx(s,b),tucxx(b),tucm5(s,b),tucm5(b),tucxx(s,b),tucxx(b),tucm5(s,b),tucm5(b),tucxt,x(s,b)ucxt,x(b)ucmt,5(s,b)ucmt,5(b)ucxt,x(s,b)ucxt,x(b)ucmt,5(s,b)ucmt,5(b)r0fr0fr0 ,ma ,mb ,ma ,mb ,mb ,ma ,ma ,mb Disassembler botch. acc rej acc8 rej8 acc6 acc4 acc2 ,%r2XX`hp (08@HPX`hpxXXXXXpxX HX`hX (08@HPX`hXX (HX`hpX`hpP` (Xpx (@HX`hpPX`h0 (X (08@HX`hpxX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPx4@x4@ @@ @@@@ @ @ @ @0 @@ @P @`@p @ @@ @ @@ @@ `@@ 3@ 3@ @ @ @ @(P@8P@H @X  @h  3@x 3@ @  @ L@L@ L@ \@\@\@H@H@ H@0 @@8  @@H  `3@X `3@h @@x  @@ D@D@ D@ @  @   3@  3@ @  @ @@@@ @@0 3@8 3@H @X @hp@xp@ @ @ @  @ l@l@ l@ |@|@|@(h@8h@@ h@P  `3@X `3@h @@x  @@ d@d@ d@   3@  3@ @  @ `@`@ `@ L@ L@( l@0 l@@ ( @H ( @X 0 @@h 0 @@x 8 @ 8 @ @ @ @ @ H @ H @ H @ H @ P @P @ X @( X @8 ` @H` @Xh @@hh @@xh @@h @@p 3@p 3@p @p @x @ @ @ @ @( @@8 @@H @X @h @x @ @ @ @ @@ @@ @ @ @ @@ @@( @8 @H 4@X4@` @h (@p (@x @@@  @ @ @  @ @@ @ @ @ @ @ @(@ (@ (@ (@ 0@ 8@( @@8 H@H P@X X@h `@x h@ p@ x@ @ ``@@@@@`@ @@@ @@@ @@@@@@ @@(@0@8 @@ `@H@@P @X@`  @h@p  @x@ @@  @ @  @  @  @ @  @  @ @ @ @ @ @ (@ 0 @(0@8 0 @H0@X 0@h 8 @p @@x H@ P@ X@X@ X @X@ X @X@ X@ ` @ h@ p @ x@  @ @@ @( @8 @@ @H@P @X   @` @p @@  @@ @@ @  @ @ @  @ @  @@ @ @  @( @0 @8@@@H @P@P@(X@8 X@H `@X h@` p@pp@x@ x@ @ @ @ @ @@@@@ @0 @@ @P @` @h @p @ @ @ @ @ @  @  @  @  `@ `@ `@ `@ (`@ 0?@  0?@  8 @  @@@ H`@ (P@ 0X@ 8 ``H@ @`@ H h@ P p@ X x?@ ` x?@ p 1?@ 1?@ ?@ ?@ 1?@ 1?@ ?@ ?@ 1?@ 1?@ @?@! @?@! ?@! ?@!0 ?@!@ ?@!P ?@!X?@!h?@!x ?@! @!@!@! @! @?@! @?@! @@! @@! @?@! @?@" @@" @@" ?@" ?@" @"( @"0 ?@"8 ?@"H ?@"P ?@"` @"h @"x ?@" ?@" @" @" (@" 0@"8@"@@" H@" P@6@" X@ @" `@&@" h@ @" p?@" p?@# x?@# x?@# $ 3@#($ 3@#8$@#H $@#X $@#h $@#x \@#X@#\@#X@#, 3@#, 3@#,@# ,@# ,@# ,@$ P@$P@$($ 3@$8 $ 3@$H $@$X $@$h $@$x $@$ |@$x@$|@$x@$, 3@$ , 3@$ ,@$ ,@$ ,@% ,@% p@%(p@%8$@%H $@%X ,@%h ,@%x $@% $@% ,@% ,@% <@% <@% $@% $@% ,@& ,@& $@&( $@&8 ,@&H ,@&X <@&h <@&x 0@& 8 @& 0&@& 8& @& 0F@& 8F @& 0f@& 8f @& 0@' 8 @' 0`@' 8` @' 0@'( 8 @'8 (0@'H (8 @'P 00@@'X 08@ @'` 80@'h 88 @'p @0@'x @8 @' H0@' H8 @' P0@' P8 @' X @'h @'x0@'x8 @'0@'8 @'0 @'8 @'0@'8 @(0@( 8 @(( 8G @(8 @(H @(X 0$ @(h0 @(p0$ @(x 0@( 0@(0@(@( @( @( @( 0@( $@( $@( ,@( ,@( $@) $@) ,@) ,@)0 $@)@ $@)P ,@)` ,@)p ($@) ($@) 0,@) 0,@) 8$@) 8$@) 8$@) 8$@) @,@* @,@* @,@* @,@*0H$@*@ H$@*P H$@*` H$@*p P,@* P,@* P,@* P,@* x P